hexsha string | size int64 | ext string | lang string | max_stars_repo_path string | max_stars_repo_name string | max_stars_repo_head_hexsha string | max_stars_repo_licenses list | max_stars_count int64 | max_stars_repo_stars_event_min_datetime string | max_stars_repo_stars_event_max_datetime string | max_issues_repo_path string | max_issues_repo_name string | max_issues_repo_head_hexsha string | max_issues_repo_licenses list | max_issues_count int64 | max_issues_repo_issues_event_min_datetime string | max_issues_repo_issues_event_max_datetime string | max_forks_repo_path string | max_forks_repo_name string | max_forks_repo_head_hexsha string | max_forks_repo_licenses list | max_forks_count int64 | max_forks_repo_forks_event_min_datetime string | max_forks_repo_forks_event_max_datetime string | content string | avg_line_length float64 | max_line_length int64 | alphanum_fraction float64 | qsc_code_num_words_quality_signal int64 | qsc_code_num_chars_quality_signal float64 | qsc_code_mean_word_length_quality_signal float64 | qsc_code_frac_words_unique_quality_signal float64 | qsc_code_frac_chars_top_2grams_quality_signal float64 | qsc_code_frac_chars_top_3grams_quality_signal float64 | qsc_code_frac_chars_top_4grams_quality_signal float64 | qsc_code_frac_chars_dupe_5grams_quality_signal float64 | qsc_code_frac_chars_dupe_6grams_quality_signal float64 | qsc_code_frac_chars_dupe_7grams_quality_signal float64 | qsc_code_frac_chars_dupe_8grams_quality_signal float64 | qsc_code_frac_chars_dupe_9grams_quality_signal float64 | qsc_code_frac_chars_dupe_10grams_quality_signal float64 | qsc_code_frac_chars_replacement_symbols_quality_signal float64 | qsc_code_frac_chars_digital_quality_signal float64 | qsc_code_frac_chars_whitespace_quality_signal float64 | qsc_code_size_file_byte_quality_signal float64 | qsc_code_num_lines_quality_signal float64 | qsc_code_num_chars_line_max_quality_signal float64 | qsc_code_num_chars_line_mean_quality_signal float64 | qsc_code_frac_chars_alphabet_quality_signal float64 | qsc_code_frac_chars_comments_quality_signal float64 | qsc_code_cate_xml_start_quality_signal float64 | qsc_code_frac_lines_dupe_lines_quality_signal float64 | qsc_code_cate_autogen_quality_signal float64 | qsc_code_frac_lines_long_string_quality_signal float64 | qsc_code_frac_chars_string_length_quality_signal float64 | qsc_code_frac_chars_long_word_length_quality_signal float64 | qsc_code_frac_lines_string_concat_quality_signal float64 | qsc_code_cate_encoded_data_quality_signal float64 | qsc_code_frac_chars_hex_words_quality_signal float64 | qsc_code_frac_lines_prompt_comments_quality_signal float64 | qsc_code_frac_lines_assert_quality_signal float64 | qsc_codepython_cate_ast_quality_signal float64 | qsc_codepython_frac_lines_func_ratio_quality_signal float64 | qsc_codepython_cate_var_zero_quality_signal bool | qsc_codepython_frac_lines_pass_quality_signal float64 | qsc_codepython_frac_lines_import_quality_signal float64 | qsc_codepython_frac_lines_simplefunc_quality_signal float64 | qsc_codepython_score_lines_no_logic_quality_signal float64 | qsc_codepython_frac_lines_print_quality_signal float64 | qsc_code_num_words int64 | qsc_code_num_chars int64 | qsc_code_mean_word_length int64 | qsc_code_frac_words_unique null | qsc_code_frac_chars_top_2grams int64 | qsc_code_frac_chars_top_3grams int64 | qsc_code_frac_chars_top_4grams int64 | qsc_code_frac_chars_dupe_5grams int64 | qsc_code_frac_chars_dupe_6grams int64 | qsc_code_frac_chars_dupe_7grams int64 | qsc_code_frac_chars_dupe_8grams int64 | qsc_code_frac_chars_dupe_9grams int64 | qsc_code_frac_chars_dupe_10grams int64 | qsc_code_frac_chars_replacement_symbols int64 | qsc_code_frac_chars_digital int64 | qsc_code_frac_chars_whitespace int64 | qsc_code_size_file_byte int64 | qsc_code_num_lines int64 | qsc_code_num_chars_line_max int64 | qsc_code_num_chars_line_mean int64 | qsc_code_frac_chars_alphabet int64 | qsc_code_frac_chars_comments int64 | qsc_code_cate_xml_start int64 | qsc_code_frac_lines_dupe_lines int64 | qsc_code_cate_autogen int64 | qsc_code_frac_lines_long_string int64 | qsc_code_frac_chars_string_length int64 | qsc_code_frac_chars_long_word_length int64 | qsc_code_frac_lines_string_concat null | qsc_code_cate_encoded_data int64 | qsc_code_frac_chars_hex_words int64 | qsc_code_frac_lines_prompt_comments int64 | qsc_code_frac_lines_assert int64 | qsc_codepython_cate_ast int64 | qsc_codepython_frac_lines_func_ratio int64 | qsc_codepython_cate_var_zero int64 | qsc_codepython_frac_lines_pass int64 | qsc_codepython_frac_lines_import int64 | qsc_codepython_frac_lines_simplefunc int64 | qsc_codepython_score_lines_no_logic int64 | qsc_codepython_frac_lines_print int64 | effective string | hits int64 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
68b74c13aa2276f42386e385f34a0bbb9009ebfe | 210 | py | Python | trampolino/__init__.py | matteomancini/trampolino | af904844404f97c49e0452527b01fd9f415677ba | [
"MIT"
] | 3 | 2020-06-17T09:25:22.000Z | 2021-06-22T23:16:53.000Z | trampolino/__init__.py | matteomancini/trampolino | af904844404f97c49e0452527b01fd9f415677ba | [
"MIT"
] | 1 | 2020-06-26T08:47:01.000Z | 2020-07-21T14:02:40.000Z | trampolino/__init__.py | matteomancini/trampolino | af904844404f97c49e0452527b01fd9f415677ba | [
"MIT"
] | 3 | 2020-06-16T11:55:50.000Z | 2020-11-25T01:37:17.000Z | # -*- coding: utf-8 -*-
"""Top-level package for Tractography Meta-Pipeline Command Line Tool (TRAMPOLINO)."""
__author__ = """Matteo Mancini"""
__email__ = 'ingmatteomancini@gmail.com'
__version__ = '0.1.9'
| 26.25 | 86 | 0.7 | 25 | 210 | 5.4 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.021739 | 0.12381 | 210 | 7 | 87 | 30 | 0.711957 | 0.490476 | 0 | 0 | 0 | 0 | 0.445545 | 0.257426 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
68bd351718db1fa4aa791850b81f6102d0eaa5af | 242 | py | Python | welut_demo/app/admin.py | agusmakmun/welut | ee176b51d4637691a616a17eb0491c933211799a | [
"MIT"
] | 6 | 2017-11-17T10:34:27.000Z | 2022-01-06T14:17:23.000Z | welut_demo/app/admin.py | agusmakmun/welut | ee176b51d4637691a616a17eb0491c933211799a | [
"MIT"
] | 2 | 2017-12-06T14:40:31.000Z | 2020-08-15T10:41:11.000Z | welut_demo/app/admin.py | agusmakmun/welut | ee176b51d4637691a616a17eb0491c933211799a | [
"MIT"
] | 7 | 2017-11-13T20:47:05.000Z | 2020-06-04T03:20:13.000Z | # -*- coding: utf-8 -*-
from __future__ import unicode_literals
from django.contrib import admin
from app.models import EBook
class EbookAdmin(admin.ModelAdmin):
raw_id_fields = ['ebook_file']
admin.site.register(EBook, EbookAdmin)
| 17.285714 | 39 | 0.756198 | 32 | 242 | 5.46875 | 0.71875 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.004808 | 0.140496 | 242 | 13 | 40 | 18.615385 | 0.836538 | 0.086777 | 0 | 0 | 0 | 0 | 0.045662 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.5 | 0 | 0.833333 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
68bdc4c0b6f174517fe0db4eaa6dd654aa09ddfc | 209 | py | Python | dm2bn/__init__.py | DCOD-OpenSource/django-messages-to-bootstrap-notify | 8d9f60dc1111961984bc33f1ec0efc3265c5c7a8 | [
"MIT"
] | 11 | 2017-05-16T15:22:13.000Z | 2019-02-13T21:43:13.000Z | dm2bn/__init__.py | DCOD-OpenSource/django-messages-to-bootstrap-notify | 8d9f60dc1111961984bc33f1ec0efc3265c5c7a8 | [
"MIT"
] | null | null | null | dm2bn/__init__.py | DCOD-OpenSource/django-messages-to-bootstrap-notify | 8d9f60dc1111961984bc33f1ec0efc3265c5c7a8 | [
"MIT"
] | null | null | null | # -*- coding: utf-8 -*-
# django-messages-to-bootstrap-notify
# dm2bn/__init__.py
from __future__ import unicode_literals
__all__ = [
"default_app_config",
]
default_app_config = "dm2bn.apps.Config"
| 13.933333 | 40 | 0.717703 | 26 | 209 | 5.115385 | 0.807692 | 0.150376 | 0.240602 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.016854 | 0.148325 | 209 | 14 | 41 | 14.928571 | 0.730337 | 0.358852 | 0 | 0 | 0 | 0 | 0.269231 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.2 | 0 | 0.2 | 0 | 1 | 0 | 0 | null | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
68d66d2618332f95369f465a3be1e10a223c535f | 1,556 | py | Python | ProjectApplication/project_core/filters.py | code-review-doctor/project-application | d85b40b69572efbcda24ce9c40803f76d8ffd192 | [
"MIT"
] | null | null | null | ProjectApplication/project_core/filters.py | code-review-doctor/project-application | d85b40b69572efbcda24ce9c40803f76d8ffd192 | [
"MIT"
] | null | null | null | ProjectApplication/project_core/filters.py | code-review-doctor/project-application | d85b40b69572efbcda24ce9c40803f76d8ffd192 | [
"MIT"
] | null | null | null | from functools import reduce
from operator import or_
from django.db.models import Q
from django_filters.rest_framework import CharFilter, FilterSet
from project_core.models import Project
class ProjectFilterSet(FilterSet):
key_any = CharFilter(method='filter_any', label="Key, Title, Keyword, PI, Lay summary or Organisation")
geographical_areas = CharFilter(method='filter_geographical_areas')
funding_instrument = CharFilter(method='filter_funding_instrument')
start_date = CharFilter(method='filter_start_date')
def filter_any(self, queryset, name, value):
fields = [
"key", "title", "keywords__name",
"principal_investigator__person__first_name",
"principal_investigator__person__surname",
"laysummary__text", "principal_investigator__organisation_names__name"
]
q_field = reduce(or_, (Q(**{f"{field}__icontains": word}) for word in value.split() for field in fields))
return queryset.filter(q_field).distinct()
def filter_geographical_areas(self, queryset, name, value):
return queryset.filter(geographical_areas__name=value)
def filter_funding_instrument(self, queryset, name, value):
return queryset.filter(funding_instrument__long_name=value)
def filter_start_date(self, queryset, name, value):
return queryset.filter(start_date__year__lte=value, end_date__year__gte=value)
class Meta:
model = Project
fields = ('key_any', 'geographical_areas', 'funding_instrument', 'start_date')
| 39.897436 | 113 | 0.732648 | 184 | 1,556 | 5.820652 | 0.36413 | 0.05042 | 0.082166 | 0.078431 | 0.114846 | 0.114846 | 0.114846 | 0 | 0 | 0 | 0 | 0 | 0.17545 | 1,556 | 38 | 114 | 40.947368 | 0.834762 | 0 | 0 | 0 | 0 | 0 | 0.235861 | 0.115039 | 0 | 0 | 0 | 0 | 0 | 1 | 0.142857 | false | 0 | 0.178571 | 0.107143 | 0.678571 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 2 |
68dceef9e17ce3214519730ed94a8ee6e47a04f0 | 2,335 | py | Python | quote_bot/settings.py | civsocit/quote-bot | 88d8161e93a8b855f984931c412f70bac12f2286 | [
"MIT"
] | 1 | 2021-09-27T05:11:37.000Z | 2021-09-27T05:11:37.000Z | quote_bot/settings.py | civsocit/quote-bot | 88d8161e93a8b855f984931c412f70bac12f2286 | [
"MIT"
] | null | null | null | quote_bot/settings.py | civsocit/quote-bot | 88d8161e93a8b855f984931c412f70bac12f2286 | [
"MIT"
] | null | null | null | import os
from os.path import abspath, dirname, join
from typing import Tuple
from dotenv import load_dotenv
load_dotenv()
class BotSettings:
@classmethod
def token(cls) -> str:
token = os.getenv("TOKEN")
if not token:
raise ValueError("Token must be specified (missing .env file or TOKEN environment variable?)")
return token
@classmethod
def access_chat_id(cls) -> int:
chat = os.getenv("CHAT")
if not chat:
raise ValueError("Access chat ID must be specified (missing .env file or CHAT environment variable?)")
return int(chat)
@classmethod
def access_cache_ttl(cls) -> int:
return 60 # in seconds
@classmethod
def dynamo_region(cls) -> str:
return "us-east-1"
class DesignerSettings:
@classmethod
def path_to_font(cls) -> str:
return join(abspath(dirname(__file__)), "designer", "Montserrat-SemiBold.ttf")
@classmethod
def path_to_caption_font(cls) -> str:
return join(abspath(dirname(__file__)), "designer", "Montserrat-ExtraBold.ttf")
@classmethod
def caption_fixed_font_size(cls) -> int:
return 65
@classmethod
def text_color_light(cls) -> Tuple[int, int, int]:
return 0xE1, 0xE6, 0xEB
@classmethod
def text_color_dark(cls) -> Tuple[int, int, int]:
return 0x19, 0x2D, 0x44
@classmethod
def background_color_dark(cls) -> Tuple[int, int, int]:
return 0x00, 0x00, 0x00
@classmethod
def background_color_light(cls) -> Tuple[int, int, int]:
return 0xE1, 0xE6, 0xEB
@classmethod
def text_position(cls) -> Tuple[float, float, float, float]:
# Relative position x0, y0, x1, y1
return 0.09375, 0.25555, 0.90625, 0.66666
@classmethod
def caption_text_position(cls) -> Tuple[float, float, float, float]:
return 0.5 / 16, 0.4 / 9, 6 / 16, 1 / 9
@classmethod
def default_width(cls) -> int:
# A3 size 16.54 inh with 200 DPI
# Warning: Pillow uses discrete scale factor, so, 150 or 170 DPI may be equal
return int(16.54 * 200.0)
@classmethod
def default_preview_width(cls) -> int:
# A7 size 4.13 inh with 150 DPI
return 620
@classmethod
def max_font_size(cls) -> int:
return 150
| 27.151163 | 114 | 0.634261 | 310 | 2,335 | 4.651613 | 0.36129 | 0.15534 | 0.030513 | 0.038835 | 0.332871 | 0.305132 | 0.305132 | 0.262136 | 0.165049 | 0.165049 | 0 | 0.062354 | 0.265096 | 2,335 | 85 | 115 | 27.470588 | 0.777972 | 0.077088 | 0 | 0.295082 | 0 | 0 | 0.110284 | 0.021871 | 0 | 0 | 0.022336 | 0 | 0 | 1 | 0.262295 | false | 0 | 0.065574 | 0.229508 | 0.622951 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 2 |
68e1a458c31e0c524390fe908d2955573ee29cfe | 78,246 | py | Python | cfdi/cfdi/doctype/cfdi/cfdi.py | dacosta2213/cfdi | d383940cb1b333207fce9c2e70d55907dd441ca1 | [
"MIT"
] | null | null | null | cfdi/cfdi/doctype/cfdi/cfdi.py | dacosta2213/cfdi | d383940cb1b333207fce9c2e70d55907dd441ca1 | [
"MIT"
] | null | null | null | cfdi/cfdi/doctype/cfdi/cfdi.py | dacosta2213/cfdi | d383940cb1b333207fce9c2e70d55907dd441ca1 | [
"MIT"
] | null | null | null | # -*- coding: utf-8 -*-
# Copyright (c) 2015, C0D1G0 B1NAR10 and contributors
# For license information, please see license.txt
from __future__ import unicode_literals
import frappe
from frappe.model.document import Document
from frappe.utils.file_manager import save_url
from frappe.model.mapper import get_mapped_doc
from frappe.utils import cint, flt
import shutil
import os
import sys
import time
import base64
from watchdog.observers import Observer
from watchdog.events import FileSystemEventHandler
import threading
from xml.dom import minidom
import requests
from datetime import datetime
import collections
import random
import string
from datetime import date
from datetime import *
import re
class CFDI(Document):
pass
@frappe.whitelist()
def ticket(source_name, target_doc=None):
doclist = get_mapped_doc("Sales Invoice", source_name, {
"Sales Invoice": {
"doctype": "CFDI",
"field_map": {
"name": "ticket",
}
},
"Sales Invoice Item": {
"doctype": "CFDI Item",
"field_map": {
"rate": "precio_de_venta",
"net_rate": "precio_unitario_neto",
"amount": "monto",
"parent": "fuente",
"net_amount": "precio_neto",
# "impuesto": "tax",
}
}
}, target_doc)
return doclist
# RG - Inicia SmarterWEb
@frappe.whitelist()
def validar_rfc(url, token, rfc):
headers = {
'Authorization': "bearer " + token,
'Content-Type': "application/json"
}
response = requests.request("GET", url + "/lrfc/" + rfc, headers=headers)
frappe.errprint(response.text)
return response.text
@frappe.whitelist()
def cancel_by_uuid(url, token,docname, rfc, uuid):
# frappe.errprint(rfc)
c = frappe.get_doc("CFDI", docname)
headers = {
'Authorization': "bearer " + token,
'Content-Type': "application/json"
}
response = requests.request("POST", url + "/cfdi33/cancel/" + rfc + "/" + uuid, headers=headers)
if response.json().get('status') == 'error':
frappe.msgprint((response.json().get('message')), "ERROR ENCONTRADO AL TIMBRAR")
else:
for d in c.items:
frappe.db.set_value("Sales Invoice",d.fuente , 'cfdi_status', 'Sin Timbrar')
return response.text
@frappe.whitelist()
def cancel_by_uuid_pago(docname):
c = frappe.get_doc("Payment Entry", docname)
uuid = c.uuid_pago
d = frappe.get_doc("Configuracion CFDI", c.company)
url = 'http://' + d.url
token = d.token
rfc = d.rfc_emisor
headers = {
'Authorization': "bearer " + token,
'Content-Type': "application/json"
}
response = requests.request("POST", url + "/cfdi33/cancel/" + rfc + "/" + uuid, headers=headers)
if response.json().get('status') == 'error':
frappe.msgprint((response.json().get('message')), "ERROR ENCONTRADO AL TIMBRAR")
else:
frappe.db.set_value("Payment Entry",c.name, 'cfdi_status', 'Cancelado')
frappe.msgprint(str(c.name) + " Cancelada exitosamente " )
return response.text
@frappe.whitelist()
def cancel_by_uuid_egreso(url, token,docname, rfc, uuid):
c = frappe.get_doc("CFDI Nota de Credito", docname)
headers = {
'Authorization': "bearer " + token,
'Content-Type': "application/json"
}
response = requests.request("POST", url + "/cfdi33/cancel/" + rfc + "/" + uuid, headers=headers)
if response.json().get('status') == 'error':
frappe.msgprint((response.json().get('message')), "ERROR ENCONTRADO AL CANCELAR")
else:
frappe.db.set_value("CFDI Nota de Credito",c.name, 'cfdi_status', 'Cancelado')
frappe.msgprint(str(c.name) + " Cancelada exitosamente " )
return response.text
# RG - Timbrado de CFDI
@frappe.whitelist()
def issue(url, token, docname, version, b64=False):
# RG - POST request al server de swarterweb
xml = genera_xml(docname)
boundary = "----=_Part_11_11939969.1490230712432" #RG- declararlo como en issue_pago
payload = "--" + boundary + "\r\nContent-Type: text/xml\r\nContent-Transfer-Encoding: binary\r\nContent-Disposition: " \
"form-data; name=\"xml\"; filename=\"xml\"\r\n\r\n" + str(xml) + "\r\n--" + boundary + "-- "
headers = {
'Authorization': "bearer " + token,
'Content-Type': "multipart/form-data; boundary=\"" + boundary + "\""
}
response = requests.request("POST", url + "/cfdi33/issue/" + version + "/" , data=payload.encode('utf-8'), headers=headers)
liga = url + "/cfdi33/issue/" + version + "/"
frappe.errprint(response.json()) #RG - para ver la respuesta en la consola
frappe.errprint(payload)
frappe.errprint(headers)
frappe.errprint(liga)
if response.json().get('status') == 'error': #RG - Ver si podemos manejar con una funcion separada el error
if response.json().get('messageDetail'):
frappe.msgprint((response.json().get('message')) + ". <b>Detalle del Error: </b>" + (response.json().get('messageDetail')), "ERROR DE SERVIDOR (PAC) ")
else:
frappe.msgprint((response.json().get('message')) , "ERROR DE SERVIDOR")
else:
# RG- Recuperar el response y manejar la info pa grabar los archivos/datos en el CFDI
c = frappe.get_doc("CFDI", docname)
fechaxml = str(c.creation)
# webfolder = c.folder
uuid = response.json().get('data').get('uuid')
# generar xml
cfdi_recibido = response.json().get('data').get('cfdi')
dest = '/home/frappe/frappe-bench/sites/' + frappe.local.site + '/public/files/' + c.name + "_" + fechaxml[0:10]
f = open( dest + '.xml',"w+")
f.write(cfdi_recibido)
f.close()
save_url( "/files/" + '/public/files/' + c.name + "_" + fechaxml[0:10] + ".xml" , c.name + "_" + fechaxml[0:10] + ".xml" , "CFDI" , c.name , "Home/Attachments" , 0)
# EscribirPNG
qr = response.json().get('data').get('qrCode')
png = open( dest + ".png", "wb")
png.write(base64.b64decode(qr))
png.close()
frappe.db.set_value("CFDI",c.name, 'qr', "/files/" + c.name + "_" + fechaxml[0:10] + ".png")
# escribir todos los demas campos
frappe.db.set_value("CFDI",c.name, 'cfdi_status', 'Timbrado')
for d in c.items:
frappe.db.set_value("Sales Invoice", d.fuente , 'cfdi_status', 'Timbrado')
frappe.db.set_value("CFDI",c.name, 'SelloCFD', response.json().get('data').get('selloCFDI'))
frappe.db.set_value("CFDI",c.name, 'cadenaOriginalSAT', response.json().get('data').get('cadenaOriginalSAT'))
frappe.db.set_value("CFDI",c.name, 'FechaTimbrado', response.json().get('data').get('fechaTimbrado') )
frappe.db.set_value("CFDI",c.name, 'uuid', uuid)
frappe.db.set_value("CFDI",c.name, 'NoCertificadoSAT', response.json().get('data').get('noCertificadoSAT') )
frappe.db.set_value("CFDI",c.name, 'SelloSAT', response.json().get('data').get('selloSAT') )
# frappe.msgprint(str(c.name) + " Timbrada exitosamente " )
mensaje = str(c.name)+" TIMBRADO EXITOSO . <a class= 'alert-info' href='https://" + frappe.local.site + "/files/" + c.name + "_" + fechaxml[0:10] + ".xml' download> Descarga XML </a>"
frappe.msgprint(mensaje)
return response.json()
def genera_xml(docname):
tieneiva = 0
notieneiva = 0
c = frappe.get_doc("CFDI", docname)
cant = len(c.items)
mytime = datetime.strptime('0800','%H%M').time()
#fecha_actual = datetime.combine(c.posting_date,mytime).isoformat()[0:19] #dacosta - para hacer que se timbre con la fecha de posting_date
fecha_actual = (datetime.now()- timedelta(minutes=480)).isoformat()[0:19]
# fecha_actual = (datetime.now()- timedelta(minutes=360)).isoformat()[0:19]
# fecha_obj = datetime.strptime(c.creation, "%Y-%m-%d %H:%M:%S.%f")
# fecha_actual = fecha_obj.isoformat()[0:19]
serie = c.naming_series.replace('-','')
folio = c.name.replace(serie,'')
FormaPago = c.forma_de_pago
SubTotal = 0
# Falta descuento
Total = '%.2f' % c.total
TipoDeComprobante = c.tipo_de_comprobante
MetodoPago = c.metodo_pago
LugarExpedicion = c.lugar_expedicion
NoCertificado = c.no_certificado
rfc_emisor = c.rfc_emisor
nombre_emisor = c.nombre_emisor
regimen_fiscal = c.regimen_fiscal
tax_id = c.tax_id.replace('&','&')
# nombre_receptor = c.customer_name.encode('ascii', 'ignore').decode('ascii')
# nombre_receptor = c.customer_name.encode('UTF-8', 'ignore')
# nombre_receptor = c.customer_name.decode('UTF-8')
nombre_receptor = c.customer_name.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ').replace('Ñ','N').replace('ñ','n').replace('Ü', 'U')
tipo = []
tasa = []
cantidad = []
cfdi_items = ""
cfdi_traslados = ""
for d in c.items:
NoIdentificacion = d.item_code.replace('"','')
ClaveProdServ = d.clave_producto
ClaveUnidad = d.clave_unidad
Cantidad = d.qty
Unidad = d.stock_uom
ValorUnitario = '%.2f' % d.precio_unitario_neto
Importe = '%.2f' % d.precio_neto
idx = d.idx
Descripcion = d.item_name
SubTotal = round(SubTotal + float(d.precio_neto), 2)
if d.tipo_de_impuesto == "IVA":
TrasladosBase = '%.2f' % d.precio_neto
Impuesto = "002"
TasaOCuota = .01 * float(d.tax)
ImpuestosTrasladosTasaOCuota='%.6f' % TasaOCuota
Importetax = '%.2f' % (TasaOCuota * float(d.precio_neto))
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
elif d.tipo_de_impuesto == "IEPS":
TrasladosBase = '%.2f' % d.precio_neto
Impuesto="003"
TasaOCuota = .01 * float(d.tax)
ImpuestosTrasladosTasaOCuota='%.6f' % TasaOCuota
Importetax = '%.2f' % (TasaOCuota * float(d.precio_neto))
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
else:
notieneiva = 1
TrasladosBase= '%.2f' % d.precio_neto
Impuesto="002"
TasaOCuota="0.000000"
Importetax= "0.00"
cfdi_items += """
<cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}" Descuento="0.00">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="Tasa" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
uso_cfdi = c.uso_cfdi
cTipo = collections.Counter(tipo)
cTasa = collections.Counter(tasa)
total_impuesto = 0
TotalImpuestosTrasladados = 0.0
for w, val1 in cTipo.items():
for y, val2 in cTasa.items():
suma = 0.0
for z in range(0,cant):
if (tasa[z] == y) and (tipo[z] == w):
suma = suma+float(cantidad[z])
b = y
t = w
total_impuesto = total_impuesto + suma
TotalImpuestosTrasladados = round(suma,2)
# total_impuesto = '%.2f' % total_impuesto1
if(suma>0):
cfdi_traslados += """
<cfdi:Traslado Impuesto="{t}" TipoFactor="Tasa" TasaOCuota="{b}" Importe="{TotalImpuestosTrasladados}"/>""".format(**locals())
else:
cfdi_traslados += """
<cfdi:Traslado Impuesto="{t}" TipoFactor="Tasa" TasaOCuota="{b}" Importe="{suma}"/>""".format(**locals())
Total = round(SubTotal + TotalImpuestosTrasladados, 2)
cfdi = """<?xml version="1.0" encoding="UTF-8"?>
<cfdi:Comprobante xmlns:cfdi="http://www.sat.gob.mx/cfd/3" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.sat.gob.mx/cfd/3 http://www.sat.gob.mx/sitio_internet/cfd/3/cfdv33.xsd"
Version="3.3" Serie="{serie}" Folio="{folio}" Fecha="{fecha_actual}" Sello="" FormaPago="{FormaPago}" NoCertificado=""
Certificado="" CondicionesDePago="CONTADO" SubTotal="{SubTotal}" Descuento="0.00" Moneda="MXN" Total="{Total}" TipoDeComprobante="{TipoDeComprobante}" MetodoPago="{MetodoPago}" LugarExpedicion="{LugarExpedicion}">
<cfdi:Emisor Rfc="{rfc_emisor}" Nombre="{nombre_emisor}" RegimenFiscal="{regimen_fiscal}"/>
<cfdi:Receptor Rfc="{tax_id}" Nombre="{nombre_receptor}" UsoCFDI="{uso_cfdi}"/>
<cfdi:Conceptos>""".format(**locals())
cfdi += cfdi_items
cfdi_conceptos = """
</cfdi:Conceptos>
<cfdi:Impuestos TotalImpuestosTrasladados="{TotalImpuestosTrasladados}">
<cfdi:Traslados> """.format(**locals())
cfdi += cfdi_conceptos
cfdi += cfdi_traslados
cfdi += """
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Comprobante>
""".format(**locals())
frappe.errprint(cfdi)
return cfdi
# RG- Para los complementos de pago (REP)
@frappe.whitelist()
def issue_pago(url, token, docname, version,user_id,user_password,folder,nombre_emisor,no_certificado, b64=False):
# RG - POST request al server de swarterweb
xml = genera_xml_pago(docname,url,user_id,user_password,folder,nombre_emisor,no_certificado)
frappe.errprint(xml)
# boundary = "----=_Part_11_11939969.1490230712432"
lst = [random.choice(string.ascii_letters + string.digits) for n in range(30)]
boundary = "".join(lst)
payload = "--" + boundary + "\r\nContent-Type: text/xml\r\nContent-Transfer-Encoding: binary\r\nContent-Disposition: form-data; name=\"xml\"; filename=\"xml\"\r\n\r\n" + str(xml) + "\r\n--" + boundary + "-- "
headers = {
'Authorization': "bearer " + token,
'Content-Type': "multipart/form-data; boundary=\"" + boundary + "\""
}
response = requests.request("POST", url + "/cfdi33/issue/" + version + "/" , data=payload.encode('utf-8'), headers=headers, timeout=300)
liga = url + "/cfdi33/issue/" + version + "/"
if response.json().get('status') == 'error':
if response.json().get('messageDetail'):
frappe.msgprint((response.json().get('message')) + ". <b>Detalle del Error: </b>" + (response.json().get('messageDetail')), "ERROR DE SERVIDOR (PAC) ")
else:
frappe.msgprint((response.json().get('message')) , "ERROR DE SERVIDOR")
else:
c = frappe.get_doc("Payment Entry", docname)
# webfolder = c.folder
uuid = response.json().get('data').get('uuid')
fechaxml = str(c.creation)
# generar xml
cfdi_recibido = response.json().get('data').get('cfdi')
dest = '/home/frappe/frappe-bench/sites/' + frappe.local.site + '/public/files/' + c.name + "_" + fechaxml[0:10]
f = open( dest + '.xml',"w+")
f.write(cfdi_recibido)
f.close()
save_url( "/files/" + c.name + "_" + fechaxml[0:10] + ".xml" , c.name + "_" + fechaxml[0:10] + ".xml" , "Payment Entry" , c.name , "Home/Attachments" , 0)
# EscribirPNG
qr = response.json().get('data').get('qrCode')
png = open( dest + ".png", "wb")
png.write(base64.b64decode(qr))
png.close()
frappe.db.set_value("Payment Entry",c.name, 'qr', "/files/" + c.name + "_" + fechaxml[0:10] + ".png")
# escribir todos los demas campos
frappe.db.set_value("Payment Entry",c.name, 'cfdi_status', 'Timbrado')
frappe.db.set_value("Payment Entry",c.name, 'SelloCFD', response.json().get('data').get('selloCFDI'))
frappe.db.set_value("Payment Entry",c.name, 'cadenaOriginalSAT', response.json().get('data').get('cadenaOriginalSAT'))
frappe.db.set_value("Payment Entry",c.name, 'FechaTimbrado', response.json().get('data').get('fechaTimbrado') )
frappe.db.set_value("Payment Entry",c.name, 'uuid_pago', uuid)
frappe.db.set_value("Payment Entry",c.name, 'NoCertificadoSAT', response.json().get('data').get('noCertificadoSAT') )
frappe.db.set_value("Payment Entry",c.name, 'SelloSAT', response.json().get('data').get('selloSAT') )
frappe.msgprint(str(c.name) + " Timbrada exitosamente " )
return response.json()
def genera_xml_pago(docname, url,user_id,user_password,folder,nombre_emisor,no_certificado):
Fecha = (datetime.now()- timedelta(minutes=480)).isoformat()[0:19]
c = frappe.get_doc("Payment Entry", docname)
cliente = frappe.get_doc("Customer", c.party_name)
# if frappe.local.site == "demo.totall.mx":
Fecha = c.fecha.isoformat()[0:19] if c.fecha else (datetime.now()- timedelta(minutes=480)).isoformat()[0:19]
#si = frappe.get_doc(tipo, invoice)
#SerieCFDI = si.naming_series
#FolioCFDI = si.name
url_timbrado = url
user_id = user_id
user_password = user_password
webfolder =folder
RegimenFiscal = c.regimen_fiscal
if c.es_factoraje == 1:
b = frappe.get_doc("Bank", c.banco)
RfcReceptor = b.tax_id.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ').replace('Ü', 'U')
else:
RfcReceptor = cliente.tax_id.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ').replace('Ü', 'U')
#########+++++++++++++++++SE COMENTARON LOS .replace DE LAS LINEAS 382 Y 214
if c.es_factoraje == 1:
NombreReceptor = c.banco
else:
NombreReceptor = c.party_name.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ').replace('Ü', 'U')
LugarExpedicion = c.lugar_expedicion
mytime = datetime.strptime('1200','%H%M').time()
FechaContabilizacion = datetime.combine(c.posting_date,mytime).isoformat()[0:19]
Serie = c.naming_series.replace('-','')
Folio = c.name.replace(Serie,'')
rfc_emisor = c.rfc_emisor
nombre_emisor = nombre_emisor
NoCertificado = no_certificado
FormaDePagoP = c.forma_de_pago
Monto = '%.2f' % c.received_amount
IdDocumento = c.documento_relacionado
# Currency = c.paid_from_account_currency
#TipoCambio = 1 if c.currency == "MXN" else '%2f' % c.source_enchange_rate
MetodoDePagoDR = c.metodo_pago_cfdi
NumOperacion = c.reference_no
# ImpSaldoAnt = '%.2f' % c.references[0].outstanding_amount
ImpSaldoAnt = '%.2f' % c.impsaldoanterior
# ImpSaldoInsoluto = '%.2f' % (c.references[0].outstanding_amount - c.received_amount )
ImpSaldoInsoluto = '%.2f' % (c.impsaldoanterior - c.received_amount )
cfdi_pago= """<?xml version="1.0" encoding="utf-8" ?>
<cfdi:Comprobante xmlns:cfdi="http://www.sat.gob.mx/cfd/3"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance"
xmlns:pago10="http://www.sat.gob.mx/Pagos" xsi:schemaLocation=" http://www.sat.gob.mx/cfd/3 http://www.sat.gob.mx/sitio_internet/cfd/3/cfdv33.xsd http://www.sat.gob.mx/Pagos http://www.sat.gob.mx/sitio_internet/cfd/Pagos/Pagos10.xsd" Version="3.3"
Serie="{Serie}" Folio="{Folio}" Fecha="{Fecha}" Sello="" NoCertificado="{NoCertificado}" Certificado="" SubTotal="0" Moneda="XXX" Total="0" TipoDeComprobante="P" LugarExpedicion="{LugarExpedicion}">
<cfdi:Emisor Rfc="{rfc_emisor}" Nombre="{nombre_emisor}" RegimenFiscal="{RegimenFiscal}"/>
<cfdi:Receptor Rfc="{RfcReceptor}" Nombre="{NombreReceptor}" UsoCFDI="P01"/>
<cfdi:Conceptos>
<cfdi:Concepto ClaveProdServ="84111506" Cantidad="1" ClaveUnidad="ACT" Descripcion="Pago" ValorUnitario="0" Importe="0">
</cfdi:Concepto>
</cfdi:Conceptos>
<cfdi:Complemento>
<pago10:Pagos Version="1.0">""".format(**locals())
# MonedaP= c.moneda
TipoCambioP = c.target_exchange_rate
MonedaP = c.paid_to_account_currency
if MonedaP != 'MXN': # Si el Pago es diferente a MXN
cfdi_pago+="""
<pago10:Pago FechaPago="{FechaContabilizacion}" FormaDePagoP="{FormaDePagoP}" TipoCambioP ="{TipoCambioP}" MonedaP="{MonedaP}" Monto="{Monto}" NumOperacion="{NumOperacion}">""".format(**locals())
else:
cfdi_pago+="""
<pago10:Pago FechaPago="{FechaContabilizacion}" FormaDePagoP="{FormaDePagoP}" MonedaP="MXN" Monto="{Monto}" NumOperacion="{NumOperacion}">""".format(**locals())
for x in c.references:
si = frappe.get_doc('Sales Invoice', x.reference_name)
MonedaDR = si.currency
# if MonedaDR != MonedaP:
# frappe.throw('Las moneda del documento original es diferente a la moneda de pago. Documento Original: ' + str(si.name))
TipoCambioDR = None if si.currency == "MXN" else ('%2f' % si.conversion_rate)
# TipoCambioDR = None
IdDocumento = x.uuid
SerieCFDI = si.naming_series
FolioCFDI = si.name.replace(SerieCFDI,'')
MetodoPago = si.metodo_pago
ImpSaldoAnt = '%.2f' % x.monto_pendiente
ImpPagado = '%.2f' % x.pagado
parc = 0
frappe.errprint(x.reference_name)
parcialidades = frappe.db.sql("""SELECT * from `tabPayment Entry Reference` WHERE reference_name = %s AND docstatus = 1""",(x.reference_name),as_dict=1)
for conteo in parcialidades:
parc += 1
ImpSaldoInsoluto= '%.2f' % (float(ImpSaldoAnt) - float(ImpPagado))
frappe.db.set_value("Sales Invoice",si.name, 'monto_pendiente', ImpSaldoInsoluto)
frappe.errprint(IdDocumento)
cfdi_pago+="""
<pago10:DoctoRelacionado IdDocumento="{IdDocumento}" Serie="{SerieCFDI}" Folio="{FolioCFDI}" """.format(**locals())
#if frappe.local.site == "demo.totall.mx": # Remover if y bloque else completo una ves comprovado el correcto funcionamiento del if - AG - 18/01/21
if TipoCambioDR: #Solo si Factura diferente a MXN
#frappe.msgprint('En transacciones de moneda extranjera, solo puede existir 1 factura relacionada en Referencias del Pago (Payment Reference) ')
ImpSaldoAnt = '%.2f' % ( flt(x.outstanding_amount) / flt(TipoCambioDR) )
if si.monto_pendiente > 1:
ImpSaldoAnt = '%.2f' % ( si.monto_pendiente )
# ImpPagado = '%.2f' % flt(Monto)
# ImpSaldoInsoluto= '%.2f' % (float(ImpSaldoAnt) - float(ImpPagado))
if MonedaP == MonedaDR:# Si Moneda de Pago igual a Moneda de Factura - Factura y Pago USD
ImpSaldoAnt = '%.2f' % (x.monto_pendiente)
ImpPagado = '%.2f' % (flt(x.pagado) / flt(c.tipo_cambio))
ImpSaldoInsoluto = '%.2f' % (float(ImpSaldoAnt) - float(ImpPagado))
frappe.errprint("Saldo Anterior: " + ImpSaldoAnt + "Pago: " + ImpPagado + "Saldo Nuevo: " + ImpSaldoInsoluto)
if float(ImpSaldoInsoluto) < 0 and float(ImpPagado) > float(ImpSaldoAnt):
ImpSaldoInsoluto = '%.2f' % 0
ImpPagado = '%.2f' % flt(ImpSaldoAnt)
frappe.errprint("Saldo Anterior: " + ImpSaldoAnt + "Pago: " + ImpPagado + "Saldo Nuevo: " + ImpSaldoInsoluto)
frappe.db.set_value("Sales Invoice",si.name, 'monto_pendiente', ImpSaldoInsoluto)
cfdi_pago+="""MonedaDR="{MonedaDR}" MetodoDePagoDR="{MetodoPago}" NumParcialidad="{parc}" ImpSaldoAnt="{ImpSaldoAnt}" ImpPagado="{ImpPagado}" ImpSaldoInsoluto="{ImpSaldoInsoluto}"/>
""".format(**locals())
else: #Si la Moneda de Pago es Diferente a la Moneda de Factura - Factura USD - Pago MXN
tipocambio = round(c.tipo_cambio, 4)
ImpPagado = round(x.pagado / tipocambio, 2)
ImpSaldoAnt = '%.2f' % (x.monto_pendiente)
ImpSaldoInsoluto = '%.2f' % (float(ImpSaldoAnt) - float(ImpPagado))
if float(ImpSaldoInsoluto) < 0 and float(ImpPagado) > float(ImpSaldoAnt):
ImpSaldoInsoluto = '%.2f' % 0
ImpPagado = '%.2f' % flt(ImpSaldoAnt)
frappe.errprint("Saldo Anterior: " + ImpSaldoAnt + "Pago: " + ImpPagado + "Saldo Nuevo: " + ImpSaldoInsoluto)
frappe.db.set_value("Sales Invoice",si.name, 'monto_pendiente', ImpSaldoInsoluto)
cfdi_pago+="""TipoCambioDR="{tipocambio}" MonedaDR="{MonedaDR}" MetodoDePagoDR="{MetodoPago}" NumParcialidad="{parc}" ImpSaldoAnt="{ImpSaldoAnt}" ImpPagado="{ImpPagado}" ImpSaldoInsoluto="{ImpSaldoInsoluto}"/>
""".format(**locals())
else: # Si la Factura es en MXN
if MonedaP != "MXN": #Si el Pago es Diferente de MXN
cfdi_pago+="""TipoCambioDR="{TipoCambioP}" MonedaDR="{MonedaDR}" MetodoDePagoDR="{MetodoPago}" NumParcialidad="{parc}" ImpSaldoAnt="{ImpSaldoAnt}" ImpPagado="{ImpPagado}" ImpSaldoInsoluto="{ImpSaldoInsoluto}"/>
""".format(**locals())
else:
cfdi_pago+="""MonedaDR="{MonedaDR}" MetodoDePagoDR="{MetodoPago}" NumParcialidad="{parc}" ImpSaldoAnt="{ImpSaldoAnt}" ImpPagado="{ImpPagado}" ImpSaldoInsoluto="{ImpSaldoInsoluto}"/>
""".format(**locals())
# else:
# if TipoCambioDR:
# ImpSaldoAnt = '%.2f' % x.total_moneda_original
# ImpPagado = '%.2f' % x.total_moneda_original
# ImpSaldoInsoluto= '%.2f' % (float(ImpSaldoAnt) - float(ImpPagado))
# cfdi_pago+="""MonedaDR="{MonedaDR}" MetodoDePagoDR="PPD" NumParcialidad="{no_parcialidad}" ImpSaldoAnt="{ImpSaldoAnt}" ImpPagado="{ImpPagado}" ImpSaldoInsoluto="{ImpSaldoInsoluto}"/>
# """.format(**locals())
# else:
# cfdi_pago+="""MonedaDR="{MonedaDR}" MetodoDePagoDR="PPD" NumParcialidad="{no_parcialidad}" ImpSaldoAnt="{ImpSaldoAnt}" ImpPagado="{ImpPagado}" ImpSaldoInsoluto="{ImpSaldoInsoluto}"/>
# """.format(**locals())
if c.es_factoraje == 1:
pagado_imp = round(c.total_allocated_amount -c.base_received_amount, 2)
parc = parc + 1
cfdi_pago+="""</pago10:Pago>
<pago10:Pago Monto="{pagado_imp}" MonedaP="{MonedaP}" FormaDePagoP="17" FechaPago="{FechaContabilizacion}">
<pago10:DoctoRelacionado Serie="{SerieCFDI}" Folio="{FolioCFDI}" NumParcialidad="{parc}" MonedaDR="{MonedaP}" MetodoDePagoDR="PUE" ImpSaldoInsoluto="0.00" ImpSaldoAnt="{pagado_imp}" ImpPagado="{pagado_imp}" IdDocumento="{IdDocumento}"/>
""".format(**locals())
cfdi_pago+="""</pago10:Pago>
</pago10:Pagos>
</cfdi:Complemento>
</cfdi:Comprobante>""".format(**locals())
return cfdi_pago
@frappe.whitelist()
def parcialidades_pe(doc,method=None):
# if frappe.local.site == "demo.totall.mx":
for item in doc.references:
parc = 1
# Obtiene todos los Pagos del Sinv en la lina actual
parcialidades = frappe.get_list('Payment Entry Reference', filters={'reference_name':item.reference_name}, fields=['parent'])
for parcialidad in parcialidades:
pe_rel = frappe.get_doc('Payment Entry',parcialidad.parent)
if pe_rel.fecha:
pago = frappe.db.get_value('Payment Entry',{'name':parcialidad.parent,'fecha':['<',doc.fecha],'docstatus':['=',1]},'posting_date')
else:
pago = frappe.db.get_value('Payment Entry',{'name':parcialidad.parent,'creation':['<',doc.creation],'docstatus':['=',1]},'posting_date')
if pago:
parc = parc + 1
item.no_parcialidad = parc
return
# MAPA DE complementos
# Num_Operacion = c.name
# FormaDePago = c.forma_de_pago
#
# PAGO10 - Iterar sobre reference
# id documento=uuid_pago
# serie y folio = reference_name
# met pago = 'PPD'
# ImpSaldoAnt=total_moneda_original
# ImpPagado=alocated_amount
# ImpSaldoInsoluto=ImpSaldoAnt - ImpPagado
# RG-Para las notas de credito CFDI
@frappe.whitelist()
def issue_egreso(url, token, docname, version, b64=False):
# RG - POST request al server de swarterweb
xml = genera_xml_egreso(docname)
boundary = "----=_Part_11_11939969.1490230712432"
payload = "--" + boundary + "\r\nContent-Type: text/xml\r\nContent-Transfer-Encoding: binary\r\nContent-Disposition: " \
"form-data; name=\"xml\"; filename=\"xml\"\r\n\r\n" + str(xml) + "\r\n--" + boundary + "-- "
headers = {
'Authorization': "bearer " + token,
'Content-Type': "multipart/form-data; boundary=\"" + boundary + "\""
}
response = requests.request("POST", url + "/cfdi33/issue/" + version + "/" , data=payload.encode('utf-8'), headers=headers)
liga = url + "/cfdi33/issue/" + version + "/"
frappe.errprint(response.json())
frappe.errprint(payload)
frappe.errprint(headers)
frappe.errprint(liga)
if response.json().get('status') == 'error':
frappe.msgprint((response.json().get('message')), "ERROR ENCONTRADO AL TIMBRAR")
else:
# RG- Recuperar el response y manejar la info pa grabar los archivos/datos en el CFDI
c = frappe.get_doc("CFDI Nota de Credito", docname)
# webfolder = c.folder
uuid = response.json().get('data').get('uuid')
fechaxml = str(c.creation)
# generar xml
cfdi_recibido = response.json().get('data').get('cfdi')
dest = '/home/frappe/frappe-bench/sites/' + frappe.local.site + '/public/files/' + c.name + "_" + fechaxml[0:10]
f = open( dest + '.xml',"w+")
f.write(cfdi_recibido)
f.close()
save_url( "/files/" + c.name + "_" + fechaxml[0:10] + ".xml" , c.name + "_" + fechaxml[0:10] + ".xml" , "CFDI Nota de Credito" , c.name , "Home/Attachments" , 0)
# EscribirPNG
qr = response.json().get('data').get('qrCode')
png = open( dest + ".png", "wb")
png.write(base64.b64decode(qr))
png.close()
frappe.db.set_value("CFDI Nota de Credito",c.name, 'qr', "/files/" + c.name + "_" + fechaxml[0:10] + ".png")
# escribir todos los demas campos
frappe.db.set_value("CFDI Nota de Credito",c.name, 'cfdi_status', 'Timbrado')
frappe.db.set_value("CFDI Nota de Credito",c.name, 'sellocfd', response.json().get('data').get('selloCFDI'))
frappe.db.set_value("CFDI Nota de Credito",c.name, 'cadenaoriginalsat', response.json().get('data').get('cadenaOriginalSAT'))
frappe.db.set_value("CFDI Nota de Credito",c.name, 'fechatimbrado', response.json().get('data').get('fechaTimbrado') )
frappe.db.set_value("CFDI Nota de Credito",c.name, 'uuid', uuid)
frappe.db.set_value("CFDI Nota de Credito",c.name, 'nocertificadosat', response.json().get('data').get('noCertificadoSAT') )
frappe.db.set_value("CFDI Nota de Credito",c.name, 'sellosat', response.json().get('data').get('selloSAT') )
frappe.msgprint(str(c.name) + " Timbrada exitosamente " )
return response.json()
def genera_xml_egreso(docname):
tieneiva = 0
notieneiva = 0
c = frappe.get_doc("CFDI Nota de Credito", docname)
mytime = datetime.strptime('0800','%H%M').time()
#fecha_actual = datetime.combine(c.posting_date,mytime).isoformat()[0:19] #dacosta - para hacer que se timbre con la fecha de posting_date
mytime = datetime.strptime('0800','%H%M').time()
fecha_actual = datetime.combine(c.posting_date,mytime).isoformat()[0:19] #dacosta - para hacer que se timbre con la fecha de posting_date
serie = c.naming_series.replace('-','')
folio = c.name.replace(serie,'')
FormaPago = c.forma_de_pago
SubTotal = float(c.total_neto)
# Falta descuento
Total = '%.2f' % (c.total)
TipoDeComprobante = "E"
MetodoPago = c.metodo_pago
LugarExpedicion = c.lugar_expedicion
NoCertificado = c.no_certificado
rfc_emisor = c.rfc_emisor
nombre_emisor = c.nombre_emisor.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ')
regimen_fiscal = c.regimen_fiscal
tax_id = c.tax_id.replace('&','&')
nombre_receptor = c.customer_name.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ')
uso_cfdi = c.uso_cfdi
# fac_rel = frappe.get_doc(c.tipo_documento,c.factura_fuente)
tipo_rel = c.tipo_de_relacion
# uuid_rel = fac_rel.uuid
Currency = c.currency
if Currency == 'MXN':
TipoCambio = 1
else:
TipoCambio = '%.4f' % float(c.conversion_rate)
cfdi = """<?xml version="1.0" encoding="UTF-8"?>
<cfdi:Comprobante xmlns:cfdi="http://www.sat.gob.mx/cfd/3" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.sat.gob.mx/cfd/3 http://www.sat.gob.mx/sitio_internet/cfd/3/cfdv33.xsd"
Version="3.3" Serie="{serie}" Folio="{folio}" Fecha="{fecha_actual}" Sello="" FormaPago="{FormaPago}" NoCertificado=""
Certificado="" CondicionesDePago="CONTADO" SubTotal="{SubTotal}" Moneda="{Currency}" TipoCambio = "{TipoCambio}" Total="{Total}" TipoDeComprobante="{TipoDeComprobante}" MetodoPago="{MetodoPago}" LugarExpedicion="{LugarExpedicion}">""".format(**locals())
site = frappe.local.site
# if site == "demo.totall.mx":
cfdi+= """
<cfdi:CfdiRelacionados TipoRelacion="{tipo_rel}">""".format(**locals())
for d in c.si_sustitucion:
cfdi+="""
<cfdi:CfdiRelacionado UUID="{d.uuid}"/>""".format(**locals())
cfdi+="""
</cfdi:CfdiRelacionados>""".format(**locals())
cfdi+="""
<cfdi:Emisor Rfc="{rfc_emisor}" Nombre="{nombre_emisor}" RegimenFiscal="{regimen_fiscal}"/>
<cfdi:Receptor Rfc="{tax_id}" Nombre="{nombre_receptor}" UsoCFDI="{uso_cfdi}"/>
<cfdi:Conceptos>""".format(**locals())
for d in c.items:
NoIdentificacion = d.item_code
ClaveProdServ = d.clave_producto
ClaveUnidad = d.clave_unidad
Cantidad = d.qty
Unidad = d.stock_uom
ValorUnitario = '%.2f' % d.precio_unitario_neto
Importe = '%.2f' % d.precio_neto
idx =d.idx
Descripcion = d.item_name
if d.tax == 16:
tieneiva = 1
TrasladosBase = '%.2f' % d.precio_neto
Impuesto = "002"
TasaOCuota = "0.160000"
Importetax = '%.2f' % d.impuestos_totales
else:
notieneiva = 1
TrasladosBase= '%.2f' % d.precio_neto
Impuesto="002"
TasaOCuota="0.000000"
Importetax= "0.00"
cfdi += """
<cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="Tasa" TasaOCuota="{TasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
TotalImpuestosTrasladados='%.2f' % c.total_impuestos
TotalIva = '%.2f' % c.total_iva
frappe.errprint(TotalIva)
TotalIeps = '%.2f' % c.total_ieps
cfdi += """
</cfdi:Conceptos>
<cfdi:Impuestos TotalImpuestosTrasladados="{TotalImpuestosTrasladados}">
<cfdi:Traslados>
""".format(**locals())
if notieneiva == 1:
cfdi += """ <cfdi:Traslado Impuesto="002" TipoFactor="Tasa" TasaOCuota="0.000000" Importe="0.00"/>""".format(**locals())
else:
cfdi += """ <cfdi:Traslado Impuesto="002" TipoFactor="Tasa" TasaOCuota="0.160000" Importe="{TotalIva}"/>""".format(**locals())
cfdi += """
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Comprobante>
""".format(**locals())
frappe.errprint(cfdi)
return cfdi
# Dev-Aaron Timbrado Sales Invoice
@frappe.whitelist()
def sales_invoice_timbrado(url, token, docname, version, b64=False):
# RG - POST request al server de swarterweb
xml = sales_invoice_timbrado_xml(docname)
frappe.errprint(xml)
lst = [random.choice(string.ascii_letters + string.digits) for n in range(30)]
boundary = "".join(lst)
payload = "--" + boundary + "\r\nContent-Type: text/xml\r\nContent-Transfer-Encoding: binary\r\nContent-Disposition: " \
"form-data; name=\"xml\"; filename=\"xml\"\r\n\r\n" + str(xml) + "\r\n--" + boundary + "-- "
headers = {
'Authorization': "bearer " + token,
'Content-Type': "multipart/form-data; boundary=\"" + boundary + "\""
}
response = requests.request("POST", url + "/cfdi33/issue/" + version + "/" , data=payload.encode('utf-8'), headers=headers)
liga = url + "/cfdi33/issue/" + version + "/"
frappe.errprint(response.json())
if response.json().get('status') == 'error':
if response.json().get('messageDetail'):
frappe.msgprint((response.json().get('message')) + ". <b>Detalle del Error: </b>" + (response.json().get('messageDetail')), "ERROR DE SERVIDOR (PAC) ")
else:
frappe.msgprint((response.json().get('message')) , "ERROR DE SERVIDOR")
else:
# RG- Recuperar el response y manejar la info pa grabar los archivos/datos en el CFDI
c = frappe.get_doc("Sales Invoice", docname)
uuid = response.json().get('data').get('uuid')
cfdi_recibido = response.json().get('data').get('cfdi')
fechaxml = str(c.creation)
dest = '/home/frappe/frappe-bench/sites/' + frappe.local.site + '/public/files/' + c.name + "_" + fechaxml[0:10]
f = open( dest + '.xml',"w+")
f.write(cfdi_recibido)
f.close()
save_url( "/files/" + c.name + "_" + fechaxml[0:10] + ".xml" , c.name + "_" + fechaxml[0:10] + ".xml" , "Sales Invoice" , c.name , "Home/Attachments" , 0)
qr = response.json().get('data').get('qrCode')
png = open( dest + ".png", "wb")
png.write(base64.b64decode(qr))
png.close()
frappe.db.set_value("Sales Invoice",c.name, 'qr', "/files/" + c.name + "_" + fechaxml[0:10] + ".png")
frappe.db.set_value("Sales Invoice",c.name, 'cfdi_status', 'Timbrado')
frappe.db.set_value("Sales Invoice",c.name, 'sellocfd', response.json().get('data').get('selloCFDI'))
frappe.db.set_value("Sales Invoice",c.name, 'cadenaoriginalsat', response.json().get('data').get('cadenaOriginalSAT'))
frappe.db.set_value("Sales Invoice",c.name, 'fechatimbrado', response.json().get('data').get('fechaTimbrado') )
frappe.db.set_value("Sales Invoice",c.name, 'uuid', uuid)
frappe.db.set_value("Sales Invoice",c.name, 'nocertificadosat', response.json().get('data').get('noCertificadoSAT') )
frappe.db.set_value("Sales Invoice",c.name, 'sellosat', response.json().get('data').get('selloSAT') )
mensaje = "TIMBRADO EXITOSO . <a class= 'alert-info' href='https://" + frappe.local.site + "/files/" + c.name + "_" + fechaxml[0:10] + ".xml' download> Descarga XML </a>"
frappe.msgprint(mensaje)
return ["TIMBRADO EXITOSO!",mensaje,uuid,xml]
def sales_invoice_timbrado_xml(docname):
c = frappe.get_doc("Sales Invoice", docname)
cliente = frappe.get_doc("Customer", c.customer)
cant = len(c.items)
company = frappe.get_doc("Configuracion CFDI", c.company)
# horaminuto = c.posting_time
# frappe.errprint(h oraminuto)
# mytime = horaminuto.strftime("%H:%M:%S")
# frappe.errprint(horaminuto)
# return
#fecha_actual = datetime.combine(c.posting_date,mytime).isoformat()[0:19] #dacosta - para hacer que se timbre con la fecha de posting_date
descuento = round(c.discount_amount, 2)
fecha_actual = (c.creation).isoformat()[0:19]
serie = c.naming_series.replace('-','')
folio = c.name.replace(serie,'')
# frappe.errprint(c.name.replace(serie,''))
FormaPago = c.forma_de_pago
#SubTotal = '%.2f' % c.net_total
SubTotal = 0
Total = '%.2f' % (c.grand_total)
# Total = 3509.40
TipoDeComprobante = 'I'
# TipoCambio = 1 if c.currency = "MXN" else '%2f' % c.conversion_rate
MetodoPago = c.metodo_pago
LugarExpedicion = company.lugar_expedicion
Currency = c.currency
if Currency == 'MXN':
TipoCambio = 1
else:
TipoCambio = '%.4f' % c.conversion_rate
rfc_emisor = company.rfc_emisor
nombre_emisor = company.nombre_emisor.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ')
regimen_fiscal = company.regimen_fiscal
tax_id = cliente.tax_id.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ').replace('Ü', 'U')
nombre_receptor = c.customer_name.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ')
uso_cfdi = c.uso_cfdi
tipo = []
tasa = []
cantidad = []
cfdi_items = ""
cfdi_traslados = ""
cfdi_mercancias = ""
if c.comercio_exterior == 1:
cfdi_mercancias = """
<cce11:Mercancias>
""".format(**locals())
for x in c.items:
i = frappe.get_doc("Item", x.item_code)
if c.comercio_exterior == 1:
arancelaria = frappe.get_doc("Fraccion Arancelaria", i.fraccion_arancelaria)
UMT = arancelaria.umt
else:
arancelaria = ""
UMT = ""
NoIdentificacion = x.item_code.replace('"','').replace('&','&')
ClaveProdServ = i.clave_producto
ClaveUnidad = i.clave_unidad
Cantidad = x.qty
Unidad = x.stock_uom
ValorUnitario = '%.2f' % x.rate
Importe = '%.2f' % x.amount
idx = x.idx
Descripcion = x.description.replace('"','').replace('&','&').replace('<div class="ql-editor read-mode"><p>','').replace('<div><p>','').replace('</p></div>','').replace('<br>','').replace('<p>','').replace('</p>','').replace('<div class=ql-editor read-mode>','').replace('@','@').replace('<strong>','').replace('</strong>','')
des = round(x.descuento*x.qty, 2)
TrasladosBase= '%.2f' % (float(x.amount) - float(des))
SubTotal = round(SubTotal + float(x.amount), 2)
TasaOCuota = .01 * float(x.tasa)
ImpuestosTrasladosTasaOCuota='%.6f' % TasaOCuota
Importetax= '%.2f' % (TasaOCuota * (float(x.amount) - des))
Tasa = 'Tasa'
FraccionArancelaria = i.fraccion_arancelaria
UnidadAduana = i.unidad_aduana
TipoImpuesto = x.tipo_de_impuesto
if c.comercio_exterior == 1:
NoIdentificacion_exterior = str(NoIdentificacion) + " " + str(x.idx)
cfdi_mercancias += """
<cce11:Mercancia NoIdentificacion="{NoIdentificacion_exterior}" FraccionArancelaria="{FraccionArancelaria}" CantidadAduana="{Cantidad}" UnidadAduana="{UMT}" ValorUnitarioAduana="{ValorUnitario}" ValorDolares="{Importe}"/>
""".format(**locals())
TipoImpuesto = "EXTERIOR"
if TipoImpuesto == 'IVA':
Impuesto = '002'
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}" Descuento="{des}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
elif TipoImpuesto == "SIN IVA":
Impuesto="002"
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}" Descuento="{des}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
elif TipoImpuesto == "IEPS":
Impuesto="003"
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}" Descuento="{des}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
elif TipoImpuesto == "EXENTO":
TrasladosBase1= x.net_amount
TrasladosBase= '%.2f' % (TrasladosBase1)
Impuesto="002"
ImpuestosTrasladosTasaOCuota="0.000000"
Importetax= "0.00"
Tasa = 'Exento'
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}" Descuento="{des}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
elif TipoImpuesto == "EXTERIOR":
NoIdentificacion_exterior = str(NoIdentificacion) + " " + str(x.idx)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion_exterior}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}" Descuento="{des}">
</cfdi:Concepto>""".format(**locals())
# tipo.append(Impuesto)
# tasa.append(ImpuestosTrasladosTasaOCuota)
# cantidad.append(Importetax)
# frappe.errprint(Importetax)
# cfdi_items += """
# <cfdi:Concepto ClaveProdServ="{ClaveProdServ}" NoIdentificacion="{NoIdentificacion}" Cantidad="{Cantidad}" ClaveUnidad="{ClaveUnidad}" Unidad="{Unidad}" Descripcion="{Descripcion}" ValorUnitario="{ValorUnitario}" Importe="{Importe}" Descuento="{des}">
# <cfdi:Impuestos>
# <cfdi:Traslados>
# <cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
# </cfdi:Traslados>
# </cfdi:Impuestos>
# </cfdi:Concepto>""".format(**locals())
# # TotalImpuestosTrasladados= 4558.38
cTipo = collections.Counter(tipo)
cTasa = collections.Counter(tasa)
total_impuesto = 0
TotalImpuestosTrasladados = 0.00
for w, val1 in cTipo.items():
for y, val2 in cTasa.items():
if c.comercio_exterior == 1:
suma = "EXTERIOR"
else:
suma =0
for z in range(0,cant):
if (tasa[z] == y) and (tipo[z] == w):
suma1 = suma+float(cantidad[z])
suma = round(suma1, 2)
b = y
t = w
total_impuesto = total_impuesto+suma
TotalImpuestosTrasladados = suma
if(suma>0):
cfdi_traslados += """
<cfdi:Traslado Impuesto="{t}" TipoFactor="{Tasa}" TasaOCuota="{b}" Importe="{suma}"/>""".format(**locals())
elif(suma==0):
cfdi_traslados += """
<cfdi:Traslado Impuesto="{t}" TipoFactor="{Tasa}" TasaOCuota="{b}" Importe="{suma}"/>""".format(**locals())
elif(suma=="EXTERIOR"):
cfdi_traslados += ""
Total = round(SubTotal - descuento + TotalImpuestosTrasladados, 2)
cfdi = ""
if c.comercio_exterior == 1:
Totalant = round(SubTotal - descuento + TotalImpuestosTrasladados, 2)
Total = '%.2f' % (Totalant)
cfdi_comprobante = """<?xml version="1.0" encoding="UTF-8"?>
<cfdi:Comprobante xmlns:cfdi="http://www.sat.gob.mx/cfd/3" xmlns:cce11="http://www.sat.gob.mx/ComercioExterior11" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.sat.gob.mx/cfd/3 http://www.sat.gob.mx/sitio_internet/cfd/3/cfdv33.xsd http://www.sat.gob.mx/ComercioExterior11 http://www.sat.gob.mx/sitio_internet/cfd/ComercioExterior11/ComercioExterior11.xsd"
Version="3.3" Serie="{serie}" Folio="{folio}" Fecha="{fecha_actual}" Sello="" FormaPago="{FormaPago}" NoCertificado=""
Certificado="" CondicionesDePago="CONTADO" SubTotal="{SubTotal}" Descuento="{descuento}" Moneda="{Currency}" TipoCambio = "{TipoCambio}" Total="{Total}" TipoDeComprobante="{TipoDeComprobante}" MetodoPago="{MetodoPago}" LugarExpedicion="{LugarExpedicion}">""".format(**locals())
else:
cfdi_comprobante = """<?xml version="1.0" encoding="UTF-8"?>
<cfdi:Comprobante xmlns:cfdi="http://www.sat.gob.mx/cfd/3" xmlns:xs="http://www.w3.org/2001/XMLSchema" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.sat.gob.mx/cfd/3 http://www.sat.gob.mx/sitio_internet/cfd/3/cfdv33.xsd"
Version="3.3" Serie="{serie}" Folio="{folio}" Fecha="{fecha_actual}" Sello="" FormaPago="{FormaPago}" NoCertificado=""
Certificado="" CondicionesDePago="CONTADO" SubTotal="{SubTotal}" Descuento="{descuento}" Moneda="{Currency}" TipoCambio = "{TipoCambio}" Total="{Total}" TipoDeComprobante="{TipoDeComprobante}" MetodoPago="{MetodoPago}" LugarExpedicion="{LugarExpedicion}">""".format(**locals())
cfdi += cfdi_comprobante
#
#es_sustitucion = frappe.get_value('Sales Invoice', docname,'sustituidos')
# try:
#site = frappe.local.site
# if site == "demo.totall.mx":
if c.cfdi_sustitucion == 1:
relacion = c.relacion
cfdi += """
<cfdi:CfdiRelacionados TipoRelacion="{relacion}">""".format(**locals())
for d in c.si_sustitucion:
cfdi+="""
<cfdi:CfdiRelacionado UUID="{d.uuid}"/>""".format(**locals())
cfdi+="""
</cfdi:CfdiRelacionados>""".format(**locals())
# if es_sustitucion:
# if c.sustituidos == 1:
# frappe.errprint('si existe')
# else:
# frappe.errprint('no existe')
cfdi+= """
<cfdi:Emisor Rfc="{rfc_emisor}" Nombre="{nombre_emisor}" RegimenFiscal="{regimen_fiscal}"/>
<cfdi:Receptor Rfc="{tax_id}" Nombre="{nombre_receptor}" UsoCFDI="{uso_cfdi}"/>
<cfdi:Conceptos>""".format(**locals())
cfdi += cfdi_items
if c.comercio_exterior == 1:
tax_id = "XAXX010101000"
cfdi_conceptos = """
</cfdi:Conceptos>""".format(**locals())
else:
cfdi_conceptos = """
</cfdi:Conceptos>
<cfdi:Impuestos TotalImpuestosTrasladados="{TotalImpuestosTrasladados}">
<cfdi:Traslados>""".format(**locals())
cfdi += cfdi_conceptos
cfdi += cfdi_traslados
cfdi_complemento = ""
cfdi_emisor = ""
cfdi_receptor = ""
cfdi_header = """
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Comprobante>
""".format(**locals())
if c.comercio_exterior == 1:
EDireccion = frappe.get_doc("Address", c.customer_address)
ECalle = re.findall("[^0-9]+", EDireccion.address_line1)[0].replace('#', '')
ENumeroExterior = re.findall("\d+", EDireccion.address_line1)[0]
EColonia = EDireccion.county
EEstado = EDireccion.clave_estado
ECp = EDireccion.pincode
#########################################
#Letras del pais UNIDECODE Origen
pais = frappe.get_doc("CFDI Clave Estado", EDireccion.clave_estado)
EPais = pais.pais
if c.comercio_exterior == 1:
cfdi_complemento = """
<cfdi:Complemento>
<cce11:ComercioExterior Version="1.1" TipoOperacion="2" ClaveDePedimento="{c.clave_pedimento}" CertificadoOrigen="0" Incoterm="{c.incoterm}" Subdivision="0" TipoCambioUSD="{TipoCambio}" TotalUSD="{Total}" xmlns:cce11="http://www.sat.gob.mx/ComercioExterior11" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.sat.gob.mx/ComercioExterior11 http://www.sat.gob.mx/sitio_internet/cfd/ComercioExterior11/ComercioExterior11.xsd">""".format(**locals())
cfdi_emisor = """
<cce11:Emisor>
<cce11:Domicilio Calle="López Cotilla" NumeroExterior="13" Localidad="12" Municipio="101" Estado="JAL" Pais="MEX" CodigoPostal="{company.lugar_expedicion}"/>
</cce11:Emisor>
""".format(**locals())
cfdi_receptor = """
<cce11:Receptor>
<cce11:Domicilio Calle="{ECalle}" NumeroExterior="{ENumeroExterior}" Colonia="{EColonia}" Estado="{EEstado}" Pais="{EPais}" CodigoPostal="{ECp}"/>
</cce11:Receptor>
""".format(**locals())
cfdi_header = """
</cce11:Mercancias>
</cce11:ComercioExterior>
</cfdi:Complemento>
</cfdi:Comprobante>
""".format(**locals())
cfdi += cfdi_complemento
cfdi += cfdi_emisor
cfdi += cfdi_receptor
cfdi += cfdi_mercancias
cfdi += cfdi_header
frappe.errprint(cfdi)
return cfdi
@frappe.whitelist()
def cancel_by_uuid_sales_invoice(url, token,uuid,docname, rfc):
c = frappe.get_doc("Sales Invoice", docname)
headers = {
'Authorization': "bearer " + token,
'Content-Type': "application/json"
}
response = requests.request("POST", url + "/cfdi33/cancel/" + rfc + "/" + uuid, headers=headers)
if response.json().get('status') == 'error':
if response.json().get('messageDetail'):
frappe.msgprint((response.json().get('message')) + ". <b>Detalle del Error: </b>" + (response.json().get('messageDetail')), "ERROR DE SERVIDOR (PAC) ")
else:
frappe.msgprint((response.json().get('message')) , "ERROR DE SERVIDOR")
else:
frappe.db.set_value("Sales Invoice", c.name, 'cfdi_status','Cancelado')
frappe.msgprint(str(c.name)+ " Cancelada Exitosamente")
return response.text
#############################################
#Comienza Carta Porte
@frappe.whitelist()
def carta_porte_timbrado(url, token, docname, version, b64=False):
# RG - POST request al server de swarterweb
xml = carta_porte_timbrado_xml(docname)
frappe.errprint(xml)
lst = [random.choice(string.ascii_letters + string.digits) for n in range(30)]
boundary = "".join(lst)
payload = "--" + boundary + "\r\nContent-Type: text/xml\r\nContent-Transfer-Encoding: binary\r\nContent-Disposition: " \
"form-data; name=\"xml\"; filename=\"xml\"\r\n\r\n" + str(xml) + "\r\n--" + boundary + "-- "
headers = {
'Authorization': "bearer " + token,
'Content-Type': "multipart/form-data; boundary=\"" + boundary + "\""
}
response = requests.request("POST", url + "/cfdi33/issue/" + version + "/" , data=payload.encode('utf-8'), headers=headers)
liga = url + "/cfdi33/issue/" + version + "/"
frappe.errprint(response.json())
if response.json().get('status') == 'error':
if response.json().get('messageDetail'):
frappe.msgprint((response.json().get('message')) + ". <b>Detalle del Error: </b>" + (response.json().get('messageDetail')), "ERROR DE SERVIDOR (PAC) ")
else:
frappe.msgprint((response.json().get('message')) , "ERROR DE SERVIDOR")
else:
# RG- Recuperar el response y manejar la info pa grabar los archivos/datos en el CFDI
c = frappe.get_doc("Delivery Trip", docname)
uuid = response.json().get('data').get('uuid')
cfdi_recibido = response.json().get('data').get('cfdi')
fechaxml = str(c.creation)
dest = '/home/frappe/frappe-bench/sites/' + frappe.local.site + '/public/files/' + c.name + "_" + fechaxml[0:10]
f = open( dest + '.xml',"w+")
f.write(cfdi_recibido)
f.close()
save_url( "/files/" + c.name + "_" + fechaxml[0:10] + ".xml" , c.name + "_" + fechaxml[0:10] + ".xml" , "Delivery Trip" , c.name , "Home/Attachments" , 0)
qr = response.json().get('data').get('qrCode')
png = open( dest + ".png", "wb")
png.write(base64.b64decode(qr))
png.close()
frappe.db.set_value("Delivery Trip",c.name, 'qr', "/files/" + c.name + "_" + fechaxml[0:10] + ".png")
frappe.db.set_value("Delivery Trip",c.name, 'cfdi_status', 'Timbrado')
frappe.db.set_value("Delivery Trip",c.name, 'sellocfd', response.json().get('data').get('selloCFDI'))
frappe.db.set_value("Delivery Trip",c.name, 'cadenaoriginalsat', response.json().get('data').get('cadenaOriginalSAT'))
frappe.db.set_value("Delivery Trip",c.name, 'fechatimbrado', response.json().get('data').get('fechaTimbrado') )
frappe.db.set_value("Delivery Trip",c.name, 'uuid', uuid)
frappe.db.set_value("Delivery Trip",c.name, 'nocertificadosat', response.json().get('data').get('noCertificadoSAT') )
frappe.db.set_value("Delivery Trip",c.name, 'sellosat', response.json().get('data').get('selloSAT') )
mensaje = "TIMBRADO EXITOSO . <a class= 'alert-info' href='https://" + frappe.local.site + "/files/" + uuid + ".xml' download> Descarga XML </a>"
frappe.msgprint(mensaje)
return ["TIMBRADO EXITOSO!",mensaje,uuid,xml]
def carta_porte_timbrado_xml(docname):
c = frappe.get_doc("Delivery Trip", docname)
TranspInternac = ""
if c.transporte_internacional == 1:
TranspInternac = 'Si'
else:
TranspInternac = 'No'
company = frappe.get_doc("Configuracion CFDI", c.company)
fecha_actual = (c.creation).isoformat()[0:19]
fecha_salida = (c.departure_time).isoformat()[0:19]
serie = c.naming_series.replace('-','')
folio = c.name.replace(serie,'')
FormaPago = c.forma_de_pago
if c.tipo_de_comprobante == "I":
SubTotal = '%.2f' % c.precio_traslado
Total = round(c.precio_traslado * 1.16, 2)
else:
SubTotal = 0
Total = 0
TipoDeComprobante = c.tipo_de_comprobante
MetodoPago = c.metodo_de_pago
LugarExpedicion = company.lugar_expedicion
Currency = c.currency
if Currency == 'MXN':
TipoCambio = 1
else:
TipoCambio = '%.4f' % c.conversion_rate
rfc_emisor = company.rfc_emisor
nombre_emisor = company.nombre_emisor.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ')
regimen_fiscal = company.regimen_fiscal
uso_cfdi = c.uso_cfdi
##########################################
#Datos de Direccion de Origen
ODireccion = frappe.get_doc("Address", c.driver_address)
OCalle = re.findall("[^0-9]+", ODireccion.address_line1)[0].replace('#', '')
ONumeroExterior = re.findall("\d+", ODireccion.address_line1)[0]
#########################################
#Letras del pais UNIDECODE Origen
OClave_estado = ODireccion.clave_estado
InfOClave_estado = frappe.get_doc("CFDI Clave Estado", OClave_estado)
OPais = InfOClave_estado.pais
articulo_claveDT = c.unidad_pesocp
suma_distancia = 0
##########################################
#Datos de Direccion de destinatario
for dest in c.delivery_stops:
UCliente = dest.customer
cliente = frappe.get_doc("Customer", UCliente)
nombre_receptor = UCliente.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ')
tax_id = cliente.tax_id.replace('&','&').replace('á','a').replace('é','e').replace('í','i').replace('ó','o').replace('ú','u').replace('À','a').replace('É','e').replace('Í','i').replace('Ó','o').replace('Ú','u').replace('@',' ').replace('Ü', 'U')
rfc_receptor = cliente.tax_id
Fecha_llegada = (dest.estimated_arrival).isoformat()[0:19]
UDireccion = frappe.get_doc("Address", dest.address)
UCalle = re.findall("[^0-9]+", UDireccion.address_line1)[0].replace('#', '')
UNumeroExterior = re.findall("\d+", UDireccion.address_line1)[0]
#########################################
#Letras del pais UNIDECODE Origen
UClave_estado = UDireccion.clave_estado
InfUClave_estado = frappe.get_doc("CFDI Clave Estado", UClave_estado)
UPais = InfUClave_estado.pais
UCodigo_postal = UDireccion.pincode
##########################################
distancia = round(dest.distance, 2)
suma_distancia += round(distancia, 2)
##########################################
#Obtener informacion de Notra de Entrega
DN = frappe.get_doc("Delivery Note", dest.delivery_note)
cant = len(DN.items)
PesoBrutoTotal = DN.total_net_weight
cfdi_ubicacion_destino = """
<cartaporte20:Ubicacion TipoUbicacion="Destino" RFCRemitenteDestinatario="{rfc_receptor}" FechaHoraSalidaLlegada="{Fecha_llegada}" DistanciaRecorrida="{distancia}">
<cartaporte20:Domicilio Calle="{UCalle}" NumeroExterior="{UNumeroExterior}" Estado="{UClave_estado}" Pais="{UPais}" CodigoPostal="{UCodigo_postal}" />
</cartaporte20:Ubicacion>
""".format(**locals())
##########################################
#Obtener informacion de articulos en Notra de Entrega
tipo = []
tasa = []
cantidad = []
cfdi_items = ""
cfdi_traslados = ""
for articulos_nota in DN.items:
articulo_qty = articulos_nota.qty
articulo_peso = articulos_nota.total_weight
row = str(articulos_nota.idx)
NumTotalMercancias = len(row)
##########################################
#Obtener informacion del articulo en general
informacion_articulo = frappe.get_doc("Item", articulos_nota.item_code)
articulo_cps = informacion_articulo.clave_producto
articulo_cu = informacion_articulo.clave_unidad
articulo_claveUP = informacion_articulo.unidad_pesocp
material_peligroso = informacion_articulo.material_peligroso
articulo_descripcion = informacion_articulo.description
articulos_mercancias_header = """ </cartaporte20:Ubicaciones>
<cartaporte20:Mercancias PesoBrutoTotal="{PesoBrutoTotal}" UnidadPeso="{articulo_claveDT}" NumTotalMercancias="{NumTotalMercancias}" >""".format(**locals())
articulos_mercancias = """
<cartaporte20:Mercancia BienesTransp="{articulo_cps}" Descripcion="{articulo_descripcion}" Cantidad="{articulo_qty}" ClaveUnidad="{articulo_claveUP}" PesoEnKg="{articulo_peso}">
</cartaporte20:Mercancia>""".format(**locals())
NoIdentificacion = articulos_nota.item_code.replace('"','').replace('&','&')
ClaveProdServ = informacion_articulo.clave_producto
ClaveUnidad = informacion_articulo.clave_unidad
Cantidad = articulos_nota.qty
Unidad = articulos_nota.stock_uom
ValorUnitario = '%.2f' % c.precio_traslado
Importe = '%.2f' % c.precio_traslado
idx = articulos_nota.idx
Descripcion = articulos_nota.item_name.replace('"','').replace('&','&')
TrasladosBase= '%.2f' % c.precio_traslado
TasaOCuota = .01 * float(informacion_articulo.tasa)
ImpuestosTrasladosTasaOCuota='%.6f' % TasaOCuota
Importetax= '%.2f' % (TasaOCuota * (float(c.precio_traslado)))
Tasa = 'Tasa'
if informacion_articulo.tipo_de_impuesto == 'IVA':
Impuesto = '002'
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="78101800" NoIdentificacion="01" Cantidad="1" ClaveUnidad="E48" Unidad="SERVICIO" Descripcion="FLETE" ValorUnitario="{ValorUnitario}" Importe="{Importe}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
elif informacion_articulo.tipo_de_impuesto == "SIN IVA":
Impuesto="002"
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="78101800" NoIdentificacion="01" Cantidad="1" ClaveUnidad="E48" Unidad="SERVICIO" Descripcion="FLETE" ValorUnitario="{ValorUnitario}" Importe="{Importe}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
elif informacion_articulo.tipo_de_impuesto == "IEPS":
Impuesto="003"
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="78101800" NoIdentificacion="01" Cantidad="1" ClaveUnidad="E48" Unidad="SERVICIO" Descripcion="FLETE" ValorUnitario="{ValorUnitario}" Importe="{Importe}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}" TasaOCuota="{ImpuestosTrasladosTasaOCuota}" Importe="{Importetax}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
elif informacion_articulo.tipo_de_impuesto == "EXENTO":
TrasladosBase1= articulos_nota.net_amount
TrasladosBase= '%.2f' % (TrasladosBase1)
Impuesto="002"
ImpuestosTrasladosTasaOCuota="0.000000"
Importetax= "0.00"
Tasa = 'Exento'
tipo.append(Impuesto)
tasa.append(ImpuestosTrasladosTasaOCuota)
cantidad.append(Importetax)
frappe.errprint(Importetax)
cfdi_items += """
<cfdi:Concepto ClaveProdServ="78101800" NoIdentificacion="01" Cantidad="1" ClaveUnidad="E48" Unidad="SERVICIO" Descripcion="FLETE" ValorUnitario="{ValorUnitario}" Importe="{Importe}">
<cfdi:Impuestos>
<cfdi:Traslados>
<cfdi:Traslado Base="{TrasladosBase}" Impuesto="{Impuesto}" TipoFactor="{Tasa}"/>
</cfdi:Traslados>
</cfdi:Impuestos>
</cfdi:Concepto>""".format(**locals())
cTipo = collections.Counter(tipo)
cTasa = collections.Counter(tasa)
total_impuesto = 0
TotalImpuestosTrasladados = 0.00
for w, val1 in cTipo.items():
for y, val2 in cTasa.items():
suma =0
for z in range(0,cant):
if (tasa[z] == y) and (tipo[z] == w):
suma1 = suma+float(cantidad[z])
suma = round(suma1, 2)
b = y
t = w
total_impuesto = total_impuesto+suma
TotalImpuestosTrasladados = suma
if(suma>0):
cfdi_traslados += """
<cfdi:Traslado Impuesto="{t}" TipoFactor="{Tasa}" TasaOCuota="{b}" Importe="{suma}"/>""".format(**locals())
else:
cfdi_traslados += """
<cfdi:Traslado Impuesto="{t}" TipoFactor="{Tasa}" TasaOCuota="{b}" Importe="{suma}"/>""".format(**locals())
# Total = round(SubTotal + TotalImpuestosTrasladados, 2)
##########################################
#Si es auto transporte AutotransporteFederal
if c.via == '01':
#Obtener datos de Vehiculo
vehicle = frappe.get_doc("Vehicle", c.vehicle)
PermSCT = vehicle.tipo_permiso
NumPermisoSCT = vehicle.numero_permiso
NombreAseg = vehicle.insurance_company
NumPolizaSeguro = vehicle.policy_no
ConfigVehicular = vehicle.configuracion_vehicular
AnioModeloVM = vehicle.model
PlacaVM = c.vehicle.replace("-","")
##########################################
#Obtener datos de Operador
operador = frappe.get_doc("Driver", c.driver)
RFCOperador = operador.rfc
NumLicencia = operador.license_number
NombreOperador = operador.full_name
#Obtener datos de Direccion de Operador
DO = frappe.get_doc("Address", c.driver_address)
DOCalle = re.findall("[^0-9]+", DO.address_line1)[0].replace('#', '')
DONumeroExterior = re.findall("\d+", DO.address_line1)[0]
#########################################
#Letras del pais UNIDECODE Origen
InfDOClave_estado = frappe.get_doc("CFDI Clave Estado", UClave_estado)
DOPais = InfDOClave_estado.pais
DOClave_estado = DO.clave_estado
DOCodigo_postal = DO.pincode
if c.tipo_de_comprobante == "I":
cfdi = """<?xml version="1.0" encoding="UTF-8"?>
<cfdi:Comprobante xsi:schemaLocation="http://www.sat.gob.mx/cfd/3 http://www.sat.gob.mx/sitio_internet/cfd/3/cfdv33.xsd http://www.sat.gob.mx/CartaPorte20 http://www.sat.gob.mx/sitio_internet/cfd/CartaPorte/CartaPorte20.xsd"
xmlns:cartaporte20="http://www.sat.gob.mx/CartaPorte20" Version="3.3" Serie="{serie}" Folio="{folio}" Fecha="{fecha_actual}" Sello="" FormaPago="{FormaPago}" NoCertificado=""
xmlns:cfdi="http://www.sat.gob.mx/cfd/3"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" Certificado="" CondicionesDePago="CONTADO" SubTotal="{SubTotal}" Moneda="{Currency}" TipoCambio = "{TipoCambio}" Total="{Total}" TipoDeComprobante="{TipoDeComprobante}" MetodoPago="{MetodoPago}" LugarExpedicion="{LugarExpedicion}">""".format(**locals())
else:
cfdi = """<?xml version="1.0" encoding="UTF-8"?>
<cfdi:Comprobante xsi:schemaLocation="http://www.sat.gob.mx/cfd/3 http://www.sat.gob.mx/sitio_internet/cfd/3/cfdv33.xsd http://www.sat.gob.mx/CartaPorte20 http://www.sat.gob.mx/sitio_internet/cfd/CartaPorte/CartaPorte20.xsd"
xmlns:cartaporte20="http://www.sat.gob.mx/CartaPorte20" Version="3.3" Serie="{serie}" Folio="{folio}" Fecha="{fecha_actual}" Sello="" NoCertificado=""
xmlns:cfdi="http://www.sat.gob.mx/cfd/3"
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" Certificado="" SubTotal="{SubTotal}" Moneda="XXX" Total="{Total}" TipoDeComprobante="{TipoDeComprobante}" LugarExpedicion="{LugarExpedicion}">""".format(**locals())
cfdi+= """
<cfdi:Emisor Rfc="{rfc_emisor}" Nombre="{nombre_emisor}" RegimenFiscal="{regimen_fiscal}"/>
<cfdi:Receptor Rfc="{tax_id}" Nombre="{nombre_receptor}" UsoCFDI="{uso_cfdi}"/>
<cfdi:Conceptos>""".format(**locals())
if c.tipo_de_comprobante == "I":
cfdi += cfdi_items
else:
cfdi += """
<cfdi:Concepto ClaveProdServ="78101800" NoIdentificacion="01" Cantidad="1" ClaveUnidad="E48" Unidad="SERVICIO" Descripcion="FLETE" ValorUnitario="{ValorUnitario}" Importe="{Importe}" />
</cfdi:Conceptos>
""".format(**locals())
cfdi_conceptos = """
</cfdi:Conceptos>
<cfdi:Impuestos TotalImpuestosTrasladados="{TotalImpuestosTrasladados}">
<cfdi:Traslados>""".format(**locals())
if c.tipo_de_comprobante == "I":
cfdi += cfdi_conceptos
cfdi += cfdi_traslados
cfdi += """
</cfdi:Traslados>
</cfdi:Impuestos>
""".format(**locals())
cfdi_carta_porte = """<cfdi:Complemento>
<cartaporte20:CartaPorte Version="2.0" TranspInternac="{TranspInternac}" TotalDistRec="{suma_distancia}">
<cartaporte20:Ubicaciones>""".format(**locals())
cfdi_ubicacion_origen = """
<cartaporte20:Ubicacion TipoUbicacion="Origen" RFCRemitenteDestinatario="{rfc_emisor}" FechaHoraSalidaLlegada="{fecha_salida}">
<cartaporte20:Domicilio Calle="{DOCalle}" NumeroExterior="{DONumeroExterior}" Estado="{DOClave_estado}" Pais="MEX" CodigoPostal="{DOCodigo_postal}" />
</cartaporte20:Ubicacion>""".format(**locals())
cfdi_autotransporte = """
<cartaporte20:Autotransporte PermSCT="{PermSCT}" NumPermisoSCT="{NumPermisoSCT}">
<cartaporte20:IdentificacionVehicular ConfigVehicular="{ConfigVehicular}" PlacaVM="{PlacaVM}" AnioModeloVM="{AnioModeloVM}" />
<cartaporte20:Seguros AseguraRespCivil="{NombreAseg}" PolizaRespCivil="{NumPolizaSeguro}"/>
</cartaporte20:Autotransporte>
</cartaporte20:Mercancias>
""".format(**locals())
cfdi_figura_transporte = """ <cartaporte20:FiguraTransporte>
<cartaporte20:TiposFigura TipoFigura="01" RFCFigura="VAAM130719H60" NumLicencia="a234567890">
</cartaporte20:TiposFigura>
</cartaporte20:FiguraTransporte>
</cartaporte20:CartaPorte>
</cfdi:Complemento>
</cfdi:Comprobante>""".format(**locals())
cfdi += cfdi_carta_porte
cfdi += cfdi_ubicacion_origen
cfdi += cfdi_ubicacion_destino
cfdi += articulos_mercancias_header
cfdi += articulos_mercancias
cfdi += cfdi_autotransporte
cfdi += cfdi_figura_transporte
frappe.errprint(cfdi)
return cfdi
@frappe.whitelist()
def cancel_by_uuid_carta_porte(url, token,uuid,docname, rfc):
c = frappe.get_doc("Delivery Trip", docname)
headers = {
'Authorization': "bearer " + token,
'Content-Type': "application/json"
}
response = requests.request("POST", url + "/cfdi33/cancel/" + rfc + "/" + uuid, headers=headers)
if response.json().get('status') == 'error':
if response.json().get('messageDetail'):
frappe.msgprint((response.json().get('message')) + ". <b>Detalle del Error: </b>" + (response.json().get('messageDetail')), "ERROR DE SERVIDOR (PAC) ")
else:
frappe.msgprint((response.json().get('message')) , "ERROR DE SERVIDOR")
else:
frappe.db.set_value("Delivery Trip", c.name, 'cfdi_status','Cancelado')
frappe.msgprint(str(c.name)+ " Cancelada Exitosamente")
return response.text
| 52.62004 | 490 | 0.60867 | 8,445 | 78,246 | 5.546004 | 0.088336 | 0.009181 | 0.024981 | 0.016739 | 0.735908 | 0.715774 | 0.697348 | 0.672794 | 0.63701 | 0.616748 | 0 | 0.016867 | 0.216535 | 78,246 | 1,486 | 491 | 52.655451 | 0.747141 | 0.082624 | 0 | 0.609091 | 0 | 0.052066 | 0.381515 | 0.122358 | 0 | 0 | 0 | 0.000673 | 0 | 1 | 0.014876 | false | 0.004132 | 0.069421 | 0 | 0.1 | 0.047107 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
68f14d10051a68fe80a35af7b3706b88c9b1de8b | 538 | py | Python | analysis/parallel/__init__.py | lconaboy/seren3 | 5a2ec80adf0d69664d2ee874f5ba12cc02d6c337 | [
"CNRI-Python"
] | 1 | 2017-09-21T14:58:23.000Z | 2017-09-21T14:58:23.000Z | analysis/parallel/__init__.py | lconaboy/seren3 | 5a2ec80adf0d69664d2ee874f5ba12cc02d6c337 | [
"CNRI-Python"
] | 1 | 2020-09-09T08:52:43.000Z | 2020-09-09T08:52:43.000Z | analysis/parallel/__init__.py | lconaboy/seren3 | 5a2ec80adf0d69664d2ee874f5ba12cc02d6c337 | [
"CNRI-Python"
] | 1 | 2019-01-21T10:57:41.000Z | 2019-01-21T10:57:41.000Z | class Result(object):
'''
Simple wrapper object to contain result of single iteration MPI computation
'''
def __init__(self, rank, idx):
self.rank = rank
self.idx = idx
self.result = None
def __repr__(self):
return "rank: %d idx: %s result: %s" % (self.rank, self.idx, self.result)
def __eq__(self, other):
return self.result == other.result
def __ne__(self, other):
return self.result != other.result
def __hash__(self):
return hash(self.result) | 26.9 | 81 | 0.607807 | 69 | 538 | 4.449275 | 0.376812 | 0.162866 | 0.071661 | 0.123779 | 0.254072 | 0.254072 | 0.254072 | 0.254072 | 0 | 0 | 0 | 0 | 0.27881 | 538 | 20 | 82 | 26.9 | 0.791237 | 0.139405 | 0 | 0 | 0 | 0 | 0.060268 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.384615 | false | 0 | 0 | 0.307692 | 0.769231 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 2 |
68f45ae803ebba062da6775e6b5c1f8ffa99fc56 | 5,020 | py | Python | yrest/auth.py | Garito/python-yrest | e31b5e02a2e460db738cc0a21e09255c0a71e40f | [
"MIT"
] | null | null | null | yrest/auth.py | Garito/python-yrest | e31b5e02a2e460db738cc0a21e09255c0a71e40f | [
"MIT"
] | null | null | null | yrest/auth.py | Garito/python-yrest | e31b5e02a2e460db738cc0a21e09255c0a71e40f | [
"MIT"
] | null | null | null | from os import urandom
from binascii import hexlify
from hashlib import pbkdf2_hmac
from secrets import compare_digest
from typing import Any, List, Tuple, Dict, Union
from datetime import datetime, timedelta
from dataclasses import dataclass, field
from uuid import UUID, uuid4
from bson import ObjectId
import jwt
from sanic.request import Request
from sanic.exceptions import Unauthorized
from dataclasses_jsonschema import JsonSchemaMixin, JsonSchemaMeta
from yrest.tree import Tree, Email, Password
from yrest.mongo import Mongo
from yrest.utils import Ok, ErrorMessage
def generate_password_hash(password: str, salt = None, iterations: int = 50000) -> str:
salt = hexlify(urandom(8)) if salt is None else str.encode(salt)
password = str.encode(password)
hex_hash = hexlify(pbkdf2_hmac("sha256", password, salt, iterations))
return f"pbkdf2:sha256:{iterations}${salt.decode('utf-8')}${hex_hash.decode('utf-8')}"
def check_password_hash(hashed: str, password: str) -> bool:
_, salt, _ = hashed.split("$")
return compare_digest(generate_password_hash(password, salt), hashed)
@dataclass
class AuthToken(JsonSchemaMixin):
access_token: str
@classmethod
def get(cls, headers, key: str = "Authorization", prefix: str = "Bearer") -> Dict[str, str]:
return cls(headers[key].replace(f"{prefix} ", "") if key in headers else None)
@classmethod
def generate(cls, payload: Dict[str, Any], secret: str, exp: int = 30, algo: str = "HS256") -> str:
if "exp" not in payload:
payload["exp"] = datetime.utcnow() + timedelta(minutes = exp)
return cls(jwt.encode(payload, secret, algo).decode())
def verify(self, secret: str, algos: List[str] = None) -> bool:
try:
return jwt.decode(self.access_token, secret, algorithms = algos or ["HS256"])
except (jwt.DecodeError, jwt.ExpiredSignatureError):
return False
async def get_actor(self, table, secret, user_class):
payload = self.verify(secret)
if payload:
return await user_class.get(table, _id = ObjectId(payload["user_id"]))
@dataclass
class Auth(JsonSchemaMixin):
"""The authentication model"""
email: Email = field(metadata = JsonSchemaMeta(title = "Enter your email", extensions = {'label': 'Email', 'placeholder': 'email@example.com'}))
password: Password = field(metadata = JsonSchemaMeta(title = "Enter your password. Click on the eye to reveal it (take care of not revealing it to others)", extensions = {'label': 'Password'}))
@classmethod
def secure(cls, password):
return password if password.startswith('pbkdf2:sha256:') else generate_password_hash(password)
async def authorize(self, table, secret, user_class):
user = await user_class.get(table, email = self.email)
if user and check_password_hash(user.password, self.password):
return AuthToken.generate({"user_id": str(user._id)}, secret)
@dataclass
class ForgotPasswordRequest(JsonSchemaMixin):
email: Email = field(metadata = JsonSchemaMeta(title = "Enter your email", extensions = {'label': 'Email', 'placeholder': 'email@example.com'}))
@dataclass
class NeedsEmail:
email: Email
@dataclass
class PasswordResetToken(JsonSchemaMixin, Tree, Mongo, NeedsEmail):
code: UUID = field(default_factory = uuid4)
created_at: datetime = field(default_factory = datetime.utcnow)
def __sluger__(self, values = None, fields: bool = False) -> Union[Tuple, str]:
if fields:
return ("email",)
elif values:
return values.get('email', self.email)
else:
return self.email
@dataclass
class ResetPassword(JsonSchemaMixin):
code: UUID
password: Password = field(metadata = JsonSchemaMeta(title = "Enter the new password. Click on the eye to reveal it (take care of not revealing it to others)", extensions = {'label': 'Password'}))
class IsAuth:
async def auth(self, request: Request, consume: Auth) -> AuthToken:
"""Authorizes email and password"""
token = await consume.authorize(self._table, request.app.config["JWT_SECRET"], request.app._models.User)
return token if token else ErrorMessage("The autentication has failed", 401)
async def forgot_password(self, request: Request, consume: ForgotPasswordRequest) -> Ok:
"""Sends a password recovery mail to the specified mail"""
from sanic.log import logger
user = await request.app._models.User.get(self._table, email = consume.email)
if not user:
return ErrorMessage("Unregistered email", 404)
prevToken = await PasswordResetToken.get(self._table, email = consume.email)
if prevToken:
return ErrorMessage("Already requested", 429)
token = PasswordResetToken(consume.email, path = "/")
token._table = self._table
await token.create()
await request.app.notify(request, 'forgot_password', actor = user, token = token)
async def reset_password(self, request: Request, consume: ResetPassword) -> Ok:
"""Reset the password authenticating the actor the forgot password token"""
from sanic.log import logger
logger.info(consume)
| 38.615385 | 198 | 0.726693 | 641 | 5,020 | 5.616225 | 0.277691 | 0.023333 | 0.03 | 0.035556 | 0.209444 | 0.152222 | 0.151111 | 0.104444 | 0.104444 | 0.104444 | 0 | 0.009474 | 0.158964 | 5,020 | 129 | 199 | 38.914729 | 0.843202 | 0.004781 | 0 | 0.136842 | 0 | 0.031579 | 0.119245 | 0.015761 | 0 | 0 | 0 | 0 | 0 | 1 | 0.073684 | false | 0.2 | 0.189474 | 0.021053 | 0.589474 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 2 |
68fab79f7a6200663e48015d71df80c194f90e0b | 261 | py | Python | volume/config.py | Napam/apartmentscience | 2724b94a9f00617c8f18994b07ee125c6d89d188 | [
"Apache-2.0"
] | null | null | null | volume/config.py | Napam/apartmentscience | 2724b94a9f00617c8f18994b07ee125c6d89d188 | [
"Apache-2.0"
] | null | null | null | volume/config.py | Napam/apartmentscience | 2724b94a9f00617c8f18994b07ee125c6d89d188 | [
"Apache-2.0"
] | null | null | null | import pathlib
import configparser
_alembicConfig = configparser.ConfigParser()
_alembicConfig.read("alembic.ini")
SQL_ADDRESS = _alembicConfig["alembic"]["sqlalchemy.url"]
TMP_DIR = pathlib.Path("data") / "tmp"
FINN_URL = "https://www.finn.no/api/search-qf"
| 26.1 | 57 | 0.766284 | 32 | 261 | 6.0625 | 0.6875 | 0.257732 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.08046 | 261 | 9 | 58 | 29 | 0.808333 | 0 | 0 | 0 | 0 | 0 | 0.275862 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.285714 | 0 | 0.285714 | 0 | 0 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
ec1d8e3dcc329b431051594eadc0219aca2fd48e | 1,248 | py | Python | dezirteer/const.py | dazdraperma/dezirteer | d46997b50c5e885e45950f65755147bdcbdb08f0 | [
"MIT"
] | 3 | 2021-07-18T19:25:37.000Z | 2021-11-26T06:44:48.000Z | dezirteer/const.py | dazdraperma/dezirteer | d46997b50c5e885e45950f65755147bdcbdb08f0 | [
"MIT"
] | 1 | 2018-09-04T09:58:36.000Z | 2018-09-04T09:58:36.000Z | dezirteer/const.py | dazdraperma/dezirteer | d46997b50c5e885e45950f65755147bdcbdb08f0 | [
"MIT"
] | 3 | 2018-08-27T05:55:34.000Z | 2021-07-20T07:22:45.000Z | LAMBDA_232 = 4.934E-11#Amelin and Zaitsev, 2002.
# LAMBDA_232 = 4.9475E-11 #old value, used in isoplot
ERR_LAMBDA_232 = 0.015E-11#Amelin and Zaitsev, 2002.
LAMBDA_235 = 9.8485E-10
#ERR_LAMBDA_235 =
LAMBDA_238 = 1.55125E-10
#ERR_LAMBDA_238 =
U238_U235 = 137.817 #https://doi.org/10.1016/j.gca.2018.06.014
# U238_U235 = 137.88 #old value, used in isoplot
ERR_U238_U235 = 0.031 ##https://doi.org/10.1016/j.gca.2018.06.014
lambdas = [LAMBDA_238, LAMBDA_235, LAMBDA_232]
isotope_ratios = ["U238_Pb206", "U235_Pb207", "Th232_Pb208", "Pb206_Pb207"]
minerals = ["zircon", "baddeleyite", "perovskite", "monazite", "apatite"]
EarthAge = 4600
sqrt2pi = 2.506628274631
listColumnNames = ['Th232/Pb208', 'err.Th232/Pb208',
'206Pb/207Pb', 'err.206Pb/207Pb',
'235U/207Pb', 'err.235U/207Pb',
'238U/206Pb', 'err.238U/206Pb',
'corr.',
'Age_232Th/208Pb', 'err.Age_232Th/208Pb',
'Age_206Pb/207Pb', 'err.Age_206Pb/207Pb',
'Age_238U/206Pb', 'err.Age_238U/206Pb',
'Age_235U/207Pb', 'err.Age_235U/207Pb',
'%disc.67-86', '%disc.86-57', 'is grain good?']
| 32.842105 | 75 | 0.591346 | 170 | 1,248 | 4.164706 | 0.435294 | 0.050847 | 0.028249 | 0.050847 | 0.231638 | 0.231638 | 0.084746 | 0.084746 | 0.084746 | 0.084746 | 0 | 0.301179 | 0.252404 | 1,248 | 37 | 76 | 33.72973 | 0.457663 | 0.209135 | 0 | 0 | 0 | 0 | 0.366154 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
ec369abeb37de118e09d34e4d3793bbe34def6d9 | 253 | py | Python | setup.py | jaycedowell/mnc_python | bc378ccc9a6cfaf76691122f072366b13e6ef092 | [
"BSD-3-Clause"
] | 2 | 2021-08-12T18:18:11.000Z | 2021-12-02T07:58:51.000Z | setup.py | jaycedowell/mnc_python | bc378ccc9a6cfaf76691122f072366b13e6ef092 | [
"BSD-3-Clause"
] | 1 | 2021-12-15T18:51:14.000Z | 2021-12-15T18:51:14.000Z | setup.py | jaycedowell/mnc_python | bc378ccc9a6cfaf76691122f072366b13e6ef092 | [
"BSD-3-Clause"
] | 1 | 2021-12-03T15:05:00.000Z | 2021-12-03T15:05:00.000Z | from setuptools import setup
from version import get_git_version
setup(name='mnc-python',
version=get_git_version(),
url='http://github.com/ovro-lwa/mnc-python',
requirements=['astropy'],
packages=['mnc'],
zip_safe=False)
| 25.3 | 50 | 0.679842 | 33 | 253 | 5.060606 | 0.666667 | 0.071856 | 0.155689 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.177866 | 253 | 9 | 51 | 28.111111 | 0.802885 | 0 | 0 | 0 | 0 | 0 | 0.225296 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.25 | 0 | 0.25 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
ec3a14c6144d721e7cea158c139c26dd612c2161 | 6,668 | py | Python | src/franz/openrdf/model/value.py | franzinc/agraph-python | 9186f19094af0be1daec273270888eadf9a68300 | [
"MIT"
] | 25 | 2015-11-05T03:43:30.000Z | 2022-03-09T07:19:09.000Z | src/franz/openrdf/model/value.py | franzinc/agraph-python | 9186f19094af0be1daec273270888eadf9a68300 | [
"MIT"
] | 14 | 2017-07-18T20:41:26.000Z | 2021-10-13T04:57:36.000Z | src/franz/openrdf/model/value.py | franzinc/agraph-python | 9186f19094af0be1daec273270888eadf9a68300 | [
"MIT"
] | 8 | 2016-12-09T02:38:45.000Z | 2020-10-12T07:59:17.000Z | #!/usr/bin/env python
# -*- coding: utf-8 -*-
# pylint: disable-msg=C0103
################################################################################
# Copyright (c) 2006-2017 Franz Inc.
# All rights reserved. This program and the accompanying materials are
# made available under the terms of the MIT License which accompanies
# this distribution, and is available at http://opensource.org/licenses/MIT
################################################################################
from __future__ import absolute_import
from __future__ import unicode_literals
import sys
import builtins
import weakref
from six import python_2_unicode_compatible
import six
from ..util import uris, strings
# Keys used to establish ordering between different types of terms
LITERAL_CMP_KEY = 1
URI_CMP_KEY = 2
BNODE_CMP_KEY = 3
@python_2_unicode_compatible
class Value(object):
"""
Top class in the org.openrdf.model interfaces.
"""
__slots__ = ('__weakref__',)
def __str__(self):
return self.toNTriples()
def __repr__(self):
result = self.toNTriples()
# Return an ascii string on Python 2, otherwise pytest gets confused
if sys.version_info < (3,):
result = result.encode('unicode-escape')
return result
def get_cmp_key(self):
"""
Return a key that will be used to compare and hash this object.
"""
raise NotImplementedError()
# Comparison methods rely on get_cmp_key.
def __eq__(self, other):
return self is other or (isinstance(other, Value)
and self.get_cmp_key() == other.get_cmp_key())
def __ne__(self, other):
return not self == other
def __hash__(self):
return hash(self.get_cmp_key())
def __lt__(self, other):
return self.get_cmp_key() < other.get_cmp_key()
def __gt__(self, other):
return self.get_cmp_key() > other.get_cmp_key()
def __le__(self, other):
return not self > other
def __ge__(self, other):
return not self < other
def toNTriples(self):
"""
Return an NTriples representation of an open rdf term
"""
raise NotImplementedError("Failed to implement 'toNTriples' on instance of type %s" % type(self).__name__)
class Resource(Value):
__slots__ = ()
pass
class URI(Resource):
"""
Lightweight implementation of the class 'URI'.
"""
__slots__ = ('_uri', '_is_canonical')
_instances = weakref.WeakValueDictionary()
def __new__(cls, uri=None, namespace=None, localname=None, canonical=True):
if isinstance(uri, URI):
if not canonical or uri._is_canonical:
return uri
uri = uri.uri
elif uri is None and namespace is not None:
uri = namespace + (localname or '')
if uri is None:
raise ValueError('Either URI or namespace is required.')
if canonical:
result = URI._instances.get(uri)
if result is not None:
return result
result = super(URI, cls).__new__(cls)
if canonical:
URI._instances[uri] = result
return result
def __init__(self, uri=None, namespace=None, localname=None, canonical=False):
if isinstance(uri, URI):
uri = uri.uri
if uri is None and namespace is not None:
uri = namespace + (localname or '')
if uri and uri[0] == '<' and uri[len(uri) - 1] == '>':
# be kind and trim the uri:
uri = uri[1:-1]
self._uri = uri
self._is_canonical = canonical
def get_cmp_key(self):
return URI_CMP_KEY, self.uri
def getURI(self):
"""
Return the URI (string) for 'self'. This method is typically
overloaded by subclasses, which may use lazy evaluation to
retrieve the string.
"""
return self._uri
uri = property(getURI)
def getValue(self):
return self.getURI()
value = property(getValue)
def getLocalName(self):
pos = uris.getLocalNameIndex(self.getURI())
return self.uri[pos:]
localname = property(getLocalName)
def getNamespace(self):
pos = uris.getLocalNameIndex(self.getURI())
return self.uri[:pos]
def split(self):
"""
Split into a namespace + local name pair.
"""
pos = uris.getLocalNameIndex(self.uri)
return self.uri[:pos], self.uri[pos:]
namespace = property(getNamespace)
def toNTriples(self):
"""
Return an NTriples representation of a resource, in this case, wrap
it in angle brackets.
"""
return strings.encode_ntriple_uri(self.uri)
def to_json_ld_key(self):
""" Converts to a string to be used as a JSON-LD key. """
return self.uri
def to_json_ld(self):
""" Converts to an object to be used as a JSON-LD value. """
return {"@id": self.uri}
class BNode(Resource):
"""
A blank node.
"""
__slots__ = ('id',)
def __init__(self, id=None):
"""
Create a blank node.
:param id: Node identifier, if not supplied one will be generated.
"""
if id is None:
id = 'b' + hex(builtins.id(self))
self.id = id
def getId(self):
"""
Get the identifier of this blank node.
"""
return self.id
getID = getId
getValue = getID
def get_cmp_key(self):
return BNODE_CMP_KEY, self.getId()
def toNTriples(self):
return "_:%s" % self.getId()
def to_json_ld_key(self):
""" Converts to a string to be used as a JSON-LD key. """
return self.toNTriples()
def to_json_ld(self):
""" Converts to an object to be used as a JSON-LD value. """
return {"@id": self.toNTriples()}
@python_2_unicode_compatible
class Namespace(object):
"""
"""
def __init__(self, prefix, name):
self.setPrefix(prefix)
self.setName(name)
def getName(self):
"""
Gets the name of the current namespace (i.e. it's URI).
"""
return self.name
def setName(self, name): self.name = name
def getPrefix(self):
"""
Gets the prefix of the current namespace.
"""
return self.prefix
def setPrefix(self, prefix): self.prefix = prefix
def __str__(self):
"""
Return an odd name (that's what the RDF4J code does).
"""
return self.prefix + " :: " + self.name
| 26.14902 | 114 | 0.580834 | 815 | 6,668 | 4.554601 | 0.265031 | 0.025862 | 0.02667 | 0.016164 | 0.27236 | 0.256735 | 0.236261 | 0.190194 | 0.163793 | 0.155711 | 0 | 0.005554 | 0.29799 | 6,668 | 254 | 115 | 26.251969 | 0.787439 | 0.226455 | 0 | 0.226563 | 0 | 0 | 0.032688 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.265625 | false | 0.007813 | 0.0625 | 0.09375 | 0.679688 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
6b79a8d3d15995a2a48974a4be33fc7c2168a05d | 616 | py | Python | app/main/model/deal_investor.py | luke-truitt/room40-underground | 174f57e0aa4b04bb7c983e10aaf4f4af6589d478 | [
"MIT"
] | null | null | null | app/main/model/deal_investor.py | luke-truitt/room40-underground | 174f57e0aa4b04bb7c983e10aaf4f4af6589d478 | [
"MIT"
] | null | null | null | app/main/model/deal_investor.py | luke-truitt/room40-underground | 174f57e0aa4b04bb7c983e10aaf4f4af6589d478 | [
"MIT"
] | 1 | 2021-07-21T13:36:13.000Z | 2021-07-21T13:36:13.000Z | from .. import db, flask_bcrypt
import datetime
import jwt
from app.main.model.blacklist import BlacklistToken
from ..config import key
class DealInvestor(db.Model):
""" DealInvestor Model is used to link deals to their respective investors """
__tablename__ = "deal_investor"
id = db.Column(db.Integer, primary_key=True, autoincrement=True)
deal_id = db.Column(db.Integer, db.ForeignKey('deal.id'))
investor_id = db.Column(db.Integer, db.ForeignKey('company.id'))
amount = db.Column(db.Integer)
investment_type = db.Column(db.String(255))
fund_invested = db.Column(db.String(255))
| 36.235294 | 82 | 0.733766 | 87 | 616 | 5.068966 | 0.482759 | 0.108844 | 0.136054 | 0.154195 | 0.306122 | 0.219955 | 0.14059 | 0 | 0 | 0 | 0 | 0.011429 | 0.147727 | 616 | 16 | 83 | 38.5 | 0.828571 | 0.113636 | 0 | 0 | 0 | 0 | 0.055762 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.384615 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
6b80b87f8ee4f931305c1464b4141765f243a780 | 642 | py | Python | py-lesson/HW4/Q3.py | jessie-233/python-exercise | 097f60978d316a7380e85686e0403cdf1ac482e9 | [
"MIT"
] | null | null | null | py-lesson/HW4/Q3.py | jessie-233/python-exercise | 097f60978d316a7380e85686e0403cdf1ac482e9 | [
"MIT"
] | 1 | 2020-10-01T13:52:54.000Z | 2020-10-01T13:54:37.000Z | py-lesson/HW4/Q3.py | jessie-233/python-exercise | 097f60978d316a7380e85686e0403cdf1ac482e9 | [
"MIT"
] | null | null | null | #!/usr/bin/env python
# coding: utf-8
# In[1]:
days_dict = {1:31, 2:29, 3:31, 4:30, 5:31, 6:30, 7:31,8:31, 9:30, 10:31, 11:30, 12:31}
start_week = {1:3, 2:6, 3:0, 4:3, 5:5, 6:1, 7:3, 8:6, 9:2, 10:4, 11:0, 12:2}
with open('Q3-output.txt', 'w') as f:
for i in range(1,13):
print('\n\n\t\t\t%d月'%i, file = f)
print('日\t一\t二\t三\t四\t五\t六', file = f)
for k in range(start_week[i]):
print('\t', end = '', file = f)
for j in range(1, days_dict[i]+1):
print(j, '\t', end = '', file = f)
if (start_week[i]+j) % 7 == 0:
print('\n', file = f)
# In[ ]:
| 23.777778 | 86 | 0.457944 | 134 | 642 | 2.156716 | 0.410448 | 0.086505 | 0.062284 | 0.062284 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.168142 | 0.29595 | 642 | 26 | 87 | 24.692308 | 0.471239 | 0.074766 | 0 | 0 | 0 | 0 | 0.088737 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0.416667 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 2 |
6b81d7df4138d109227c296d3f36cc5b8c75cc78 | 17,615 | py | Python | tests/test_hvactemplatesystempackagedvav.py | marcelosalles/pyidf | c2f744211572b5e14e29522aac1421ba88addb0e | [
"Apache-2.0"
] | 19 | 2015-12-08T23:33:51.000Z | 2022-01-31T04:41:10.000Z | tests/test_hvactemplatesystempackagedvav.py | marcelosalles/pyidf | c2f744211572b5e14e29522aac1421ba88addb0e | [
"Apache-2.0"
] | 2 | 2019-10-04T10:57:00.000Z | 2021-10-01T06:46:17.000Z | tests/test_hvactemplatesystempackagedvav.py | marcelosalles/pyidf | c2f744211572b5e14e29522aac1421ba88addb0e | [
"Apache-2.0"
] | 7 | 2015-11-04T02:25:01.000Z | 2021-12-08T03:14:28.000Z | import os
import tempfile
import unittest
import logging
from pyidf import ValidationLevel
import pyidf
from pyidf.idf import IDF
from pyidf.hvac_templates import HvactemplateSystemPackagedVav
log = logging.getLogger(__name__)
class TestHvactemplateSystemPackagedVav(unittest.TestCase):
def setUp(self):
self.fd, self.path = tempfile.mkstemp()
def tearDown(self):
os.remove(self.path)
def test_create_hvactemplatesystempackagedvav(self):
pyidf.validation_level = ValidationLevel.error
obj = HvactemplateSystemPackagedVav()
# alpha
var_name = "Name"
obj.name = var_name
# object-list
var_system_availability_schedule_name = "object-list|System Availability Schedule Name"
obj.system_availability_schedule_name = var_system_availability_schedule_name
# real
var_supply_fan_maximum_flow_rate = 0.0001
obj.supply_fan_maximum_flow_rate = var_supply_fan_maximum_flow_rate
# real
var_supply_fan_minimum_flow_rate = 0.0
obj.supply_fan_minimum_flow_rate = var_supply_fan_minimum_flow_rate
# alpha
var_supply_fan_placement = "DrawThrough"
obj.supply_fan_placement = var_supply_fan_placement
# real
var_supply_fan_total_efficiency = 0.50005
obj.supply_fan_total_efficiency = var_supply_fan_total_efficiency
# real
var_supply_fan_delta_pressure = 0.0
obj.supply_fan_delta_pressure = var_supply_fan_delta_pressure
# real
var_supply_fan_motor_efficiency = 0.50005
obj.supply_fan_motor_efficiency = var_supply_fan_motor_efficiency
# real
var_supply_fan_motor_in_air_stream_fraction = 0.5
obj.supply_fan_motor_in_air_stream_fraction = var_supply_fan_motor_in_air_stream_fraction
# alpha
var_cooling_coil_type = "TwoSpeedDX"
obj.cooling_coil_type = var_cooling_coil_type
# object-list
var_cooling_coil_availability_schedule_name = "object-list|Cooling Coil Availability Schedule Name"
obj.cooling_coil_availability_schedule_name = var_cooling_coil_availability_schedule_name
# object-list
var_cooling_coil_setpoint_schedule_name = "object-list|Cooling Coil Setpoint Schedule Name"
obj.cooling_coil_setpoint_schedule_name = var_cooling_coil_setpoint_schedule_name
# real
var_cooling_coil_design_setpoint = 13.13
obj.cooling_coil_design_setpoint = var_cooling_coil_design_setpoint
# real
var_cooling_coil_gross_rated_total_capacity = 14.14
obj.cooling_coil_gross_rated_total_capacity = var_cooling_coil_gross_rated_total_capacity
# real
var_cooling_coil_gross_rated_sensible_heat_ratio = 0.75
obj.cooling_coil_gross_rated_sensible_heat_ratio = var_cooling_coil_gross_rated_sensible_heat_ratio
# real
var_cooling_coil_gross_rated_cop = 0.0001
obj.cooling_coil_gross_rated_cop = var_cooling_coil_gross_rated_cop
# alpha
var_heating_coil_type = "HotWater"
obj.heating_coil_type = var_heating_coil_type
# object-list
var_heating_coil_availability_schedule_name = "object-list|Heating Coil Availability Schedule Name"
obj.heating_coil_availability_schedule_name = var_heating_coil_availability_schedule_name
# object-list
var_heating_coil_setpoint_schedule_name = "object-list|Heating Coil Setpoint Schedule Name"
obj.heating_coil_setpoint_schedule_name = var_heating_coil_setpoint_schedule_name
# real
var_heating_coil_design_setpoint = 20.2
obj.heating_coil_design_setpoint = var_heating_coil_design_setpoint
# real
var_heating_coil_capacity = 21.21
obj.heating_coil_capacity = var_heating_coil_capacity
# real
var_gas_heating_coil_efficiency = 0.5
obj.gas_heating_coil_efficiency = var_gas_heating_coil_efficiency
# real
var_gas_heating_coil_parasitic_electric_load = 0.0
obj.gas_heating_coil_parasitic_electric_load = var_gas_heating_coil_parasitic_electric_load
# real
var_maximum_outdoor_air_flow_rate = 0.0
obj.maximum_outdoor_air_flow_rate = var_maximum_outdoor_air_flow_rate
# real
var_minimum_outdoor_air_flow_rate = 0.0
obj.minimum_outdoor_air_flow_rate = var_minimum_outdoor_air_flow_rate
# alpha
var_minimum_outdoor_air_control_type = "FixedMinimum"
obj.minimum_outdoor_air_control_type = var_minimum_outdoor_air_control_type
# object-list
var_minimum_outdoor_air_schedule_name = "object-list|Minimum Outdoor Air Schedule Name"
obj.minimum_outdoor_air_schedule_name = var_minimum_outdoor_air_schedule_name
# alpha
var_economizer_type = "FixedDryBulb"
obj.economizer_type = var_economizer_type
# alpha
var_economizer_lockout = "NoLockout"
obj.economizer_lockout = var_economizer_lockout
# real
var_economizer_maximum_limit_drybulb_temperature = 30.3
obj.economizer_maximum_limit_drybulb_temperature = var_economizer_maximum_limit_drybulb_temperature
# real
var_economizer_maximum_limit_enthalpy = 31.31
obj.economizer_maximum_limit_enthalpy = var_economizer_maximum_limit_enthalpy
# real
var_economizer_maximum_limit_dewpoint_temperature = 32.32
obj.economizer_maximum_limit_dewpoint_temperature = var_economizer_maximum_limit_dewpoint_temperature
# real
var_economizer_minimum_limit_drybulb_temperature = 33.33
obj.economizer_minimum_limit_drybulb_temperature = var_economizer_minimum_limit_drybulb_temperature
# object-list
var_supply_plenum_name = "object-list|Supply Plenum Name"
obj.supply_plenum_name = var_supply_plenum_name
# object-list
var_return_plenum_name = "object-list|Return Plenum Name"
obj.return_plenum_name = var_return_plenum_name
# alpha
var_supply_fan_partload_power_coefficients = "InletVaneDampers"
obj.supply_fan_partload_power_coefficients = var_supply_fan_partload_power_coefficients
# alpha
var_night_cycle_control = "StayOff"
obj.night_cycle_control = var_night_cycle_control
# object-list
var_night_cycle_control_zone_name = "object-list|Night Cycle Control Zone Name"
obj.night_cycle_control_zone_name = var_night_cycle_control_zone_name
# alpha
var_heat_recovery_type = "None"
obj.heat_recovery_type = var_heat_recovery_type
# real
var_sensible_heat_recovery_effectiveness = 0.5
obj.sensible_heat_recovery_effectiveness = var_sensible_heat_recovery_effectiveness
# real
var_latent_heat_recovery_effectiveness = 0.5
obj.latent_heat_recovery_effectiveness = var_latent_heat_recovery_effectiveness
# alpha
var_cooling_coil_setpoint_reset_type = "None"
obj.cooling_coil_setpoint_reset_type = var_cooling_coil_setpoint_reset_type
# alpha
var_heating_coil_setpoint_reset_type = "None"
obj.heating_coil_setpoint_reset_type = var_heating_coil_setpoint_reset_type
# alpha
var_dehumidification_control_type = "None"
obj.dehumidification_control_type = var_dehumidification_control_type
# object-list
var_dehumidification_control_zone_name = "object-list|Dehumidification Control Zone Name"
obj.dehumidification_control_zone_name = var_dehumidification_control_zone_name
# real
var_dehumidification_setpoint = 50.0
obj.dehumidification_setpoint = var_dehumidification_setpoint
# alpha
var_humidifier_type = "None"
obj.humidifier_type = var_humidifier_type
# object-list
var_humidifier_availability_schedule_name = "object-list|Humidifier Availability Schedule Name"
obj.humidifier_availability_schedule_name = var_humidifier_availability_schedule_name
# real
var_humidifier_rated_capacity = 0.0
obj.humidifier_rated_capacity = var_humidifier_rated_capacity
# real
var_humidifier_rated_electric_power = 0.0
obj.humidifier_rated_electric_power = var_humidifier_rated_electric_power
# object-list
var_humidifier_control_zone_name = "object-list|Humidifier Control Zone Name"
obj.humidifier_control_zone_name = var_humidifier_control_zone_name
# real
var_humidifier_setpoint = 50.0
obj.humidifier_setpoint = var_humidifier_setpoint
# alpha
var_sizing_option = "Coincident"
obj.sizing_option = var_sizing_option
# alpha
var_return_fan = "Yes"
obj.return_fan = var_return_fan
# real
var_return_fan_total_efficiency = 0.50005
obj.return_fan_total_efficiency = var_return_fan_total_efficiency
# real
var_return_fan_delta_pressure = 0.0
obj.return_fan_delta_pressure = var_return_fan_delta_pressure
# real
var_return_fan_motor_efficiency = 0.50005
obj.return_fan_motor_efficiency = var_return_fan_motor_efficiency
# real
var_return_fan_motor_in_air_stream_fraction = 0.5
obj.return_fan_motor_in_air_stream_fraction = var_return_fan_motor_in_air_stream_fraction
# alpha
var_return_fan_partload_power_coefficients = "InletVaneDampers"
obj.return_fan_partload_power_coefficients = var_return_fan_partload_power_coefficients
idf = IDF()
idf.add(obj)
idf.save(self.path, check=False)
with open(self.path, mode='r') as f:
for line in f:
log.debug(line.strip())
idf2 = IDF(self.path)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].name, var_name)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].system_availability_schedule_name, var_system_availability_schedule_name)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_maximum_flow_rate, var_supply_fan_maximum_flow_rate)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_minimum_flow_rate, var_supply_fan_minimum_flow_rate)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_placement, var_supply_fan_placement)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_total_efficiency, var_supply_fan_total_efficiency)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_delta_pressure, var_supply_fan_delta_pressure)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_motor_efficiency, var_supply_fan_motor_efficiency)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_motor_in_air_stream_fraction, var_supply_fan_motor_in_air_stream_fraction)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_type, var_cooling_coil_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_availability_schedule_name, var_cooling_coil_availability_schedule_name)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_setpoint_schedule_name, var_cooling_coil_setpoint_schedule_name)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_design_setpoint, var_cooling_coil_design_setpoint)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_gross_rated_total_capacity, var_cooling_coil_gross_rated_total_capacity)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_gross_rated_sensible_heat_ratio, var_cooling_coil_gross_rated_sensible_heat_ratio)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_gross_rated_cop, var_cooling_coil_gross_rated_cop)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].heating_coil_type, var_heating_coil_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].heating_coil_availability_schedule_name, var_heating_coil_availability_schedule_name)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].heating_coil_setpoint_schedule_name, var_heating_coil_setpoint_schedule_name)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].heating_coil_design_setpoint, var_heating_coil_design_setpoint)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].heating_coil_capacity, var_heating_coil_capacity)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].gas_heating_coil_efficiency, var_gas_heating_coil_efficiency)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].gas_heating_coil_parasitic_electric_load, var_gas_heating_coil_parasitic_electric_load)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].maximum_outdoor_air_flow_rate, var_maximum_outdoor_air_flow_rate)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].minimum_outdoor_air_flow_rate, var_minimum_outdoor_air_flow_rate)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].minimum_outdoor_air_control_type, var_minimum_outdoor_air_control_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].minimum_outdoor_air_schedule_name, var_minimum_outdoor_air_schedule_name)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].economizer_type, var_economizer_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].economizer_lockout, var_economizer_lockout)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].economizer_maximum_limit_drybulb_temperature, var_economizer_maximum_limit_drybulb_temperature)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].economizer_maximum_limit_enthalpy, var_economizer_maximum_limit_enthalpy)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].economizer_maximum_limit_dewpoint_temperature, var_economizer_maximum_limit_dewpoint_temperature)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].economizer_minimum_limit_drybulb_temperature, var_economizer_minimum_limit_drybulb_temperature)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].supply_plenum_name, var_supply_plenum_name)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].return_plenum_name, var_return_plenum_name)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].supply_fan_partload_power_coefficients, var_supply_fan_partload_power_coefficients)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].night_cycle_control, var_night_cycle_control)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].night_cycle_control_zone_name, var_night_cycle_control_zone_name)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].heat_recovery_type, var_heat_recovery_type)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].sensible_heat_recovery_effectiveness, var_sensible_heat_recovery_effectiveness)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].latent_heat_recovery_effectiveness, var_latent_heat_recovery_effectiveness)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].cooling_coil_setpoint_reset_type, var_cooling_coil_setpoint_reset_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].heating_coil_setpoint_reset_type, var_heating_coil_setpoint_reset_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].dehumidification_control_type, var_dehumidification_control_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].dehumidification_control_zone_name, var_dehumidification_control_zone_name)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].dehumidification_setpoint, var_dehumidification_setpoint)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].humidifier_type, var_humidifier_type)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].humidifier_availability_schedule_name, var_humidifier_availability_schedule_name)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].humidifier_rated_capacity, var_humidifier_rated_capacity)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].humidifier_rated_electric_power, var_humidifier_rated_electric_power)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].humidifier_control_zone_name, var_humidifier_control_zone_name)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].humidifier_setpoint, var_humidifier_setpoint)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].sizing_option, var_sizing_option)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].return_fan, var_return_fan)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].return_fan_total_efficiency, var_return_fan_total_efficiency)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].return_fan_delta_pressure, var_return_fan_delta_pressure)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].return_fan_motor_efficiency, var_return_fan_motor_efficiency)
self.assertAlmostEqual(idf2.hvactemplatesystempackagedvavs[0].return_fan_motor_in_air_stream_fraction, var_return_fan_motor_in_air_stream_fraction)
self.assertEqual(idf2.hvactemplatesystempackagedvavs[0].return_fan_partload_power_coefficients, var_return_fan_partload_power_coefficients) | 65.240741 | 167 | 0.795572 | 2,052 | 17,615 | 6.295809 | 0.069688 | 0.155275 | 0.159842 | 0.127719 | 0.888304 | 0.786903 | 0.680161 | 0.55848 | 0.443533 | 0.252342 | 0 | 0.014618 | 0.153392 | 17,615 | 270 | 168 | 65.240741 | 0.851673 | 0.022424 | 0 | 0 | 0 | 0 | 0.038518 | 0.004196 | 0 | 0 | 0 | 0 | 0.293532 | 1 | 0.014925 | false | 0 | 0.039801 | 0 | 0.059701 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
6b83d0d9417fbfeb8bd14b3ee42701ee5d08783b | 43,043 | py | Python | t01_final_story.py | fall-2018-csc-226/t04-master | cf62ad87451f4309c4c580767e9d725382b35d33 | [
"MIT"
] | null | null | null | t01_final_story.py | fall-2018-csc-226/t04-master | cf62ad87451f4309c4c580767e9d725382b35d33 | [
"MIT"
] | 7 | 2018-09-19T15:37:58.000Z | 2018-10-01T14:54:46.000Z | t01_final_story.py | fall-2018-csc-226/t04-master | cf62ad87451f4309c4c580767e9d725382b35d33 | [
"MIT"
] | null | null | null | ######################################################################
# Author: The Fall 2018 226 Class!
#
# Assignment: T01: Choose Your Own Adventure
#
# Purpose: To create a choose-your-own-adventure style game.
# Each "twist" in the story is from a different group. The resulting story
# will either be incoherently random, or entertainingly "Mad Lib" like.
# Either way, it should be fun!
######################################################################
# Acknowledgements:
# Original Author: Dr. Scott Heggen
#
# Inspired by https://www.cs.hmc.edu/twiki/bin/view/CS5/Week0ChoiceProblem
######################################################################
from time import sleep
delay = 1.0 # change to 0.0 for testing/speed runs; larger for dramatic effect!
dead = False # You start out not dead, which is good.
injured = 0 # You start with 100% of your limbs! When this reaches two, you die!
flashlight = 0 # You have no source of light!
antisoftlock = 0 # For loops
checkGlint = 0 # Tracking!
checkPool = 0 # ^
# Asks the user to input their name.
username = input("What do they call you, unworthy adversary? ")
#########################################################################################################
# The following is the first part of the story. Don't change this section.
print()
print("Welcome,", username, ", to the labyrinth.")
sleep(delay)
print("Before you lies two paths. One path leads to treasures of unimaginable worth.")
print("The other, certain death. Choose wisely.")
print()
sleep(delay * 2)
print("You are in a dark cave. You can see nothing.")
print("Staying here is certainly not wise. You must find your way out.")
print()
sleep(delay)
#########################################################################################################
# This is an example chapter. Your story will follow a similar structure.
# You will learn more by NOT copy and pasting this section. Write your section on your own, and when you get stuck,
# refer to this code to help you get unstuck. Of course, raise your hand if you get really stuck.
direction = input("Which direction would you like to go? [North/South/East/West]" )
if direction == "North":
# Good choice!
print("You are still trapped in the dark, but someone else is there with you now! I hope they're friendly...")
sleep(delay)
elif direction == "South":
# Oh... Bad choice
print("You hear a growl. Not a stomach growl. More like a big nasty animal growl.")
sleep(delay)
print("Oops. Turns out the cave was home to a nasty grizzly bear. ")
print("Running seems like a good idea now. But... it's really, really dark.")
print("You turn and run like hell. The bear wakes up to the sound of your head bouncing off a low stalactite. ")
print("He eats you. You are delicious.")
dead = True
else:
# Neutral choice
print("You're in another part of the cave. It is equally dark, and equally uninteresting. Please get me out of here!")
sleep(delay)
if dead == True:
print("Oh no! You died. Better luck next time! Try again by hitting the green play button. ")
quit()
#########################################################################################################
# Christson & Alfaro
# Refactored by Team 1
direction = input("Where do you want to go today?. Choose carefully hahaahhaha [Wakanda, New York, Asgard, Gotham City]")
if direction == "Asgard":
# Well done!
print()
print("Wow, I'm shocked!. Good Choice!")
print()
print()
sleep(delay)
print("Thor deems you worthy to fight by his side! Welcome to Asgard", username,)
sleep(delay)
elif direction == "Gotham City":
#oh.. bad choice
print()
sleep(delay * 2)
print("You find yourself in an dark alley, you hear two gunshots *bang, bang*")
sleep(delay * 2)
print("A man runs past you, no witnesses he says...")
sleep (delay *2 )
print ("*Bang*")
print(username,"You're Dead")
dead = True
elif direction == "Wakanda":
#interesting choice
print()
name = input ("Are you a Wakanda citizen ?")
if name == "Yes":
sleep (delay *2 )
print("Welcome back, your family missed you", username,)
else:
sleep (delay *2 )
print ("You can't find Wakanda. You only see a rhino here")
print("He looks friendly but this is boring")
sleep (delay *2 )
else:
#neutral choice
print("You are in New York. Not much for you to do here")
sleep (delay *2 )
print("Press the green button so you can see if you have better luck next time")
sleep(delay * 2)
if dead == True:
print("Oh no! You died. Better luck next time! Try again by hitting the green play button. ")
quit()
#########################################################################################################
# toktobaeva & coxb
# Refactored by Team 2
print ()
print ()
direction = input ("As a Berean, no matter where you end up, you have to constantly make this hard decision: Go to dining or Go do homework, what do you say? [Go to dining/Go do homework]")
if direction == "Go to dining":
# Good choice!
print ()
print("you get tired of this trivial cave and leave and head to dining to meet up friends")
print ()
sleep(delay*3)
elif direction == "Go do homework":
# Bad choice!
print ()
sleep (delay*3)
print("You think you are making the right choice to conform to this capitalist world.")
sleep(delay*3)
print ()
print("When you, at heart, are a leftist Marxist")
sleep(delay*3)
print ()
print("You know you shouldn't be enslaved by the instiution that is generally accepted in the form of")
sleep(delay*3)
print ()
print("'all american college'")
sleep(delay*3)
print ()
print("You graduate with a degree.")
sleep(delay*3)
print ()
print("Work an 8-5 job.")
sleep(delay*3)
print ()
print("Have two children.")
sleep(delay*3)
print ()
print("Get old.")
sleep(delay*3)
print ()
print("And, when sitting at your white wood porch, looking at your old pictures, quietly sob realizing...")
sleep(delay*3)
print ()
print("that you should have gone to the dining hall")
sleep(delay*3)
print ()
print ("You die a victim of this machine.")
print ()
print ()
dead = True
else:
sleep (delay)
print ()
print("You are not a true Berean.")
print ()
sleep(delay)
if dead == True:
sleep(delay)
print("Oh no. You are dead. Bye.")
quit()
money = int(input ("How much is your family income?"))
if money < 30000:
sleep (delay)
print ()
print ("Berea, berea, beloved")
elif money > 30000:
sleep (delay)
print ()
print ("you don't belong here")
dead = True
else:
sleep (delay)
print ("illiterate. bye. *middle finger emoji* *clown emoji* *middle finger emoji*")
if dead == True:
print ("go back to the centre college where you belong.")
quit ()
#########################################################################################################
# cullomn & coreass
# Refactored by Team 3
print()
print("You wake up in the middle of the night to footsteps coming down the hallway.")
sleep (delay * 2)
print()
print("You could hide in the closet, go out the window, or go investigate.")
print()
choice = input("What do you want to do? (Please type closet, window, or investigate)")
if choice == "window":
#good choice
print()
print("You managed to land safely in a bush. And run to a neighbor's house to call the police.")
sleep(delay)
elif choice == "investigate":
#bad choice
print("While trying to investigate, you heard a loud bang.")
print()
sleep(delay)
print("You got so startled that you tripped and fell down the stairs. Better luck next time!")
dead = True
else:
# Neutral Choice
print("After finding your way to the closet, the footsteps enter your room")
print()
print("You see the shadows of the invader's feet in front of the door.")
sleep(delay)
print()
print("The footsteps slowly leave your room, and downstairs you hear the front door close.")
print("You are safe and alone, but are they coming back?")
if dead == True:
print()
print("Sorry you died, have a nice funeral! If you want to play again hit the green button.")
quit()
#########################################################################################################
# Morgan's & Matilda
# Refactored by Team 4
#Sleep is between the lines to make it so a wall of text doesn't appear at once.
print("You hear some sort of... Odd sound. Is that a dripping sound?")
sleep(delay)
print("It sounds like it's coming from a side path, though you were remaining on the main one.")
sleep(delay)
print("It might be rain from outside. Or, maybe even an underground oasis.")
sleep(delay)
print("Or, perhaps, something a lot more dangerous...")
sleep(delay * 2)
direction = input("What do you do? [Ignore, Investigate, Run like hell]")
if direction == "Ignore":
#Good choice!
print("You carry on down the path, ignoring the strange sound.")
sleep(delay)
print("As you walk, you hear the sound of water rushing behind you.")
sleep(delay)
print("Glancing back, you notice that water had suddenly burst from the side tunnel into the other.")
sleep(delay)
print("Good thing you avoided that. Close call.")
elif direction == "Investigate":
#Bad choice!
print("You decide, for some reason, to go check out the suspicious dripping sound.")
sleep(delay)
print("As you walk, you feel the droplets of water soak into your shirt, and a roaring sound fills you ears.")
sleep(delay * 2)
print("... Shit.")
sleep(delay * 2)
print("A sudden rush of water drags you along, and though you try and fight the current, it's no use.")
sleep(delay)
print("Guess this is the end.")
dead=True
else:
#Guess what? TWO BAD ENDS. AHAHHAHA.
print("Rather than doing either option that would be somewhat sensible, you make a horrible decision.")
sleep(delay)
print("Breaking out into a sprint, you start to run from that location.")
sleep(delay)
print("Frankly, the cave's floors are slick from water.")
sleep(delay)
print("You trip and fall, hitting your head on the rocky floor.")
sleep(delay)
print("As you start to lose consciousness, you hear the sound of a creature moving somewhere nearby.")
sleep(delay)
print("You're perfect prey like this.")
dead=True
if dead == True:
sleep(delay)
print("Ha! Guess that's the end. Good job, sucker.")
quit()
#'s Chapter
print(" You hear an odd sound. You feel your way around and see that there are two options.")
print (" Option 1: Investigate ")
print ( "Option 2: Scale the cave wall and go through an opening in the cave")
print ("Option 3:Stay where you are")
direction= input(" Which choice do you make? [ Option 1, Option 2, Option 3]")
if direction == "Option 1":
print (" The odd sound belonged to an animal. You made for a tasty meal")
dead=True
sleep(delay)
elif direction== "Option 2":
print (" You made it to another part of the cave!")
sleep(delay)
print (" Unfortunately, you trip over a boulder, fall back through the opening, and you are now injured")
dead=False
else:
print (" The noise is getting louder and you are still in danger.")
sleep(delay)
print ("However, it appears the darkenss of the cave is keeping you alive...for now ")
dead= False
if dead == True:
print(" Looks like you've reached the end of the road. Better luck next time!")
quit()
#########################################################################################################
# Dunn & Dovranov
# Refactored by Team 5
direction = input("Where do you want to go? [North/South/East/West]" )
if direction == "East":
# Bad Choice
print("You followed the light and it led to another person that was lost.")
print("Slowly approaching the other person you fall and they now know they are not alone.")
print("You are now injured and the other person is leaving you because of the noise.")
print("After they have left you fall asleep.")
sleep(delay)
print("You awaken to the noise of bear that is approaching closer to you.")
print("Unfortunately, you can't walk and the bear is close to you.")
print("The bear is hungry and is looking for a delicious meal.")
print("The bear begins to eat you.")
print("You have one more chance to live. You see a rock.")
userinput = input ("Can you grab it? [Yes/No]")
if userinput == "Yes":
print("You hit the bear and it runs off.")
elif userinput == "No":
print("The bear ate you.")
else :
print("The bear ate you.")
dead = True
elif direction == "West":
# Good choice
print("You are walking in the dark and you stumble across something on the ground.")
print("You bend over and pick it up.")
print("It is a flashlight!")
print("However, you are still in the dark but now you have a flashlight to see more with so you do not fall.")
sleep(delay)
else:
# Neutral choice
print("You found a place to stay for the night until daytime.")
sleep(delay)
if dead == True:
print("Oh no! You died. Try again by hitting the green play button.")
quit()
#########################################################################################################
# lovelle
# Refactored by Team 6
direction = input("Which direction would you like to go? [North/South/East/West] ")
if direction == "East":
# Good choice
print("You come upon an underground lake, fed by a glistening stream.")
print("The sound of the water soothes your troubled nerves.")
sleep(delay)
elif direction == "South":
# Bad choice
print("Ever so suddenly, you find yourself surrounded by ogres twice your size.")
print("They realize you are harmless and you catch your breath. It seems they might let you pass...")
sleep(delay * 3)
print("They strike up a song, ready to continue on their way.")
print("Oh, but how loud their voices are! And you aren't feeling so good...")
sleep(delay * 3)
print("The leader asks you to rank the quality of their singing, on a scale of 1 to 10.")
rating = int(input("What do you say? Choose wisely; your life depends on it... "))
if rating < 10:
print("You fall to the ground, feeling the power of a cursed song. Looks like your time is up, friend.")
dead = True
else:
print("The ogre thanks you for the complement and sends you on your merry way.")
else:
# Neutral choice
print("Phew, you're still on solid ground. But still in the dark. Think fast!")
sleep(delay)
if dead == True:
print("Oh no! You died. And what a shame it had to happen this way.")
print("Better luck next time - try again by hitting the green play button!")
quit()
#########################################################################################################
# Eppersonb & Barnetth
# Refactored by Team 7
print()
print(username, "continues on their quest")
sleep(delay)
print("You continue your path in the forest")
print("As you walk through the forest, you encounter a bear wearing a fez and sunglasses.")
print(
"You notice that the fez has the name 'Bosco' labeled on it. You deduce that this is the famous runaway circus bear, Bosco the Bear.")
sleep(delay)
print()
print("However, Bosco has took notice of you and stands on his hind legs and takes interest in you.")
print("You must make a choice, or it could end very badly for you!")
choice = input("What would you like to do? [Entertain or Fight?]")
if choice == "Fight":
#Good Choice!
print("You choose to engage in fisticuffs with Bosco the Bear. This seems like a very bad idea.")
print()
sleep(delay)
print("Luckily for you, Bosco the Bear lived in the circus his whole life. He does not know how to fight.")
print("Feeling intimated, Bosco the Bear flees. Dropping his fez and glasses.")
print()
print("You are free to continue on your journey while rocking the fez and glasses. Well at least you look nice.")
print()
elif choice == "Entertain":
# Bad Choice
print("Bosco the Bear is not amused with your performance.")
print()
sleep(delay)
print("He ran away from the circus because he hated that life.")
print("Your entertainment reminded him of that hatred. How inconsiderate of you.")
print()
sleep(delay)
print("In a fit of rage, Bosco the Bear kills you with his bare hands.")
print()
dead = True
else:
#Neutral Choice
print("Bosco the Bear is confused by your actions.")
print("Bosco the Bear does not see you as a threat and leaves.")
print()
print("You are free to continue on your journey.")
print()
if dead == True:
print("Oh no! You died. Better luck next time! Try again by hiting the green play button. ")
quit()
#########################################################################################################
# Guillermo & Tanner
# Refactored by Team 8
#We pick it up from the point where you are in a dark room with a stranger. What happens next?
decision = input("The stranger tells you that he knows the way out, but you have to follow his every word. What is your decision? [I trust you/No way, No thank you] ")
if decision == "I trust you" :
#Good choice!
print("The stranger is overcome with joy, and hands you flashlight and a ham sandwich.")
sleep(delay)
elif decision == "No way" :
#Bad choice...
print("Your unwillingness to trust the stranger angers him. He begins to chase you through the dark cave, and you find a place to hide. You hide there for several days.")
sleep(delay)
print("After several days of hiding, you begin to fell fatigued. You lose consciousness, and the stranger is able to find your body and he dismembers you.")
dead = True
else:
print("You respectfully decline his offer, and decide to wonder around in the dark by yourself. You wonder in the dark for hours, and make no progress. ")
sleep(delay)
if dead == True:
print("You died, oh no! Try again by hitting the green button.")
quit()
#########################################################################################################
# hilljac & nudgarrobot
# Refactored by Team 9
direction = input("Which direction would you like to go? [North/South/East/West]" )
if direction == "South":
# Good choice!
print("...")
sleep(delay)
print("Ooooooo boy!! You enter a room FILLED WITH GOLD!")
sleep(delay)
print("In addition to the gold, there seems to be a flashlight right in front of you! This is too good to be true!!")
sleep(delay)
itemChoice = input("What do you do? [Pocket the gold]/[Grab the flashlight]/[Try to grab both]")
sleep(delay)
if itemChoice == "Pocket the gold":
print("You stuff your pockets as full as you can, and continue on your journey")
sleep(delay*3)
print("But wait!!")
sleep(delay)
print("Suddenly an enchanted skeleton appears, demanding that you return the gold, or pay with your life")
skeletonChoice = input("Which will you do? [Keep the gold / Leave the gold]")
sleep(delay)
#branching good path
if skeletonChoice == "Keep the gold":
print("You decide to keep the gold for yourself, and attempt to run for your life. You escape the room, but in the process, the skeleton stabs you in the shoulder, injuring you for the duration of the adventure")
elif skeletonChoice == "Leave the gold":
print("You leave the gold and peacefully leave the room. Satisfied with your following his orders, the skeleton disappears. Your adventure continues")
else:
print("You have the confused the skeleton.")
sleep(delay)
print("Now the skeleton is angry!")
sleep(delay*5)
print("the skeleton has killed you...")
sleep(delay)
dead = True
sleep(delay)
if dead == True:
print("Oh no! You died. Better luck next time! Try again by hitting the green play button. ")
quit()
elif itemChoice == "Grab the flashlight":
print("You decide to play it safe and only grab the flashlight. Obviously, the gold was a trap.")
sleep(delay)
print("You peacefully leave the room and your adventure continues. Also, now you have a flashlight!")
elif itemChoice == "Try to grab both":
print("You rush towards the motherlode in front of you!")
sleep(delay)
print("You grab the flashlight and start stuffing your pockets with as much gold as you can carry.")
sleep(delay)
print("You're gonna be so ri-")
sleep(delay*2)
print("everything is going dark...")
sleep(delay*2)
print("you're not sure, but you feel as though you have been stabbed from behind.")
sleep(delay*2)
print("You fall to the ground...")
sleep(delay*2)
dead = True
sleep(delay)
if dead == True:
print("Oh no! You died. Better luck next time! Try again by hitting the green play button. ")
quit()
else:
print("You decide this whole situation is too good to be true, and is certainly a trap.")
sleep(delay)
print("You turn away and your adventure continues.")
elif direction == "East":
# Bad direction 2. Internal decisions can make it a trade, but an injury is normally guaranteed.
print("You notice a rather low overhang in the darkness of the cave")
sleep(delay)
print("You're wary, but nothing's going to get done if you're overly hesitant.")
sleep(delay)
print("You crawl under the overhang and realize it's more of a short tunnel-")
sleep(delay)
print("It's very narrow, and you barely make your way out the other side.")
sleep(delay*1.33)
print("The air is has a notable chill and movement on the other side of the tunnel,")
sleep(delay)
print("and you hear a faint dripping reverberating through the space.")
sleep(delay)
if flashlight == 1:
print("You sweep the flashlight over the space, but its beam doesn't reach the opposite wall.")
sleep(delay*2)
print("The stone in this part of the cave is smooth, seemingly worn down.")
sleep(delay)
print("The light does, however, illuminate a layer of mist swirling over a small pool")
sleep(delay*1.33)
print("The pool is perfectly still, and despite the darkness, is a deep, almost ethereal blue.")
sleep(delay*2.33)
print("In the far side of the cave, you see something small glisten as you sweep the flashlight over it.")
choice = input("[Inspect pool]/[Check Glint]")
#TODO Flesh out choices for flashlight-enabled play!
if choice == "Check Glint":
print("You carefully walk around the pool and inspect the base of the wall for anything unusual.")
sleep(delay)
print("Unlike most of the room, there are rough, broken rocks here and a crack in the wall.")
sleep(delay)
print("Sifting through the rocks and debris, you find a kind of cup--")
sleep(delay)
print("The cup is shaped in such a way as to resemble a stemless goblet.")
sleep(delay)
print("It's inlaid with small gemstones, and strange symbols mark its surface.")
sleep(delay)
print("You decide that it's worth keeping.")
checkGlint = 1
chalice = 1
elif choice == "Inspect pool":
checkPool = 1
print("You walk up to the lip of the pool. As you approach, the mist recedes.")
sleep(delay)
print("Thick and unnatural, the mist seems almost to pulse as you draw near.")
sleep(delay)
print("Upon closer observation, the pool is by no means water-")
sleep(delay)
print("Instead, it's a thinner liquid, so much so that the edge seems at times to blur with the mist above it.")
sleep(delay)
print("As you remain by the edge, the mist seems to grow more agitated in its swirling.")
sleep(delay)
if checkGlint == 1:
choice = input("[Collect from Pool]/[Touch Pool]/[Remain Motionless]/[Retreat]")
else:
choice = input("[Check Glint]/[Touch Pool]/[Remain Motionless]/[Retreat]")
if choice == "Touch Pool":
print("You dip your hand into the crystal clear liquid.")
sleep(delay)
print("It feels strange, as if it were fine silk that was impossible to hold.")
sleep(delay)
print("Suddenly, you feel something coil around your wrist")
sleep(delay)
print("But the pool is still perfectly clear, and you see nothing.")
sleep(delay)
print("In panic you try to wrest your arm free, but only throw yourself off balance.")
sleep(delay)
print("Your other arm plunges into the pool as you try to steady yourself")
sleep(delay)
print("You claw at your bound wrist, trying to remove the invisible restraint")
sleep(delay)
print("But your hand finds nothing to grasp.")
sleep(delay)
print("You struggle helplessly against the swirling fluid, which is now pulling your arms deeper")
sleep(delay)
print("Absorbed in your struggle, you notice the mist too late--")
sleep(delay)
print("It has rolled forward, and is upon you, enveloping you.")
sleep(delay)
print("Forced to breathe it in, the last of your strength drains away")
sleep(delay)
print("As your vision slowly goes black, the last you feel is the soft, silky feeling of the pool's embrace.")
sleep(delay)
sleep(delay)
dead = True
elif choice == "Check Glint":
print("You carefully walk around the pool and inspect the base of the wall for anything unusual.")
sleep(delay)
print("Unlike most of the room, there are rough, broken rocks here and a crack in the wall.")
sleep(delay)
print("Sifting through the rocks and debris, you find a kind of cup--")
sleep(delay)
print("The cup is shaped in such a way as to resemble a stemless goblet.")
sleep(delay)
print("It's inlaid with small gemstones, and strange symbols mark its surface.")
sleep(delay)
print("You decide that it's worth keeping, but upon taking it the wall behind caves in--")
sleep(delay)
print("You're blinded by light pouring through the opening the cave in created.")
sleep(delay)
print("When you can see again, you realize you're looking out over a range of mountains.")
sleep(delay)
print("Far from being deep underground, you had been trapped in the top of a mountain!")
sleep(delay)
print("You step out and breathe a sigh of relief in the clean mountain air.")
checkGlint = 1
chalice = 1
else:
print("If you're seeing this, you've probably referred to one of our placeholders!")
print("While we intend to flesh these out later, at present it would be detrimental")
print("to assignment deadlines! Speaking of deadlines, this is one! Have fun replaying!")
dead = True
else:
print("Although the room is still too dark to see anything, the cavern feels immense.")
sleep(delay)
print("The cave floor under you feels smoother than the rest of the cave so far.")
print("You place a hand on the wall to ground yourself- In the pitch blackness, you feel you could easily lose yourself.")
sleep(delay*1.33)
print("The wall is angled inward, and is just as smooth as the floor.")
print("You don't particularly feel the space inviting...")
sleep(delay*2)
print("...But you still need to find a way out of here.")
while antisoftlock == 0:
choice = input("[Follow wall]/[Venture into dark]/[Retreat through tunnel]")
if choice == "Follow wall":
print("Placeholder text, you follow the wall.")
antisoftlock = antisoftlock + 1
elif choice == "Venture into dark":
print("Placeholder text, you leave the wall and walk into the inky blackness.")
antisoftlock = antisoftlock + 1
elif choice == "Retreat through tunnel":
print("Placeholder text. The tunnel is too wide to retreat through without forcing yourself through.")
else:
print("If you're seeing this, you've probably referred to one of our placeholders!")
print("(Or just something that doesn't exist!)")
print("While we intend to flesh these out later, at present it would be detrimental")
print("to assignment deadlines! Speaking of deadlines, this is one! Have fun replaying!")
dead = True
else:
# Neutral choice
print("You're in another part of the cave. It is equally dark, and equally uninteresting. Please get me out of here!")
sleep(delay)
if dead == True:
print("Oh no! You died. Better luck next time! Try again by hitting the green play button. ")
quit()
#########################################################################################################
# jamalie & juem
# Refactored by Team 10
direction = input("There is a river in your path, what would you do to cross the river? (swim, make a bridge,etc)")
sleep(delay)
if direction == "make a bridge":
# this is the best choice!
print("Well done, you have made a wise choice")
print("you reward is that you will survive and explore more of the jungle")
sleep(delay)
elif direction == "swim":
# surprisingly, this is a bad choice!
print("Oh,no! Just like Goblet of Fire, there are deadly mermaids looking for fresh blood")
print("you will be dragged down the ocean to be eaten at a feast")
sleep(delay*3)
print("Now you're in their territory, you see some Gillyweeds just next to where you're trap")
sleep(delay*3)
print("You should be careful with eating Gillyweed")
direction = int(input("You have the option to eat between 1-3 strands of Gillyweed, what will you do?"))
if direction <= 2:
# Good idea
print("Good job! now you have more strength and you can breath under water!")
sleep(delay*3)
print("fight them and survive")
elif direction > 2 and direction <= 3:
# this is a bad idea
print("Too much Gillyweed will cause suffocation!")
dead = True
sleep(delay*5)
else:
# We would like the user to use whole number
print("Since you did not choose from the given numbers, your only chance is to fight and survive")
else:
# this is a neutral choice!
print("Well done for the creativity! you crossed the river!")
sleep(delay*3)
print("but...")
sleep(delay*3)
print("you got injured for the hard work, so you can't move on and you need to rest by the river")
sleep(delay)
if dead == True:
print("oops.. I guess that's all for you!")
sleep(delay*3)
print("you were not very successful this time")
sleep(delay*3)
print("see you in your next journey")
#########################################################################################################
# nashab & phillipsvi
# Refactored by Team 11
print()
print("To your left, you notice a house. Curious... Looking around more, you see a cat behind you.")
print("The cat has seven tails and a missing eye. You ponder for a moment. You feel sleepy.")
sleep(delay * 2)
print()
direction = input ("What will you do? [House/Cat/Sleep]")
if direction == "House":
#bad choice
print("You decide that you need help and make your way towards the house. The path is a bit rocky though...")
sleep(delay)
print("...")
sleep(delay)
print("......")
sleep(delay)
print(".........")
sleep(delay * 2)
print("Oh no! You tripped on a rock! It was so shocking, you die before you hit the ground.")
dead = True
elif direction == "Cat":
# neutral choice
print("The cat is just so damn intriguing, you can't help but examine it.")
print("You stretch out your hand, and the cat nuzzles you, its several tails twitching affectionately.")
print("This is nice, but accomplishes nothing.")
sleep (delay)
print()
print ("You waste time loving the cat, but nothing gets done.")
sleep (delay)
dead == False
else:
print ("You disregaurd that because you fell asleep.")
sleep (delay * 5)
print ("You awake feeling refreshed.")
dead == False
if dead == True:
print("What a sad way to die.")
quit()
#########################################################################################################
# prattw & phillipsde
# Refactored by Team 12
print()
print('An eerie box lays before you, and for some reason you are drawn to it.')
print()
print('As you draw closer you hear a voice in your head...')
print()
print('"In order to receive the treasures of the box you must reveal your deepest and darkest secret"')
choice = input('Will you reveal your secret? [Yes/No]')
if choice == "Yes" or choice == "Y":
secret = input('Speak now and reveal the truth.')
print(secret)
print("The box opens and you reach inside to retrieve your treasure...")
sleep(delay)
print()
print('''It's a flower with petals made of fire and a note that says, "It's a me, copyright."''' )
sleep(delay)
print()
print('Confused by the note, you take your reward and move on.')
print()
sleep(delay)
elif choice == "No" or choice == "N":
death = input('Will you open the box? [Yes/No]')
if death == "Yes":
print('You attempt to open the box but you become consumed by a deadly darkness that envelops your body.')
print()
print('You died. LOL')
revive=input("would You like to restart")
if revive=="Yes":
riddle=input("What starts with 'e' ends with 'e' and contains one letter? "
"[a/an]")
if riddle=="envelope":
print("you live good job but you don't get the treasure")
if revive=="No":
print("ah its your choice")
quit()
elif death == "No":
print('You decide not to open the box.')
print()
print('You feel like you have avoided some mysterious danger but missed out on some sweet loot.')
else:
print("You walk away")
#hi
#########################################################################################################
# mayerss & kinyunaa
# Refactored by Team 13
jump = input("which direction would you like to go?[jump/stay/parachute]")
if jump == "jump":
#bad choice
print("you fall from the sky and land on your head..")
print("your skull burst open and your brains spread everywhere")
print("your chances of survival are zero")
print("youre dead meat")
dead = True
sleep(delay)
elif jump == "parachute":
#good choice
print("Open your parachute at approximately 1000 feet and you avoid injury")
print("Congratulations you passed your parachute test today!")
else:
print("you decided to stay. so now you are alone in the cave and have to find your way out")
if dead == True:
print("You died at least you dont have to take 226 anymore :)")
#########################################################################################################
# stettner & vankirk
# Refactored by Team 14
direction = input(" You see a ladder in front of you and hear Water to the right. Do you want to go for a Swim or Climb the ladder? "
"[Swim, Climb]")
print()
if direction == "Climb":
print(" When you reach the top of the ladder you come face to face with a demented clown")
print("The clown jumps at you causing you to fall back and break your right arm but as you were falling you caught a glimpse "
"of a tunnel to your left.")
sleep(delay)
direction == input (" Would you like to take a Hike or go for a Swim? [Hike, Swim]")
elif direction == "Swim":
print("As you go into the water you see a faint outline of a hole accros from you and you begin to swim towards it.")
print("With your nose almost even with the watter you are able to fit through the hole.")
sleep(delay)
if direction == "Hike":
sleep(delay)
print("As you go down the path to your left, you hear a large form coming for you. "
"You start running instinctively but you are not fast enough... ")
dead = True
else:
print("That was not an option!")
dead= True
if dead == True:
sleep(delay)
print("Oh no! You died. Better luck next time! Try again by hitting the green play button. ")
quit()
#########################################################################################################
# stetzera and whitfordr
# Refactored by Team 15
print()
print("A figure emerges from the shadows, hunched and withered. Her single good eye turns to face you -- a witch!")
sleep(delay)
print("Two more eyes blink out of the darkness, the witch's black cat slinking their way out from around the hem of her dress.")
sleep(delay)
#Exposition for the upcoming choices.
choice = input("The witch stares at you, blocking the way forward. What do you do? [Pet the cat/Attack the witch/Run away]")
if choice == "Pet the cat":
#Cats always equal best choice.
print("You kneel down, holding out a hand to the cat.")
print("The kitty pads forward, sniffing at you...")
sleep(delay *5)
print("The little black cat purrs.")
print("With a throaty laugh the witch shuffles to the side, apparently trusting her cat's judgement. You're free to go!")
elif choice == "Attack the witch":
#What sort of idiot attacks a mysterious woman with a cat? How rude.
print("Fearing for your life -- it's a witch, who trusts witches? -- you pull out a dagger from the sheathe at your belt.")
print("With a echoing bellow you rush forward, only to find yourself frozen in place.")
print("A hex!")
dead = True
elif choice == "Run away":
#Arguably the most rational.
print("Not your circus, not your monkeys.")
print("You just turn around, avoid eye contact and meander back into the darkness of the cave from whence you came.")
else:
#Neutral/indecisive choice.
print("You find yourself full of strange thoughts, pulled backwards into the labyrinth once more.")
sleep(delay)
if dead == True:
print("Your muscles lock up, which, unfortunately, includes your heart.")
sleep(delay)
print("As your lifeless body falls to the ground, the witch and cat both turn, melting back into the shadows of the cave.")
print("Serves you right for attacking a mostly-defenseless old woman.")
print("Better luck next time! Try again by hitting the green play button.")
quit()
#########################################################################################################
# Refactored by Team 16
print()
print("Deeper in the cave, you hear the sound of someone crying!")
sleep(delay)
print("As you investigate the noise, you discover that it is coming from a little girl in a pink dress.")
sleep(delay)
choice = input("She looks up at you tearfully, huddled against the wall. What do you do? [Pick her up/Interrogate her/Back away slowly]")
if choice =="Interrogate her":
print("Frankly you find this to be a bit suspect. What's a little kid doing in some kind of creepy magic cave?")
sleep(delay)
print("You point an accusatory finger at her and ask what her deal is")
print("she immediately stops crying and looks grumpy instead. She sticks her tongue out at you and turns into a bat, flying away")
print("Welp. guess you dodged that bullet.")
elif choice =="Back away slowly":
print("Ok you never signed up to be a childcare service. This is someone else's problem. You turn and leave")
sleep(delay)
print("The little girl looks at you incredulously but doesn't stop you")
elif choice =="Pick her up":
print("Despite your best efforts to calm her, the girl keeps crying. ...but after a moment, her cries begin to change.")
sleep(delay)
print("you realize she is laughing just as sharp fangs pierce your neck. You fall to the ground in surprise")
print("As you look up, you realize that her eyes have turned deep red! Vampire!")
dead = True
else:
print("Before you can decide what to do about the little kid, the ground collapses beneath you")
sleep(delay)
print("You find yourself in a totally different tunnel. A bit startled, but miraculously unhurt.")
if dead == True:
print("As your consiousness fades away, her giggles continue.")
print("This is what you get for trying to help kids lost in caves apparently")
print("Better luck next time! Try again by hitting the green play button.")
quit()
#########################################################################################################
# westth & whitakerj
# Refactored by Team 17
Move = input("You see a cell phone up ahead. Do you want to pick it up, leave it where it is, or try to watch youtube videos? Type pick up, leave it or youtube, please. ")
if Move == "pick up" or "Pick up":
#This will be good later on. To call for help.
print("Since you did not turn it on this could be helpful in the future.")
sleep(delay)
elif Move == "youtube" or "Youtube":
#Oh no... this isn't going to be good
print("Loud volume came out of the speakers, it was a bears mating call, the bear was NOT happy that you were not another bear.")
sleep(delay)
dead = True
else :
#Nothing happens, the volume doesn't turn on and you can't call for help later
print("You left the phone. Oh well.")
if dead == True:
print("Oh no, your dead by a mating bear.")
quit()
| 41.952242 | 224 | 0.621541 | 6,239 | 43,043 | 4.288027 | 0.202276 | 0.067656 | 0.051583 | 0.012559 | 0.202557 | 0.142451 | 0.113819 | 0.113819 | 0.104287 | 0.099353 | 0 | 0.004749 | 0.241758 | 43,043 | 1,025 | 225 | 41.993171 | 0.814965 | 0.069582 | 0 | 0.489796 | 0 | 0.063776 | 0.620349 | 0.004187 | 0 | 0 | 0 | 0.000976 | 0 | 1 | 0 | false | 0.002551 | 0.001276 | 0 | 0.001276 | 0.482143 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 2 |
6b8eb68d651fe2f3973d6258338aed3f82e05c3d | 90 | py | Python | tawsocks/constant.py | comeacrossyun/skyun | 96ef2e98da2826863850c8b917bf1cba8a8a796b | [
"MIT"
] | 1 | 2021-05-23T15:50:25.000Z | 2021-05-23T15:50:25.000Z | tawsocks/constant.py | comeacrossyun/skyun | 96ef2e98da2826863850c8b917bf1cba8a8a796b | [
"MIT"
] | null | null | null | tawsocks/constant.py | comeacrossyun/skyun | 96ef2e98da2826863850c8b917bf1cba8a8a796b | [
"MIT"
] | null | null | null | #!/usr/bin/env python
# @Time : 2019-06-03
# @Author : hongshu
BUFF_SIZE = 32 * 1024
| 15 | 23 | 0.611111 | 14 | 90 | 3.857143 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.2 | 0.222222 | 90 | 5 | 24 | 18 | 0.571429 | 0.677778 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
6ba0b0cb88433c042ca25747c1498b6fe7781f52 | 251 | py | Python | pages/blender-scripts/simple-blocks.py | makersall/learn-python-blender | 45f82f32a9b5d9fad6275d8912d5828a6d45b727 | [
"MIT"
] | null | null | null | pages/blender-scripts/simple-blocks.py | makersall/learn-python-blender | 45f82f32a9b5d9fad6275d8912d5828a6d45b727 | [
"MIT"
] | null | null | null | pages/blender-scripts/simple-blocks.py | makersall/learn-python-blender | 45f82f32a9b5d9fad6275d8912d5828a6d45b727 | [
"MIT"
] | null | null | null | import bpy
from mathutils import *
D = bpy.data
C = bpy.context
for i in range(0,3):
bpy.ops.mesh.primitive_cube_add(location=(1, 2, i))
# Now all I need to be able to do is add a mouseclick and a control z command in blender, and I'm good to go | 27.888889 | 108 | 0.713147 | 53 | 251 | 3.339623 | 0.754717 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.019901 | 0.199203 | 251 | 9 | 108 | 27.888889 | 0.860697 | 0.422311 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.333333 | 0 | 0.333333 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 2 |
6ba48e7128b7a057d5f72e9950790980dd0f6128 | 1,246 | py | Python | tests/molecular/reactions/reaction/fixtures/one_one_reaction.py | stevenbennett96/stk | 6e5af87625b83e0bfc7243bc42d8c7a860cbeb76 | [
"MIT"
] | null | null | null | tests/molecular/reactions/reaction/fixtures/one_one_reaction.py | stevenbennett96/stk | 6e5af87625b83e0bfc7243bc42d8c7a860cbeb76 | [
"MIT"
] | null | null | null | tests/molecular/reactions/reaction/fixtures/one_one_reaction.py | stevenbennett96/stk | 6e5af87625b83e0bfc7243bc42d8c7a860cbeb76 | [
"MIT"
] | null | null | null | import itertools as it
import pytest
import stk
from ..case_data import CaseData
@pytest.fixture
def one_one_reaction(
functional_group1,
functional_group1_2,
bond_order,
periodicity,
):
"""
A :class:`.CaseData` instance.
"""
return CaseData(
reaction=stk.OneOneReaction(
functional_group1=functional_group1,
functional_group2=functional_group1_2,
bond_order=bond_order,
periodicity=periodicity,
),
new_atoms=(),
new_bonds=(
get_bond(
functional_group1=functional_group1,
functional_group2=functional_group1_2,
bond_order=bond_order,
periodicity=periodicity,
),
),
deleted_atoms=tuple(it.chain(
functional_group1.get_deleters(),
functional_group1_2.get_deleters(),
)),
deleted_bonds=(),
)
def get_bond(
functional_group1,
functional_group2,
bond_order,
periodicity,
):
return stk.Bond(
atom1=next(functional_group1.get_bonders()),
atom2=next(functional_group2.get_bonders()),
order=bond_order,
periodicity=periodicity,
)
| 21.482759 | 54 | 0.605939 | 118 | 1,246 | 6.059322 | 0.322034 | 0.268531 | 0.218182 | 0.134266 | 0.436364 | 0.293706 | 0.293706 | 0.293706 | 0.293706 | 0.293706 | 0 | 0.025611 | 0.310594 | 1,246 | 57 | 55 | 21.859649 | 0.806752 | 0.024077 | 0 | 0.444444 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.044444 | false | 0 | 0.088889 | 0.022222 | 0.177778 | 0 | 0 | 0 | 0 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
6baddfd6c2bc7b76ee7cb32726d54db33f057904 | 583 | py | Python | 5/new code/OpenKE-OpenKE-PyTorch/openke/module/model/__init__.py | smurf-1119/knowledge-engeneering-experiment | 7fd3647bfc5b05e5fd6f93fea324e7ec0d55d4a1 | [
"MIT"
] | 10 | 2021-11-19T06:24:51.000Z | 2022-02-09T15:44:00.000Z | 5/new code/OpenKE-OpenKE-PyTorch/openke/module/model/__init__.py | smurf-1119/knowledge-engeneering-experiment | 7fd3647bfc5b05e5fd6f93fea324e7ec0d55d4a1 | [
"MIT"
] | 9 | 2021-10-01T11:06:27.000Z | 2021-12-23T02:10:52.000Z | 5/new code/OpenKE-OpenKE-PyTorch/openke/module/model/__init__.py | smurf-1119/knowledge-engeneering-experiment | 7fd3647bfc5b05e5fd6f93fea324e7ec0d55d4a1 | [
"MIT"
] | 2 | 2021-09-14T04:08:36.000Z | 2021-11-19T06:24:54.000Z | from __future__ import absolute_import
from __future__ import division
from __future__ import print_function
from .Model import Model
from .TransE import TransE
from .TransD import TransD
from .TransR import TransR
from .TransH import TransH
from .DistMult import DistMult
from .ComplEx import ComplEx
from .RESCAL import RESCAL
from .Analogy import Analogy
from .SimplE import SimplE
from .RotatE import RotatE
__all__ = [
'Model',
'TransE',
'TransD',
'TransR',
'TransH',
'DistMult',
'ComplEx',
'RESCAL',
'Analogy',
'SimplE',
'RotatE'
] | 20.103448 | 38 | 0.722127 | 70 | 583 | 5.757143 | 0.271429 | 0.074442 | 0.119107 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.198971 | 583 | 29 | 39 | 20.103448 | 0.862955 | 0 | 0 | 0 | 0 | 0 | 0.118151 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.518519 | 0 | 0.518519 | 0.037037 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
6bd8f9bf02a6766c4d6a7fccca5eeed4aef8e654 | 9,225 | py | Python | api/metadata_routes.py | ImagingDataCommons/ISB-CGC-API | d3207a6ada958ad5ac3cb8834b216ec1108dcf1c | [
"Apache-2.0"
] | null | null | null | api/metadata_routes.py | ImagingDataCommons/ISB-CGC-API | d3207a6ada958ad5ac3cb8834b216ec1108dcf1c | [
"Apache-2.0"
] | 5 | 2020-07-07T23:45:21.000Z | 2021-06-11T17:52:29.000Z | api/metadata_routes.py | ImagingDataCommons/ISB-CGC-API | d3207a6ada958ad5ac3cb8834b216ec1108dcf1c | [
"Apache-2.0"
] | 2 | 2019-10-15T01:17:35.000Z | 2021-04-05T19:54:12.000Z | #
# Copyright 2019, Institute for Systems Biology
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
#
import logging
from flask import jsonify
from python_settings import settings
from . metadata_views import get_versions, get_attributes, get_collections, get_analysis_results
from flask import Blueprint
metadata_bp = Blueprint('metadata_bp', __name__, url_prefix='/{}'.format(settings.API_VERSION))
logger = logging.getLogger(settings.LOGGER_NAME)
@metadata_bp.route('/versions/', methods=['GET'], strict_slashes=False)
def versions():
"""Retrieve a list of IDC versions"""
response = None
try:
results = get_versions()
if 'message' in results:
response = jsonify(results)
response.status_code = results['code']
else:
response = jsonify({
'code': 200,
**results
})
response.status_code = 200
except Exception as e:
logger.error("[ERROR] While retrieving IDC versions:")
logger.exception(e)
response = jsonify({
'code': 500,
'message': 'Encountered an error while retrieving the versions list.'
})
response.status_code = 500
return response
# @metadata_bp.route('/data_sources/', methods=['GET'], strict_slashes=False)
# def data_sources():
# """Retrieve a list of IDC versions"""
#
# response = None
#
# try:
# results = get_data_sources()
#
# if 'message' in results:
# response = jsonify(results)
# response.status_code = results['code']
# else:
# response = jsonify({
# 'code': 200,
# **results
# })
# response.status_code = 200
# except Exception as e:
# logger.error("[ERROR] While retrieving IDC versions:")
# logger.exception(e)
# response = jsonify({
# 'code': 500,
# 'message': 'Encountered an error while retrieving the program list.'
# })
# response.status_code = 500
#
# return response
@metadata_bp.route('/attributes', methods=['GET'], strict_slashes=False)
def attributes():
"""Retrieve a list of IDC versions"""
response = None
try:
results = get_attributes()
if 'message' in results:
response = jsonify(results)
response.status_code = results['code']
else:
response = jsonify({
'code': 200,
**results
})
response.status_code = 200
except Exception as e:
logger.error("[ERROR] While retrieving IDC versions:")
logger.exception(e)
response = jsonify({
'code': 500,
'message': 'Encountered an error while retrieving the attributes.'
})
response.status_code = 500
return response
# @metadata_bp.route('/programs/', methods=['GET'], strict_slashes=False)
# def programs():
# """Retrieve the list of programs and builds currently available for cohort creation."""
#
# response = None
#
# try:
# results = get_programs()
#
# if 'message' in results:
# response = jsonify(results)
# response.status_code = results['code']
# else:
# response = jsonify({
# 'code': 200,
# **results
# })
# response.status_code = 200
# except Exception as e:
# logger.error("[ERROR] While retrieving program information:")
# logger.exception(e)
# response = jsonify({
# 'code': 500,
# 'message': 'Encountered an error while retrieving the program list.'
# })
# response.status_code = 500
#
# return response
#
#
# @metadata_bp.route('/programs/<program_name>', methods=['GET'], strict_slashes=False)
# def program_collections(program_name):
# """Retrieve the list of collections and versions in program <program_name>."""
# response = None
#
# try:
#
# results = get_program_collections(program_name)
#
# if 'message' in results:
# response = jsonify(results)
# response.status_code = results['code']
# else:
# response = jsonify({
# 'code': 200,
# **results
# })
# response.status_code = 200
# except Exception as e:
# logger.error("[ERROR] While retrieving collection information:")
# logger.exception(e)
# response = jsonify({
# 'code': 500,
# 'message': 'Encountered an error while retrieving the collection list.'
# })
# response.status_code = 500
#
# return response
@metadata_bp.route('/collections/', methods=['GET'], strict_slashes=False)
def collections():
"""Retrieve the list of collections in some IDC versions """
response = None
try:
results = get_collections()
if 'message' in results:
response = jsonify(results)
response.status_code = results['code']
else:
response = jsonify({
'code': 200,
**results
})
response.status_code = 200
except Exception as e:
logger.error("[ERROR] While retrieving collection information:")
logger.exception(e)
response = jsonify({
'code': 500,
'message': 'Encountered an error while retrieving the collection list.'
})
response.status_code = 500
return response
@metadata_bp.route('/analysis_results/', methods=['GET'], strict_slashes=False)
def analysis_results():
"""Retrieve the list of analysis results in some IDC versions """
response = None
try:
results = get_analysis_results()
if 'message' in results:
response = jsonify(results)
response.status_code = results['code']
else:
response = jsonify({
'code': 200,
**results
})
response.status_code = 200
except Exception as e:
logger.error("[ERROR] While retrieving analysis results information:")
logger.exception(e)
response = jsonify({
'code': 500,
'message': 'Encountered an error while retrieving the analysis results list.'
})
response.status_code = 500
return response
@metadata_bp.route('/fields', methods=['GET'], strict_slashes=False)
def fields():
"""Retrieve a list of IDC versions"""
response = jsonify({
'code': 500,
'message': '/fields not yet supported.'
})
return response
response = None
try:
results = get_attributes()
if 'message' in results:
response = jsonify(results)
response.status_code = results['code']
else:
response = jsonify({
'code': 200,
**results
})
response.status_code = 200
except Exception as e:
logger.error("[ERROR] While retrieving IDC versions:")
logger.exception(e)
response = jsonify({
'code': 500,
'message': 'Encountered an error while retrieving the attributes.'
})
response.status_code = 500
return response
# @metadata_bp.route('/programs/<program_name>/<collection_name>/', methods=['GET'], strict_slashes=False)
# def collection(program_name, collection_name):
# """"Get a list of the available fields for a specific version of a collection."""
# response = None
#
# try:
# results = get_collection_info(program_name, collection_name)
# if results:
# if 'message' in results:
# response = jsonify(results)
# response.status_code = 500
#
# else:
# code = 200
# response = jsonify({
# 'code': code,
# **results
# })
# response.status_code = 200
# else:
# response = jsonify({
# 'code': 500,
# 'message': 'Encountered an error while retrieving the collection list.'
# })
# response.status_code = 500
# except Exception as e:
# logger.error("[ERROR] While retrieving collection information:")
# logger.exception(e)
# response = jsonify({
# 'code': 500,
# 'message': 'Encountered an error while retrieving the collection metadata.'
# })
# response.status_code = 500
#
# return response
| 29.854369 | 106 | 0.572358 | 925 | 9,225 | 5.610811 | 0.140541 | 0.083815 | 0.09711 | 0.086705 | 0.732755 | 0.698073 | 0.649518 | 0.63025 | 0.63025 | 0.614066 | 0 | 0.020389 | 0.319458 | 9,225 | 308 | 107 | 29.951299 | 0.806308 | 0.496369 | 0 | 0.795276 | 0 | 0 | 0.168376 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.03937 | false | 0 | 0.03937 | 0 | 0.125984 | 0.015748 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d41224f4ff45a38d4e8a034a7a6c35db41c23971 | 873 | py | Python | packages/api-server/api_server/routes/building_map.py | cnboonhan/rmf-web | 4389c53ef87e95c9a4bf1a6a72ed11f6f441a33f | [
"Apache-2.0"
] | null | null | null | packages/api-server/api_server/routes/building_map.py | cnboonhan/rmf-web | 4389c53ef87e95c9a4bf1a6a72ed11f6f441a33f | [
"Apache-2.0"
] | null | null | null | packages/api-server/api_server/routes/building_map.py | cnboonhan/rmf-web | 4389c53ef87e95c9a4bf1a6a72ed11f6f441a33f | [
"Apache-2.0"
] | null | null | null | from fastapi import Depends
from rx import operators as rxops
from api_server.base_app import BaseApp
from api_server.fast_io import FastIORouter, SubscriptionRequest
from api_server.models import BuildingMap
from api_server.repositories.rmf import RmfRepository
class BuildingMapRouter(FastIORouter):
def __init__(self, app: BaseApp):
super().__init__(tags=["Building"])
@self.get("", response_model=BuildingMap)
async def get_building_map(rmf_repo: RmfRepository = Depends(app.rmf_repo)):
"""
Available in socket.io
"""
return await rmf_repo.get_bulding_map()
@self.sub("", response_model=BuildingMap)
def sub_building_map(_req: SubscriptionRequest):
return app.rmf_events().building_map.pipe(
rxops.filter(lambda x: x is not None)
)
| 33.576923 | 84 | 0.68614 | 104 | 873 | 5.490385 | 0.5 | 0.049037 | 0.091068 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.230241 | 873 | 25 | 85 | 34.92 | 0.849702 | 0 | 0 | 0 | 0 | 0 | 0.009768 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.117647 | false | 0 | 0.352941 | 0.058824 | 0.647059 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
d41dcd0b703b0cef481717fe5ec5b997bf1f78dd | 19,894 | py | Python | tools/w3af/w3af/plugins/bruteforce/form_auth.py | sravani-m/Web-Application-Security-Framework | d9f71538f5cba6fe1d8eabcb26c557565472f6a6 | [
"MIT"
] | 3 | 2019-04-09T22:59:33.000Z | 2019-06-14T09:23:24.000Z | tools/w3af/w3af/plugins/bruteforce/form_auth.py | sravani-m/Web-Application-Security-Framework | d9f71538f5cba6fe1d8eabcb26c557565472f6a6 | [
"MIT"
] | null | null | null | tools/w3af/w3af/plugins/bruteforce/form_auth.py | sravani-m/Web-Application-Security-Framework | d9f71538f5cba6fe1d8eabcb26c557565472f6a6 | [
"MIT"
] | null | null | null | """
form_auth.py
Copyright 2006 Andres Riancho
This file is part of w3af, http://w3af.org/ .
w3af is free software; you can redistribute it and/or modify
it under the terms of the GNU General Public License as published by
the Free Software Foundation version 2 of the License.
w3af is distributed in the hope that it will be useful,
but WITHOUT ANY WARRANTY; without even the implied warranty of
MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
GNU General Public License for more details.
You should have received a copy of the GNU General Public License
along with w3af; if not, write to the Free Software
Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA
"""
from __future__ import with_statement
import time
from copy import deepcopy
from itertools import izip, repeat
import w3af.core.data.kb.knowledge_base as kb
import w3af.core.controllers.output_manager as om
import w3af.core.data.constants.severity as severity
from w3af.core.data.fuzzer.utils import rand_alnum
from w3af.core.data.fuzzer.mutants.querystring_mutant import QSMutant
from w3af.core.data.fuzzer.mutants.postdata_mutant import PostDataMutant
from w3af.core.data.dc.generic.form import Form
from w3af.core.data.kb.vuln import Vuln
from w3af.core.controllers.misc.diff import diff
from w3af.core.controllers.misc.epoch_to_string import epoch_to_string
from w3af.core.controllers.plugins.bruteforce_plugin import BruteforcePlugin
from w3af.core.controllers.misc.fuzzy_string_cmp import fuzzy_equal
from w3af.core.controllers.exceptions import BaseFrameworkException
class form_auth(BruteforcePlugin):
"""
Bruteforce HTML form authentication.
:author: Andres Riancho (andres.riancho@gmail.com)
"""
def __init__(self):
BruteforcePlugin.__init__(self)
self._found = set()
def audit(self, freq, debugging_id=None):
"""
Tries to bruteforce a form auth. This is slow!
:param freq: A FuzzableRequest
:param debugging_id: The ID to use in the logs to be able to track this
call to audit(). Plugins need to send this ID to
the ExtendedUrllib to get improved logging.
"""
if freq.get_url() in self._already_tested:
return
mutant = form_pointer_factory(freq)
if not self._is_login_form(mutant):
# Not a login form, login forms have these fields:
# * username/password
# * password
return
self._already_tested.append(mutant.get_url())
try:
session = self._create_new_session(mutant, debugging_id)
except BaseFrameworkException, bfe:
msg = 'Failed to create new session during form bruteforce setup: "%s"'
om.out.debug(msg % bfe)
return
try:
login_failed_bodies = self._id_failed_login_pages(mutant, session, debugging_id)
except BaseFrameworkException, bfe:
msg = 'Failed to ID failed login page during form bruteforce setup: "%s"'
om.out.debug(msg % bfe)
return
try:
self._signature_test(mutant, session, login_failed_bodies, debugging_id)
except BaseFrameworkException, bfe:
msg = 'Signature test failed during form bruteforce setup: "%s"'
om.out.debug(msg % bfe)
return
user_token, pass_token = mutant.get_dc().get_login_tokens()
# Let the user know what we are doing
msg = 'Found a user login form. The form action is: "%s"'
om.out.information(msg % mutant.get_url())
if user_token is not None:
msg = 'The username field to be used is: "%s"'
om.out.information(msg % user_token.get_name())
msg = 'The password field to be used is: "%s"'
om.out.information(msg % pass_token.get_name())
msg = 'Starting form authentication bruteforce on URL: "%s"'
om.out.information(msg % mutant.get_url())
start = time.time()
if user_token is not None:
generator = self._create_user_pass_generator(mutant.get_url())
else:
generator = self._create_pass_generator(mutant.get_url())
self._bruteforce_pool(mutant,
login_failed_bodies,
generator,
session,
debugging_id)
# Report that we've finished.
took_str = epoch_to_string(start)
msg = 'Finished bruteforcing "%s" (spent %s)'
args = (mutant.get_url(), took_str)
om.out.information(msg % args)
def _create_new_session(self, mutant, debugging_id):
"""
Creates a new session in the xurllib. This session will be used
to send HTTP requests and brute force the login.
:param mutant: The form mutant
:return: The session ID (a string)
"""
session = self._uri_opener.get_new_session()
# And initialize the session (send a request so that in the response
# we receive the cookie from the application and save it to the
# cookiejar)
self._uri_opener.send_mutant(mutant,
grep=False,
session=session,
debugging_id=debugging_id)
return session
def _bruteforce_pool(self, mutant, login_failed_res, generator, session, debugging_id):
args_iter = izip(repeat(mutant),
repeat(login_failed_res),
generator,
repeat(session),
repeat(debugging_id))
self.worker_pool.map_multi_args(self._brute_worker,
args_iter,
chunksize=100)
def _bruteforce_test(self, mutant, login_failed_res, generator, session, debugging_id):
for combination in generator:
self._brute_worker(mutant, login_failed_res, combination, session, debugging_id)
def _password_only_login(self, form):
user_token, pass_token = form.get_login_tokens()
if user_token is None:
return True
return False
def _fill_form(self, form, username, password):
"""
Set the username and password fields to the provided params. Handle
the case where the form only has a password field.
:param form: The Form instance to brute-force
:param username: Username value
:param password: Password value
:return: The form instance with the username (optional) and password
"""
user_token, pass_token = form.get_login_tokens()
# Setup the data_container, remember that we can have password
# only forms!
if user_token is not None:
form.set_login_username(username)
form.set_login_password(password)
return form
def _id_failed_login_pages(self, mutant, session, debugging_id):
"""
Generate different response bodies that are the result of failed
authentication.
Return a list with at least the following response bodies:
* Two response bodies for failed login using a randomly generated
username and leaving the password field empty. This is stored in
a FailedLoginPage instance.
* Two response bodies for failed login using a randomly generated
username and password. This is stored in a FailedLoginPage
instance.
"""
# The result is going to be stored here
login_failed_result_list = []
form = mutant.get_dc()
self._true_extra_fields(form)
#
# Create the FailedLoginPage instance for randomly generated username
# and password
#
random_user_pass = []
for _ in xrange(2):
user, password = rand_alnum(8), rand_alnum(8)
self._fill_form(form, user, password)
response = self._uri_opener.send_mutant(mutant,
grep=False,
session=session,
debugging_id=debugging_id)
body = self._clean_body(response, user, password)
random_user_pass.append(body)
failed_login_page = FailedLoginPage(random_user_pass[0],
random_user_pass[1])
login_failed_result_list.append(failed_login_page)
#
# Create the FailedLoginPage instance for randomly generated username
# and empty password
#
random_user_empty_pass = []
for _ in xrange(2):
user, password = rand_alnum(8), ''
self._fill_form(form, user, password)
response = self._uri_opener.send_mutant(mutant,
grep=False,
session=session,
debugging_id=debugging_id)
body = self._clean_body(response, user, password)
random_user_empty_pass.append(body)
failed_login_page = FailedLoginPage(random_user_empty_pass[0],
random_user_empty_pass[1])
login_failed_result_list.append(failed_login_page)
return login_failed_result_list
def _signature_test(self, mutant, session, login_failed_bodies, debugging_id):
"""
Perform a signature test before starting the brute-force process. This
test makes sure that the signatures captured in _id_failed_login_pages
are usable.
The basic idea is to send more failed login attempts and all should
be identified as failed logins.
:param mutant: The mutant that holds the login form
:param session: The HTTP session / cookies to use in the test
:param login_failed_bodies: The login failed bodies signatures
:return: True if success, raises exception on failure
"""
tests = [(rand_alnum(8), rand_alnum(8)),
(rand_alnum(8), '')]
form = mutant.get_dc()
for user, passwd in tests:
self._fill_form(form, user, passwd)
response = self._uri_opener.send_mutant(mutant,
grep=False,
session=session,
debugging_id=debugging_id)
body = self._clean_body(response, user, passwd)
if self._matches_any_failed_page(body, login_failed_bodies):
continue
msg = 'Failed to generate a response that matches the failed login page'
raise BaseFrameworkException(msg)
return True
def _matches_any_failed_page(self, resp_body, login_failed_result_list):
"""
:return: True if the resp_body matches the previously created
responses that are stored in login_failed_result_list.
"""
for failed_login_page in login_failed_result_list:
if failed_login_page.matches(resp_body):
return True
# I'm happy! The response_body *IS NOT* a failed login page.
return False
def _is_login_form(self, mutant):
"""
:return: True if this FuzzableRequest is a login form.
"""
form = mutant.get_dc()
if isinstance(form, Form):
return form.is_login_form()
return False
def _true_extra_fields(self, form):
"""
Some login forms have "extra" parameters. In some cases I've seen
login forms that have an "I agree with the terms and conditions"
checkbox. If w3af does not set that extra field to "true", even if
I have the correct username and password combination, it won't
perform a successful login.
:return: A data_container that has all fields (other than the username
and password) set to 1,
"""
user_token, pass_token = form.get_login_tokens()
pass_field = pass_token.get_name()
user_pass_fields = {pass_field}
if user_token is not None:
user_pass_fields.add(user_token.get_name())
for pname, value, path, value_setter in form.iter_setters():
if pname not in user_pass_fields:
if not value:
value_setter('1')
def _clean_body(self, http_response, username, password):
"""
Remove username and password from HTTP response, just in case the
application included them in the response.
:param http_response: An HTTP response instance
:param username: The username to replace
:param password: The password to replace
:return: A clean body (string)
"""
#
# At some point this method was implemented as follows:
#
# strings_to_replace_list = [username, password]
# return get_clean_body_impl(http_response, strings_to_replace_list)
#
# There is a complex interaction between cleaning the response body
# and the diff() in FailedLoginPage.matches(). The problem is that the
# bruteforce plugin will extract usernames and passwords from the HTML
# thus doing a _clean_body() with username and password will "break"
# one HTTP response in one way (clean with password A) and another HTTP
# response in another way (clean with password B) thus making diff()
# crazy
#
return http_response.body
def _brute_worker(self, mutant, login_failed_result_list, combination, session, debugging_id):
"""
:param mutant: A Mutant holding a QsMutant of PostDataMutant, created
using form_pointer_factory
:param combination: A tuple with (user, pass) or a pass if this is a
password only form.
"""
if mutant.get_url() in self._found and self._stop_on_first:
return
mutant = deepcopy(mutant)
form = mutant.get_dc()
if self._password_only_login(form):
user = 'password-only-form'
password = combination
else:
user, password = combination
self._true_extra_fields(form)
self._fill_form(form, user, password)
resp = self._uri_opener.send_mutant(mutant,
session=session,
grep=False,
debugging_id=debugging_id)
body = self._clean_body(resp, user, password)
if self._matches_any_failed_page(body, login_failed_result_list):
return
#
# SUCCESS (most likely)
#
# The application is most likely answering with one of these
# messages (first 3 are examples of errors, last is success):
#
# (f) "The username is valid but the password is invalid"
#
# (f) "Brute-force detected, user blocked"
#
# (f) "Brute-force detected, please complete this CAPTCHA form"
#
# (s) "Welcome Mr. Admin, how can I help?"
#
# Let's try to identify if we're in the (f) cases...
#
# This needs to be done in a different browser session, the old
# session is (potentially) already logged in, sending a new
# authentication request in that session will most likely
# succeed with a 302 redirect to the user's home page or similar
#
new_session = self._create_new_session(mutant, debugging_id)
password_1 = rand_alnum(8)
form.set_login_password(password_1)
verify_resp_1 = self._uri_opener.send_mutant(mutant,
session=new_session,
grep=False,
debugging_id=debugging_id)
password_2 = rand_alnum(8)
form.set_login_password(password_2)
verify_resp_2 = self._uri_opener.send_mutant(mutant,
session=new_session,
grep=False,
debugging_id=debugging_id)
body_1 = self._clean_body(verify_resp_1, user, password_1)
body_2 = self._clean_body(verify_resp_2, user, password_2)
potential_captcha_page = FailedLoginPage(body_1, body_2)
if self._matches_any_failed_page(body, [potential_captcha_page]):
om.out.debug('The form brute-force plugin detected a response'
' that might indicate that a user exists or CAPTCHA'
' protection is present. Please manually review HTTP'
' response with ID %s.' % verify_resp_2.id)
return
#
# Found a valid username and password!
#
freq_url = mutant.get_url()
self._found.add(freq_url)
user_token, pass_token = form.get_login_tokens()
if user_token is not None:
desc = ('Found authentication credentials to: "%s". A correct'
' user and password combination is: %s/%s')
desc %= (freq_url, user, password)
else:
# There is no user field!
desc = ('Found authentication credentials to: "%s". The correct'
' password is: "%s".')
desc %= (freq_url, password)
v = Vuln.from_mutant('Guessable credentials', desc, severity.HIGH,
resp.id, self.get_name(), mutant)
v['user'] = user
v['pass'] = password
v['response'] = resp
v['request'] = mutant.get_fuzzable_request()
kb.kb.append(self, 'auth', v)
om.out.vulnerability(desc, severity=severity.HIGH)
def end(self):
self._found = set()
self._already_tested = []
self._already_reported = []
def form_pointer_factory(freq):
if isinstance(freq.get_uri().querystring, Form):
return QSMutant(freq)
return PostDataMutant(freq)
class FailedLoginPage(object):
def __init__(self, body_a, body_b):
self.body_a = body_a
self.body_b = body_b
self.diff_a_b = None
def matches(self, query):
"""
This method is used to check if the `query` HTTP response body matches
the failed login page instance.
:param query: An HTTP response body
:return: True if the `query` response body is equal to the failed login
bodies which were received in __init__().
"""
if self.body_a == query:
return True
if self.body_b == query:
return True
if not fuzzy_equal(self.body_a, query, 0.60):
# They are really different, no need to calculate diff()
return False
if self.diff_a_b is None:
self.diff_a_b, _ = diff(self.body_a, self.body_b)
_, diff_query_a = diff(self.body_a, query)
# Had to add this in order to prevent issues with CSRF tokens, which
# might be part of the HTTP response body, are random (not removed by
# clean_body) and will "break" the diff
if len(diff_query_a) < 64:
return True
if fuzzy_equal(self.diff_a_b, diff_query_a, 0.9):
return True
return False
| 36.840741 | 98 | 0.59817 | 2,397 | 19,894 | 4.768043 | 0.183563 | 0.027911 | 0.017324 | 0.016537 | 0.296614 | 0.244378 | 0.20798 | 0.18838 | 0.148657 | 0.112083 | 0 | 0.006044 | 0.334624 | 19,894 | 539 | 99 | 36.909091 | 0.857369 | 0.10752 | 0 | 0.33463 | 0 | 0 | 0.065384 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0.198444 | 0.066148 | null | null | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
d41f2e6ad842c3dcc252d1a4c7fa71c7d5d7d944 | 948 | py | Python | fhir_kindling/util/resources.py | azmeuk/fhir-kindling | 4f73c384cb00abe978044785eea228756c1054af | [
"MIT"
] | 3 | 2021-12-19T03:17:54.000Z | 2022-02-24T10:29:25.000Z | fhir_kindling/util/resources.py | azmeuk/fhir-kindling | 4f73c384cb00abe978044785eea228756c1054af | [
"MIT"
] | 60 | 2021-10-30T12:12:39.000Z | 2022-03-28T07:24:38.000Z | fhir_kindling/util/resources.py | azmeuk/fhir-kindling | 4f73c384cb00abe978044785eea228756c1054af | [
"MIT"
] | 1 | 2022-02-24T11:06:48.000Z | 2022-02-24T11:06:48.000Z | from typing import Union, List
from pydantic.fields import ModelField
from fhir.resources.resource import Resource
from fhir.resources import get_fhir_model_class
from fhir.resources.fhirtypes import ResourceType
def get_resource_fields(resource: Union[Resource, ResourceType, str]) -> List[ModelField]:
"""
Get the fields of a resource.
Args:
resource:
Returns:
"""
# If the resource is a string, then we need to get the resource class
if isinstance(resource, str):
resource = get_fhir_model_class(resource)
# Get the resource model fields
fields = list(resource.__fields__.values())
return fields
def valid_resource_name(resource_name: str) -> str:
"""
Args:
resource_name:
Returns:
"""
try:
get_fhir_model_class(resource_name)
except KeyError:
raise ValueError(f"Invalid resource name: {resource_name}")
return resource_name
| 22.571429 | 90 | 0.700422 | 118 | 948 | 5.440678 | 0.355932 | 0.130841 | 0.079439 | 0.079439 | 0.077882 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.223629 | 948 | 41 | 91 | 23.121951 | 0.872283 | 0.203587 | 0 | 0 | 0 | 0 | 0.054286 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.125 | false | 0 | 0.3125 | 0 | 0.5625 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
d42330431628c02abbfae562dd0d55db21f4866f | 186 | py | Python | imd_weather/__init__.py | bhardwajRahul/imd_weather | cdb4cd171eb35d7557cfc52deee273b093f1ba28 | [
"MIT"
] | null | null | null | imd_weather/__init__.py | bhardwajRahul/imd_weather | cdb4cd171eb35d7557cfc52deee273b093f1ba28 | [
"MIT"
] | null | null | null | imd_weather/__init__.py | bhardwajRahul/imd_weather | cdb4cd171eb35d7557cfc52deee273b093f1ba28 | [
"MIT"
] | 1 | 2021-01-01T12:36:24.000Z | 2021-01-01T12:36:24.000Z | #!/usr/bin/python3
'''
Collects Weather Forecast by Indian Meterological Department, by parsing webpages :)
'''
__version__ = '0.2.0'
__author__ = 'Anjan Roy<anjanroy@yandex.com>'
| 20.666667 | 88 | 0.715054 | 23 | 186 | 5.434783 | 0.913043 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.025157 | 0.145161 | 186 | 8 | 89 | 23.25 | 0.761006 | 0.548387 | 0 | 0 | 0 | 0 | 0.486111 | 0.333333 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d42a8604bb2d70ad65e56defe7c0d2fcca097723 | 1,094 | py | Python | python/test/resource/test_dataset_mixed.py | Fosstack/vmaf | e13b6c383ec20dba0cbd64d3265cfe49677a6f18 | [
"BSD-2-Clause-Patent"
] | 2,874 | 2016-06-06T16:11:37.000Z | 2022-03-31T10:10:22.000Z | python/test/resource/test_dataset_mixed.py | Fosstack/vmaf | e13b6c383ec20dba0cbd64d3265cfe49677a6f18 | [
"BSD-2-Clause-Patent"
] | 619 | 2016-06-07T19:30:53.000Z | 2022-03-31T16:36:05.000Z | python/test/resource/test_dataset_mixed.py | Fosstack/vmaf | e13b6c383ec20dba0cbd64d3265cfe49677a6f18 | [
"BSD-2-Clause-Patent"
] | 723 | 2016-06-05T02:44:33.000Z | 2022-03-31T03:29:12.000Z | dataset_name = 'example'
quality_width = 1920
quality_height = 1080
from vmaf.config import VmafConfig
ref_videos = [
{'content_id': 0, 'path': VmafConfig.resource_path('yuv', 'checkerboard_1920_1080_10_3_0_0.yuv'), 'yuv_fmt': 'yuv420p', 'width': 1920, 'height': 1080},
{'content_id': 1, 'path': VmafConfig.resource_path('yuv', 'flat_1920_1080_0.yuv'), 'yuv_fmt': 'yuv420p', 'width': 720, 'height': 480},
]
dis_videos = [
{'content_id': 0, 'asset_id': 0, 'dmos': 100, 'path': VmafConfig.resource_path('yuv', 'checkerboard_1920_1080_10_3_0_0.yuv'), 'yuv_fmt': 'yuv420p', 'width': 1920, 'height': 1080}, # ref
{'content_id': 0, 'asset_id': 1, 'dmos': 50, 'path': VmafConfig.resource_path('yuv', 'checkerboard_1920_1080_10_3_1_0.264'), 'yuv_fmt': 'notyuv',},
{'content_id': 1, 'asset_id': 2, 'dmos': 100, 'path': VmafConfig.resource_path('yuv', 'flat_1920_1080_0.yuv'), 'yuv_fmt': 'yuv420p', 'width': 720, 'height': 480}, # ref
{'content_id': 1, 'asset_id': 3, 'dmos': 80, 'path': VmafConfig.resource_path('yuv', 'flat_1920_1080_10.264'), 'yuv_fmt': 'notyuv',},
]
| 52.095238 | 189 | 0.669104 | 161 | 1,094 | 4.21118 | 0.242236 | 0.079646 | 0.19469 | 0.230089 | 0.741888 | 0.641593 | 0.641593 | 0.620944 | 0.560472 | 0.560472 | 0 | 0.14657 | 0.120658 | 1,094 | 20 | 190 | 54.7 | 0.558212 | 0.006399 | 0 | 0 | 0 | 0 | 0.414207 | 0.116236 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.071429 | 0 | 0.071429 | 0 | 0 | 0 | 0 | null | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d4308ff2bb28a84034c881fb380435ac9669edd4 | 18,320 | py | Python | translate/problemdef_pb2.py | schultet/goa | b76af608109ff217a2b68ca4e66582850c0a47ea | [
"MIT"
] | 2 | 2019-05-13T11:59:18.000Z | 2019-05-13T12:37:51.000Z | translate/problemdef_pb2.py | schultet/goa | b76af608109ff217a2b68ca4e66582850c0a47ea | [
"MIT"
] | null | null | null | translate/problemdef_pb2.py | schultet/goa | b76af608109ff217a2b68ca4e66582850c0a47ea | [
"MIT"
] | null | null | null | # Generated by the protocol buffer compiler. DO NOT EDIT!
# source: problemdef.proto
import sys
_b=sys.version_info[0]<3 and (lambda x:x) or (lambda x:x.encode('latin1'))
from google.protobuf import descriptor as _descriptor
from google.protobuf import message as _message
from google.protobuf import reflection as _reflection
from google.protobuf import symbol_database as _symbol_database
from google.protobuf import descriptor_pb2
# @@protoc_insertion_point(imports)
_sym_db = _symbol_database.Default()
DESCRIPTOR = _descriptor.FileDescriptor(
name='problemdef.proto',
package='',
serialized_pb=_b('\n\x10problemdef.proto\"-\n\x11PlanProblemVarVal\x12\x0b\n\x03var\x18\x01 \x02(\x05\x12\x0b\n\x03val\x18\x02 \x02(\x05\"\x1f\n\x10PlanProblemState\x12\x0b\n\x03val\x18\x01 \x03(\x05\"7\n\x14PlanProblemPartState\x12\x1f\n\x03val\x18\x01 \x03(\x0b\x32\x12.PlanProblemVarVal\"T\n\x0ePlanProblemVar\x12\x0c\n\x04name\x18\x01 \x02(\t\x12\r\n\x05range\x18\x02 \x02(\x05\x12\x11\n\tfact_name\x18\x03 \x03(\t\x12\x12\n\nis_private\x18\x04 \x01(\x08\"4\n\x10PlanProblemMutex\x12 \n\x04\x66\x61\x63t\x18\x01 \x03(\x0b\x32\x12.PlanProblemVarVal\"\\\n\x12PlanProblemCondEff\x12\"\n\x03pre\x18\x01 \x02(\x0b\x32\x15.PlanProblemPartState\x12\"\n\x03\x65\x66\x66\x18\x02 \x02(\x0b\x32\x15.PlanProblemPartState\"\xd6\x01\n\x13PlanProblemOperator\x12\x0c\n\x04name\x18\x01 \x02(\t\x12\x0c\n\x04\x63ost\x18\x02 \x02(\x05\x12\"\n\x03pre\x18\x03 \x02(\x0b\x32\x15.PlanProblemPartState\x12\"\n\x03\x65\x66\x66\x18\x04 \x02(\x0b\x32\x15.PlanProblemPartState\x12%\n\x08\x63ond_eff\x18\x05 \x03(\x0b\x32\x13.PlanProblemCondEff\x12\r\n\x05owner\x18\x06 \x01(\x05\x12\x11\n\tglobal_id\x18\x07 \x01(\x05\x12\x12\n\nis_private\x18\x08 \x01(\x08\"\xaa\x02\n\x0bPlanProblem\x12\x0f\n\x07version\x18\x01 \x02(\x05\x12\x1c\n\x03var\x18\x02 \x03(\x0b\x32\x0f.PlanProblemVar\x12 \n\x05mutex\x18\x03 \x03(\x0b\x32\x11.PlanProblemMutex\x12%\n\ninit_state\x18\x04 \x02(\x0b\x32\x11.PlanProblemState\x12#\n\x04goal\x18\x05 \x02(\x0b\x32\x15.PlanProblemPartState\x12&\n\x08operator\x18\x06 \x03(\x0b\x32\x14.PlanProblemOperator\x12\x12\n\nagent_name\x18\x07 \x03(\t\x12\x30\n\x12projected_operator\x18\x08 \x03(\x0b\x32\x14.PlanProblemOperator\x12\x10\n\x08\x61gent_id\x18\t \x01(\x05')
)
_sym_db.RegisterFileDescriptor(DESCRIPTOR)
_PLANPROBLEMVARVAL = _descriptor.Descriptor(
name='PlanProblemVarVal',
full_name='PlanProblemVarVal',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='var', full_name='PlanProblemVarVal.var', index=0,
number=1, type=5, cpp_type=1, label=2,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='val', full_name='PlanProblemVarVal.val', index=1,
number=2, type=5, cpp_type=1, label=2,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=20,
serialized_end=65,
)
_PLANPROBLEMSTATE = _descriptor.Descriptor(
name='PlanProblemState',
full_name='PlanProblemState',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='val', full_name='PlanProblemState.val', index=0,
number=1, type=5, cpp_type=1, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=67,
serialized_end=98,
)
_PLANPROBLEMPARTSTATE = _descriptor.Descriptor(
name='PlanProblemPartState',
full_name='PlanProblemPartState',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='val', full_name='PlanProblemPartState.val', index=0,
number=1, type=11, cpp_type=10, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=100,
serialized_end=155,
)
_PLANPROBLEMVAR = _descriptor.Descriptor(
name='PlanProblemVar',
full_name='PlanProblemVar',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='name', full_name='PlanProblemVar.name', index=0,
number=1, type=9, cpp_type=9, label=2,
has_default_value=False, default_value=_b("").decode('utf-8'),
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='range', full_name='PlanProblemVar.range', index=1,
number=2, type=5, cpp_type=1, label=2,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='fact_name', full_name='PlanProblemVar.fact_name', index=2,
number=3, type=9, cpp_type=9, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='is_private', full_name='PlanProblemVar.is_private', index=3,
number=4, type=8, cpp_type=7, label=1,
has_default_value=False, default_value=False,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=157,
serialized_end=241,
)
_PLANPROBLEMMUTEX = _descriptor.Descriptor(
name='PlanProblemMutex',
full_name='PlanProblemMutex',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='fact', full_name='PlanProblemMutex.fact', index=0,
number=1, type=11, cpp_type=10, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=243,
serialized_end=295,
)
_PLANPROBLEMCONDEFF = _descriptor.Descriptor(
name='PlanProblemCondEff',
full_name='PlanProblemCondEff',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='pre', full_name='PlanProblemCondEff.pre', index=0,
number=1, type=11, cpp_type=10, label=2,
has_default_value=False, default_value=None,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='eff', full_name='PlanProblemCondEff.eff', index=1,
number=2, type=11, cpp_type=10, label=2,
has_default_value=False, default_value=None,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=297,
serialized_end=389,
)
_PLANPROBLEMOPERATOR = _descriptor.Descriptor(
name='PlanProblemOperator',
full_name='PlanProblemOperator',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='name', full_name='PlanProblemOperator.name', index=0,
number=1, type=9, cpp_type=9, label=2,
has_default_value=False, default_value=_b("").decode('utf-8'),
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='cost', full_name='PlanProblemOperator.cost', index=1,
number=2, type=5, cpp_type=1, label=2,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='pre', full_name='PlanProblemOperator.pre', index=2,
number=3, type=11, cpp_type=10, label=2,
has_default_value=False, default_value=None,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='eff', full_name='PlanProblemOperator.eff', index=3,
number=4, type=11, cpp_type=10, label=2,
has_default_value=False, default_value=None,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='cond_eff', full_name='PlanProblemOperator.cond_eff', index=4,
number=5, type=11, cpp_type=10, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='owner', full_name='PlanProblemOperator.owner', index=5,
number=6, type=5, cpp_type=1, label=1,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='global_id', full_name='PlanProblemOperator.global_id', index=6,
number=7, type=5, cpp_type=1, label=1,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='is_private', full_name='PlanProblemOperator.is_private', index=7,
number=8, type=8, cpp_type=7, label=1,
has_default_value=False, default_value=False,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=392,
serialized_end=606,
)
_PLANPROBLEM = _descriptor.Descriptor(
name='PlanProblem',
full_name='PlanProblem',
filename=None,
file=DESCRIPTOR,
containing_type=None,
fields=[
_descriptor.FieldDescriptor(
name='version', full_name='PlanProblem.version', index=0,
number=1, type=5, cpp_type=1, label=2,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='var', full_name='PlanProblem.var', index=1,
number=2, type=11, cpp_type=10, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='mutex', full_name='PlanProblem.mutex', index=2,
number=3, type=11, cpp_type=10, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='init_state', full_name='PlanProblem.init_state', index=3,
number=4, type=11, cpp_type=10, label=2,
has_default_value=False, default_value=None,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='goal', full_name='PlanProblem.goal', index=4,
number=5, type=11, cpp_type=10, label=2,
has_default_value=False, default_value=None,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='operator', full_name='PlanProblem.operator', index=5,
number=6, type=11, cpp_type=10, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='agent_name', full_name='PlanProblem.agent_name', index=6,
number=7, type=9, cpp_type=9, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='projected_operator', full_name='PlanProblem.projected_operator', index=7,
number=8, type=11, cpp_type=10, label=3,
has_default_value=False, default_value=[],
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
_descriptor.FieldDescriptor(
name='agent_id', full_name='PlanProblem.agent_id', index=8,
number=9, type=5, cpp_type=1, label=1,
has_default_value=False, default_value=0,
message_type=None, enum_type=None, containing_type=None,
is_extension=False, extension_scope=None,
options=None),
],
extensions=[
],
nested_types=[],
enum_types=[
],
options=None,
is_extendable=False,
extension_ranges=[],
oneofs=[
],
serialized_start=609,
serialized_end=907,
)
_PLANPROBLEMPARTSTATE.fields_by_name['val'].message_type = _PLANPROBLEMVARVAL
_PLANPROBLEMMUTEX.fields_by_name['fact'].message_type = _PLANPROBLEMVARVAL
_PLANPROBLEMCONDEFF.fields_by_name['pre'].message_type = _PLANPROBLEMPARTSTATE
_PLANPROBLEMCONDEFF.fields_by_name['eff'].message_type = _PLANPROBLEMPARTSTATE
_PLANPROBLEMOPERATOR.fields_by_name['pre'].message_type = _PLANPROBLEMPARTSTATE
_PLANPROBLEMOPERATOR.fields_by_name['eff'].message_type = _PLANPROBLEMPARTSTATE
_PLANPROBLEMOPERATOR.fields_by_name['cond_eff'].message_type = _PLANPROBLEMCONDEFF
_PLANPROBLEM.fields_by_name['var'].message_type = _PLANPROBLEMVAR
_PLANPROBLEM.fields_by_name['mutex'].message_type = _PLANPROBLEMMUTEX
_PLANPROBLEM.fields_by_name['init_state'].message_type = _PLANPROBLEMSTATE
_PLANPROBLEM.fields_by_name['goal'].message_type = _PLANPROBLEMPARTSTATE
_PLANPROBLEM.fields_by_name['operator'].message_type = _PLANPROBLEMOPERATOR
_PLANPROBLEM.fields_by_name['projected_operator'].message_type = _PLANPROBLEMOPERATOR
DESCRIPTOR.message_types_by_name['PlanProblemVarVal'] = _PLANPROBLEMVARVAL
DESCRIPTOR.message_types_by_name['PlanProblemState'] = _PLANPROBLEMSTATE
DESCRIPTOR.message_types_by_name['PlanProblemPartState'] = _PLANPROBLEMPARTSTATE
DESCRIPTOR.message_types_by_name['PlanProblemVar'] = _PLANPROBLEMVAR
DESCRIPTOR.message_types_by_name['PlanProblemMutex'] = _PLANPROBLEMMUTEX
DESCRIPTOR.message_types_by_name['PlanProblemCondEff'] = _PLANPROBLEMCONDEFF
DESCRIPTOR.message_types_by_name['PlanProblemOperator'] = _PLANPROBLEMOPERATOR
DESCRIPTOR.message_types_by_name['PlanProblem'] = _PLANPROBLEM
PlanProblemVarVal = _reflection.GeneratedProtocolMessageType('PlanProblemVarVal', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEMVARVAL,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblemVarVal)
))
_sym_db.RegisterMessage(PlanProblemVarVal)
PlanProblemState = _reflection.GeneratedProtocolMessageType('PlanProblemState', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEMSTATE,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblemState)
))
_sym_db.RegisterMessage(PlanProblemState)
PlanProblemPartState = _reflection.GeneratedProtocolMessageType('PlanProblemPartState', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEMPARTSTATE,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblemPartState)
))
_sym_db.RegisterMessage(PlanProblemPartState)
PlanProblemVar = _reflection.GeneratedProtocolMessageType('PlanProblemVar', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEMVAR,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblemVar)
))
_sym_db.RegisterMessage(PlanProblemVar)
PlanProblemMutex = _reflection.GeneratedProtocolMessageType('PlanProblemMutex', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEMMUTEX,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblemMutex)
))
_sym_db.RegisterMessage(PlanProblemMutex)
PlanProblemCondEff = _reflection.GeneratedProtocolMessageType('PlanProblemCondEff', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEMCONDEFF,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblemCondEff)
))
_sym_db.RegisterMessage(PlanProblemCondEff)
PlanProblemOperator = _reflection.GeneratedProtocolMessageType('PlanProblemOperator', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEMOPERATOR,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblemOperator)
))
_sym_db.RegisterMessage(PlanProblemOperator)
PlanProblem = _reflection.GeneratedProtocolMessageType('PlanProblem', (_message.Message,), dict(
DESCRIPTOR = _PLANPROBLEM,
__module__ = 'problemdef_pb2'
# @@protoc_insertion_point(class_scope:PlanProblem)
))
_sym_db.RegisterMessage(PlanProblem)
# @@protoc_insertion_point(module_scope)
| 37.61807 | 1,667 | 0.742522 | 2,232 | 18,320 | 5.806004 | 0.087366 | 0.056795 | 0.050004 | 0.043213 | 0.622502 | 0.584536 | 0.564241 | 0.545644 | 0.515395 | 0.511228 | 0 | 0.041247 | 0.133188 | 18,320 | 486 | 1,668 | 37.695473 | 0.774811 | 0.032587 | 0 | 0.653759 | 1 | 0.002278 | 0.179729 | 0.115584 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.013667 | 0 | 0.013667 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d445167c129f0fee7127509d25fc78e9fed6e319 | 100 | py | Python | micro-benchmark/snippets/external/cls_parent/main.py | WenJinfeng/PyCG | b45e8e04fe697d8301cf27222a8f37646d69f168 | [
"Apache-2.0"
] | 121 | 2020-12-16T20:31:37.000Z | 2022-03-21T20:32:43.000Z | micro-benchmark/snippets/external/cls_parent/main.py | WenJinfeng/PyCG | b45e8e04fe697d8301cf27222a8f37646d69f168 | [
"Apache-2.0"
] | 24 | 2021-03-13T00:04:00.000Z | 2022-03-21T17:28:11.000Z | micro-benchmark/snippets/external/cls_parent/main.py | WenJinfeng/PyCG | b45e8e04fe697d8301cf27222a8f37646d69f168 | [
"Apache-2.0"
] | 19 | 2021-03-23T10:58:47.000Z | 2022-03-24T19:46:50.000Z | from ext import parent
class A(parent):
def fn(self):
self.parent_fn()
a = A()
a.fn()
| 11.111111 | 24 | 0.58 | 17 | 100 | 3.352941 | 0.529412 | 0.070175 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.27 | 100 | 8 | 25 | 12.5 | 0.780822 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.166667 | false | 0 | 0.166667 | 0 | 0.5 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d45d36879d463d078c14e712d7f0575764948839 | 289 | py | Python | securityscrape/securityscrape/items.py | ArcIX/vsdscrapy | 998232f9f8b41ae83040a628ed599a51da378d18 | [
"MIT"
] | null | null | null | securityscrape/securityscrape/items.py | ArcIX/vsdscrapy | 998232f9f8b41ae83040a628ed599a51da378d18 | [
"MIT"
] | null | null | null | securityscrape/securityscrape/items.py | ArcIX/vsdscrapy | 998232f9f8b41ae83040a628ed599a51da378d18 | [
"MIT"
] | null | null | null | # Define here the models for your scraped items
#
# See documentation in:
# https://docs.scrapy.org/en/latest/topics/items.html
from scrapy import Item, Field
class SecurityItem(Item):
# define the fields for your item here like:
# name = scrapy.Field()
source_url = Field()
| 24.083333 | 53 | 0.716263 | 42 | 289 | 4.904762 | 0.714286 | 0.067961 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.183391 | 289 | 11 | 54 | 26.272727 | 0.872881 | 0.636678 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.333333 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
d45db6bf4b1f5eb843ac891cdb32a017e59d1ba3 | 638 | py | Python | apps/djnext/__init__.py | martync/zython | e008bbb33e212f0856e85b8594003402e0a635c0 | [
"Beerware"
] | null | null | null | apps/djnext/__init__.py | martync/zython | e008bbb33e212f0856e85b8594003402e0a635c0 | [
"Beerware"
] | null | null | null | apps/djnext/__init__.py | martync/zython | e008bbb33e212f0856e85b8594003402e0a635c0 | [
"Beerware"
] | null | null | null | from django.http import HttpResponseRedirect
# Ask GET then POST
def get_post(request, url, key="next"):
return request.GET.get(key, request.POST.get(key, url))
def get_post_response(*args, **kwargs):
return HttpResponseRedirect(get_post(*args, **kwargs))
# Ask POST then GET
def post_get(request, url, key="next"):
return request.POST.get(key, request.GET.get(key, url))
def post_get_response(*args, **kwargs):
return HttpResponseRedirect(post_get(*args, **kwargs))
# REFERRER ?
def ref_get_post(request, url, key="next"):
return request.META.get("HTTP_REFERER", request.GET.get(key, request.POST.get(key, url))) | 33.578947 | 93 | 0.727273 | 95 | 638 | 4.768421 | 0.231579 | 0.07947 | 0.086093 | 0.112583 | 0.567329 | 0.373068 | 0.306843 | 0.306843 | 0.15894 | 0 | 0 | 0 | 0.122257 | 638 | 19 | 93 | 33.578947 | 0.808929 | 0.0721 | 0 | 0 | 0 | 0 | 0.040747 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.454545 | false | 0 | 0.090909 | 0.454545 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 2 |
d46b8a28734476fc07b094bb7d6120cd6392d36d | 140 | py | Python | calorimeter/__init__.py | jevandezande/dsc | 482b32026bd769a0fe0b20750e051e356f1fcdac | [
"MIT"
] | null | null | null | calorimeter/__init__.py | jevandezande/dsc | 482b32026bd769a0fe0b20750e051e356f1fcdac | [
"MIT"
] | null | null | null | calorimeter/__init__.py | jevandezande/dsc | 482b32026bd769a0fe0b20750e051e356f1fcdac | [
"MIT"
] | null | null | null | """Top-level package for Calorimeter."""
__author__ = """Jonathon Vandezande"""
__email__ = 'jevandezande@gmail.com'
__version__ = '0.2.1'
| 23.333333 | 40 | 0.714286 | 16 | 140 | 5.5 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.024 | 0.107143 | 140 | 5 | 41 | 28 | 0.68 | 0.242857 | 0 | 0 | 0 | 0 | 0.46 | 0.22 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d47cde2d88200d0120c3cc99d44676263aaceb49 | 509 | py | Python | cyberpunk_theme/widget/checkbutton.py | pyrustic/tk-cyberpunk-theme | be0386abf293e2f3612b64fb31f7b2bf554acb8e | [
"MIT"
] | 5 | 2021-03-28T02:52:03.000Z | 2021-06-10T11:34:09.000Z | cyberpunk_theme/widget/checkbutton.py | pyrustic/tk-cyberpunk-theme | be0386abf293e2f3612b64fb31f7b2bf554acb8e | [
"MIT"
] | null | null | null | cyberpunk_theme/widget/checkbutton.py | pyrustic/tk-cyberpunk-theme | be0386abf293e2f3612b64fb31f7b2bf554acb8e | [
"MIT"
] | null | null | null | import tkstyle
from cyberpunk_theme import constant
def get_style(font_family=constant.FONT_FAMILY,
font_size=constant.FONT_SIZE):
style = tkstyle.Checkbutton()
style.background = constant.BACKGROUND_COLOR
style.foreground = "#9B9B9B"
style.font = (font_family, font_size, "normal")
style.highlightThickness = 0
style.selectColor = constant.BACKGROUND_COLOR
style.activeBackground = constant.BACKGROUND_COLOR
style.activeForeground = "#B9B9B9"
return style
| 31.8125 | 54 | 0.744597 | 56 | 509 | 6.571429 | 0.446429 | 0.081522 | 0.1875 | 0.228261 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.016667 | 0.174853 | 509 | 15 | 55 | 33.933333 | 0.859524 | 0 | 0 | 0 | 0 | 0 | 0.039293 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.076923 | false | 0 | 0.153846 | 0 | 0.307692 | 0 | 0 | 0 | 0 | null | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d47e9a34c853b5dc3fca8b991390e543326fef11 | 5,192 | py | Python | esphome/components/tcs34725/sensor.py | OttoWinter/esphomeyaml | 6a85259e4d6d1b0a0f819688b8e555efcb99ecb0 | [
"MIT"
] | 249 | 2018-04-07T12:04:11.000Z | 2019-01-25T01:11:34.000Z | esphome/components/tcs34725/sensor.py | OttoWinter/esphomeyaml | 6a85259e4d6d1b0a0f819688b8e555efcb99ecb0 | [
"MIT"
] | 243 | 2018-04-11T16:37:11.000Z | 2019-01-25T16:50:37.000Z | esphome/components/tcs34725/sensor.py | OttoWinter/esphomeyaml | 6a85259e4d6d1b0a0f819688b8e555efcb99ecb0 | [
"MIT"
] | 40 | 2018-04-10T05:50:14.000Z | 2019-01-25T15:20:36.000Z | import esphome.codegen as cg
import esphome.config_validation as cv
from esphome.components import i2c, sensor
from esphome.const import (
CONF_COLOR_TEMPERATURE,
CONF_GAIN,
CONF_ID,
CONF_ILLUMINANCE,
CONF_GLASS_ATTENUATION_FACTOR,
CONF_INTEGRATION_TIME,
DEVICE_CLASS_ILLUMINANCE,
ICON_LIGHTBULB,
STATE_CLASS_MEASUREMENT,
UNIT_PERCENT,
ICON_THERMOMETER,
UNIT_KELVIN,
UNIT_LUX,
)
DEPENDENCIES = ["i2c"]
CONF_RED_CHANNEL = "red_channel"
CONF_GREEN_CHANNEL = "green_channel"
CONF_BLUE_CHANNEL = "blue_channel"
CONF_CLEAR_CHANNEL = "clear_channel"
tcs34725_ns = cg.esphome_ns.namespace("tcs34725")
TCS34725Component = tcs34725_ns.class_(
"TCS34725Component", cg.PollingComponent, i2c.I2CDevice
)
TCS34725IntegrationTime = tcs34725_ns.enum("TCS34725IntegrationTime")
TCS34725_INTEGRATION_TIMES = {
"auto": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_AUTO,
"2.4ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_2_4MS,
"24ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_24MS,
"50ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_50MS,
"101ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_101MS,
"120ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_120MS,
"154ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_154MS,
"180ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_180MS,
"199ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_199MS,
"240ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_240MS,
"300ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_300MS,
"360ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_360MS,
"401ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_401MS,
"420ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_420MS,
"480ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_480MS,
"499ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_499MS,
"540ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_540MS,
"600ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_600MS,
"614ms": TCS34725IntegrationTime.TCS34725_INTEGRATION_TIME_614MS,
}
TCS34725Gain = tcs34725_ns.enum("TCS34725Gain")
TCS34725_GAINS = {
"1X": TCS34725Gain.TCS34725_GAIN_1X,
"4X": TCS34725Gain.TCS34725_GAIN_4X,
"16X": TCS34725Gain.TCS34725_GAIN_16X,
"60X": TCS34725Gain.TCS34725_GAIN_60X,
}
color_channel_schema = sensor.sensor_schema(
unit_of_measurement=UNIT_PERCENT,
icon=ICON_LIGHTBULB,
accuracy_decimals=1,
state_class=STATE_CLASS_MEASUREMENT,
)
color_temperature_schema = sensor.sensor_schema(
unit_of_measurement=UNIT_KELVIN,
icon=ICON_THERMOMETER,
accuracy_decimals=1,
state_class=STATE_CLASS_MEASUREMENT,
)
illuminance_schema = sensor.sensor_schema(
unit_of_measurement=UNIT_LUX,
accuracy_decimals=1,
device_class=DEVICE_CLASS_ILLUMINANCE,
state_class=STATE_CLASS_MEASUREMENT,
)
CONFIG_SCHEMA = (
cv.Schema(
{
cv.GenerateID(): cv.declare_id(TCS34725Component),
cv.Optional(CONF_RED_CHANNEL): color_channel_schema,
cv.Optional(CONF_GREEN_CHANNEL): color_channel_schema,
cv.Optional(CONF_BLUE_CHANNEL): color_channel_schema,
cv.Optional(CONF_CLEAR_CHANNEL): color_channel_schema,
cv.Optional(CONF_ILLUMINANCE): illuminance_schema,
cv.Optional(CONF_COLOR_TEMPERATURE): color_temperature_schema,
cv.Optional(CONF_INTEGRATION_TIME, default="auto"): cv.enum(
TCS34725_INTEGRATION_TIMES, lower=True
),
cv.Optional(CONF_GAIN, default="1X"): cv.enum(TCS34725_GAINS, upper=True),
cv.Optional(CONF_GLASS_ATTENUATION_FACTOR, default=1.0): cv.float_range(
min=1.0
),
}
)
.extend(cv.polling_component_schema("60s"))
.extend(i2c.i2c_device_schema(0x29))
)
async def to_code(config):
var = cg.new_Pvariable(config[CONF_ID])
await cg.register_component(var, config)
await i2c.register_i2c_device(var, config)
cg.add(var.set_integration_time(config[CONF_INTEGRATION_TIME]))
cg.add(var.set_gain(config[CONF_GAIN]))
cg.add(var.set_glass_attenuation_factor(config[CONF_GLASS_ATTENUATION_FACTOR]))
if CONF_RED_CHANNEL in config:
sens = await sensor.new_sensor(config[CONF_RED_CHANNEL])
cg.add(var.set_red_sensor(sens))
if CONF_GREEN_CHANNEL in config:
sens = await sensor.new_sensor(config[CONF_GREEN_CHANNEL])
cg.add(var.set_green_sensor(sens))
if CONF_BLUE_CHANNEL in config:
sens = await sensor.new_sensor(config[CONF_BLUE_CHANNEL])
cg.add(var.set_blue_sensor(sens))
if CONF_CLEAR_CHANNEL in config:
sens = await sensor.new_sensor(config[CONF_CLEAR_CHANNEL])
cg.add(var.set_clear_sensor(sens))
if CONF_ILLUMINANCE in config:
sens = await sensor.new_sensor(config[CONF_ILLUMINANCE])
cg.add(var.set_illuminance_sensor(sens))
if CONF_COLOR_TEMPERATURE in config:
sens = await sensor.new_sensor(config[CONF_COLOR_TEMPERATURE])
cg.add(var.set_color_temperature_sensor(sens))
| 39.037594 | 86 | 0.759052 | 604 | 5,192 | 6.130795 | 0.183775 | 0.093168 | 0.226843 | 0.236025 | 0.20794 | 0.180124 | 0.180124 | 0.137996 | 0.075614 | 0.05293 | 0 | 0.101482 | 0.155431 | 5,192 | 132 | 87 | 39.333333 | 0.742987 | 0 | 0 | 0.066116 | 0 | 0 | 0.042951 | 0.00443 | 0 | 0 | 0.00077 | 0 | 0 | 1 | 0 | false | 0 | 0.033058 | 0 | 0.033058 | 0 | 0 | 0 | 0 | null | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2e07b20c9adc514cedce0a1835709bcabae73d57 | 733 | py | Python | src/admissionreviewrequest/apiversion.py | nokia/conftest-runner | a809f642407663ae0bff39554fdc3c2cb5e430ce | [
"BSD-3-Clause"
] | 2 | 2022-03-03T23:37:06.000Z | 2022-03-11T21:36:06.000Z | src/admissionreviewrequest/apiversion.py | nokia/conftest-runner | a809f642407663ae0bff39554fdc3c2cb5e430ce | [
"BSD-3-Clause"
] | null | null | null | src/admissionreviewrequest/apiversion.py | nokia/conftest-runner | a809f642407663ae0bff39554fdc3c2cb5e430ce | [
"BSD-3-Clause"
] | null | null | null | # Copyright 2021 Nokia
# Licensed under the BSD 3-Clause License.
# SPDX-License-Identifier: BSD-3-Clause
class ApiVersion(object):
def __init__(self, group: str, version: str):
self.group = group
self.version = version
class Kind(ApiVersion):
def __init__(self, group: str, version: str, kind: str):
super().__init__(group, version)
self.kind = kind
class Resource(ApiVersion):
def __init__(self, group: str, version: str, kind: str):
super().__init__(group, version)
self.resource = kind
def parse_api_version(api_version: str) -> ApiVersion:
if '/' in api_version:
return ApiVersion(*api_version.split('/', 1))
return ApiVersion('', api_version)
| 26.178571 | 60 | 0.664393 | 92 | 733 | 5.01087 | 0.336957 | 0.10846 | 0.071584 | 0.104121 | 0.370933 | 0.370933 | 0.370933 | 0.308026 | 0.308026 | 0.308026 | 0 | 0.012153 | 0.214188 | 733 | 27 | 61 | 27.148148 | 0.788194 | 0.135061 | 0 | 0.25 | 0 | 0 | 0.003175 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | false | 0 | 0 | 0 | 0.5625 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
2e0d1e3a83b4f30f17bb556a1b901364ab2cb0e2 | 1,682 | py | Python | tests/unit/test_cards.py | ChristChurchMayfair/ccm-assistant | 3d9a922642f0275882c6829e54a6fbc940067f26 | [
"MIT"
] | null | null | null | tests/unit/test_cards.py | ChristChurchMayfair/ccm-assistant | 3d9a922642f0275882c6829e54a6fbc940067f26 | [
"MIT"
] | null | null | null | tests/unit/test_cards.py | ChristChurchMayfair/ccm-assistant | 3d9a922642f0275882c6829e54a6fbc940067f26 | [
"MIT"
] | null | null | null | import unittest
from datetime import date, datetime
import cards
class TestCards(unittest.TestCase):
def test_get_passage_title(self):
morning = "morning"
evening = "evening"
self.assertEqual(cards.get_passage_title(date(2012, 4, 21), morning),
"Bible reading for 21st April 2012 AM service")
self.assertEqual(cards.get_passage_title(date(1997, 6, 2), evening),
"Bible reading for 2nd June 1997 PM service")
self.assertEqual(cards.get_passage_title(date(2018, 6, 3), evening),
"Bible reading for 3rd June 2018 PM service")
self.assertEqual(cards.get_passage_title(date(2018, 7, 4), evening),
"Bible reading for 4th July 2018 PM service")
self.assertEqual(cards.get_passage_title(date(2018, 11, 13), morning),
"Bible reading for 13th November 2018 AM service")
self.assertEqual(cards.get_passage_title(date(2018, 12, 11), morning),
"Bible reading for 11th December 2018 AM service")
def test_get_next_event_title(self):
test_event_datetime = datetime(2000, 1, 1, 4, 20, 33)
self.assertEqual(cards.get_next_event_title("Mission Breakfast", test_event_datetime),
"Mission Breakfast - 04:20, Saturday 01 January")
def test_get_next_event_content(self):
self.assertEqual(cards.get_next_event_content("", "The Moon"), "The Moon")
self.assertEqual(cards.get_next_event_content("Brunch for Women", "Christ Church Mayfair"),
"Brunch for Women\nLocation: Christ Church Mayfair")
| 50.969697 | 99 | 0.643282 | 211 | 1,682 | 4.957346 | 0.322275 | 0.129063 | 0.172084 | 0.197897 | 0.431166 | 0.394837 | 0.364245 | 0.25239 | 0.25239 | 0.156788 | 0 | 0.073446 | 0.263377 | 1,682 | 32 | 100 | 52.5625 | 0.770783 | 0 | 0 | 0 | 0 | 0 | 0.263377 | 0 | 0 | 0 | 0 | 0 | 0.333333 | 1 | 0.111111 | false | 0.259259 | 0.111111 | 0 | 0.259259 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
2e1a3d1d3c216dd3ce3e8b734b07005db6b159c3 | 727 | py | Python | SIT312-Group1-Prototype-main/flaskwebsite/dashboardPackage/__init__.py | FrozenKnight101/SITSystem-Design101 | 0cf2b5f3b5fd54e881b70f9b515aa3828d136402 | [
"MIT"
] | null | null | null | SIT312-Group1-Prototype-main/flaskwebsite/dashboardPackage/__init__.py | FrozenKnight101/SITSystem-Design101 | 0cf2b5f3b5fd54e881b70f9b515aa3828d136402 | [
"MIT"
] | null | null | null | SIT312-Group1-Prototype-main/flaskwebsite/dashboardPackage/__init__.py | FrozenKnight101/SITSystem-Design101 | 0cf2b5f3b5fd54e881b70f9b515aa3828d136402 | [
"MIT"
] | null | null | null | from flask import Flask
from flask_sqlalchemy import SQLAlchemy
from flask_bcrypt import Bcrypt
from flask_login import LoginManager
from sqlalchemy import create_engine
import pymysql
pymysql.install_as_MySQLdb()
app = Flask(__name__)
app.config['SQLALCHEMY_DATABASE_URI'] = 'mysql://{user}:{password}@{server}/{database}'.format(user='admin', password='sit312Group!', server='rfidcheckin.cljhbnnuplh1.ap-southeast-2.rds.amazonaws.com', database='rfidDB')
app.config['SECRET_KEY'] = '2392510167989ae56f41070a'
db = SQLAlchemy(app)
bcrypt = Bcrypt(app)
login_manager = LoginManager(app)
login_manager.login_view = 'login_page'
login_manager.login_message_category = 'info'
from dashboardPackage import routes
| 40.388889 | 221 | 0.792297 | 90 | 727 | 6.177778 | 0.511111 | 0.064748 | 0.053957 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.038168 | 0.099037 | 727 | 17 | 222 | 42.764706 | 0.810687 | 0 | 0 | 0 | 0 | 0 | 0.276056 | 0.209859 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0.0625 | 0.4375 | 0 | 0.4375 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 2 |
2e3c8f4bd26227fdb2c328ea513c5297064cd78e | 139 | py | Python | music/__model/_number/temporal.py | jedhsu/music | dea68c4a82296cd4910e786f533b2cbf861377c3 | [
"MIT"
] | null | null | null | music/__model/_number/temporal.py | jedhsu/music | dea68c4a82296cd4910e786f533b2cbf861377c3 | [
"MIT"
] | null | null | null | music/__model/_number/temporal.py | jedhsu/music | dea68c4a82296cd4910e786f533b2cbf861377c3 | [
"MIT"
] | null | null | null | """
*Temporal Number*
"""
from abc import ABCMeta
__all__ = ["TemporalNumber"]
class TemporalNumber:
__metaclass__ = ABCMeta
| 9.928571 | 28 | 0.676259 | 12 | 139 | 7.166667 | 0.833333 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.215827 | 139 | 13 | 29 | 10.692308 | 0.788991 | 0.122302 | 0 | 0 | 0 | 0 | 0.12963 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.25 | 0 | 0.75 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
2e42c6fa1451793870610d45a13885b8ba881cb1 | 2,439 | py | Python | plot/plot_curve.py | MasterLX/utils | 71445e174323641e31558cdab16f4d41e52c3881 | [
"MIT"
] | 1 | 2021-06-22T01:15:56.000Z | 2021-06-22T01:15:56.000Z | plot/plot_curve.py | MasterLX/utils | 71445e174323641e31558cdab16f4d41e52c3881 | [
"MIT"
] | null | null | null | plot/plot_curve.py | MasterLX/utils | 71445e174323641e31558cdab16f4d41e52c3881 | [
"MIT"
] | null | null | null | import matplotlib.pyplot as plt
from matplotlib import rc
rc('text', usetex=True)
fig = plt.figure(figsize=(6,3))
ax1 = fig.add_subplot(1,2,1)
x_ind = [2, 4, 6, 8, 10]
x_lab = [r'$\mathcal{T}_2$', r'$\mathcal{T}_4$', r'$\mathcal{T}_6$', r'$\mathcal{T}_8$', r'$\mathcal{T}_{{10}}$']
leg = [r'$\mathcal{T}_1$',r'$\mathcal{T}_2$',r'$\mathcal{T}_3$']
# fig, axs = plt.subplots(9,1)
# fig.subplots_adjust(hspace=0)
plt.xlabel('Task',fontsize=15)
plt.ylabel('Accuracy (\%)',fontsize=15)
plt.title('(a) 10-split CIFAR-100', y=-0.5, fontsize=15)
plt.ylim([50, 95])
ax1.plot([1,2,3,4,5,6,7,8,9,10], [87.4,83.7,85.0,82.8,85.5,84.6,83.6,84.7,83.5,83.7], label=leg[0], marker='*', markersize=5)#[89.1,82.0,84.6,83.6,85.1,84.1,82.7,82.2,82.4,84.2]
ax1.plot([2,3,4,5,6,7,8,9,10], [78.4,75.5,75.3,76.4,75.1,71.6,72.7,73.7,76.3], label=leg[1], marker='.', markersize=5)#[80.5,79.2,79.1,80.9,80.6,78.3,77.6,81,80.2]
ax1.plot([3,4,5,6,7,8,9,10], [79.9,73.2, 78.5,75.1,72.9,75.0,75.1,76.5], label=leg[2], marker='*', markersize=5)#[84.2,74.2,76.3,74.6,73.4,74.7,76.5,76.3]
plt.xticks(x_ind,x_lab,fontsize=12)
plt.yticks(size = 12)
# plt.legend(bbox_to_anchor=(1,0.48),fontsize=13)
ax2 = fig.add_subplot(1,2,2)
x_ind = [5, 10, 15, 20, 25]
x_lab = [r'$\mathcal{T}_5$', r'$\mathcal{T}_{{10}}$', r'$\mathcal{T}_{{15}}$', r'$\mathcal{T}_{{20}}$', r'$\mathcal{T}_{{25}}$']
# set_xlabel(r'$\mathcal{T}',fontsize=1)
# fig, axs = plt.subplots(9,1)
# fig.subplots_adjust(hspace=0)
plt.xlabel('Task',fontsize=15)
plt.ylabel('Accuracy (\%)',fontsize=15)
plt.title('(b) 25-split TinyImageNet', y=-0.5, fontsize=15)
plt.ylim([25, 75])
ax2.plot(list(range(1,26)), [68.25,65.75,65.75,60.25,64.75,63,59,60.25,53.75,57.25,54.5,57.5,52.75,56,57.25,56,55.25,57.5,54.75,56,54.75,56.75,59.5,54.25,58.5],marker='*', markersize=5)
ax2.plot(list(range(2,26)), [73,71.75,68.25,69.25,68.25,67,69,67.5,67.5,66.75,70.25,65.5,62.75,66,65.25,66.25,65.5,66,67.25,69.75,68.5,69.5,64.25,68.25],marker='.', markersize=5)
ax2.plot(list(range(3,26)), [72.0, 66.0, 65.0, 67.75, 68.5, 67.5,66.5,68.75, 69.0, 65.5,66.5,67.0,68.0,68.25,68.0,68.0,67.25,67.5, 66.5,68.0,62.75,59.75,71.0],marker='*', markersize=5)
plt.xticks(x_ind,x_lab,fontsize=12)
plt.yticks(size = 12)
# plt.legend(bbox_to_anchor=(1,0.48),fontsize=13)
plt.tight_layout()
plt.subplots_adjust(top=0.85, bottom=0.3)
fig.legend(bbox_to_anchor=(0.98,1),fontsize=12,ncol=3)
plt.savefig('acc.pdf') #,bbox_inches='tight'
plt.show()
| 49.77551 | 185 | 0.637966 | 580 | 2,439 | 2.622414 | 0.210345 | 0.073636 | 0.08284 | 0.00789 | 0.389218 | 0.347798 | 0.347798 | 0.253123 | 0.247206 | 0.234057 | 0 | 0.247602 | 0.059451 | 2,439 | 48 | 186 | 50.8125 | 0.415432 | 0.167282 | 0 | 0.235294 | 0 | 0 | 0.157504 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.058824 | 0 | 0.058824 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2e4967f94cf168917348f39b2ed3bfe7b78e54d2 | 620 | py | Python | judge/templatetags/markdown_tags.py | TheAvidDev/pnoj-site | 63299e873b1fb654667545222ce2b3157e78acd9 | [
"MIT"
] | null | null | null | judge/templatetags/markdown_tags.py | TheAvidDev/pnoj-site | 63299e873b1fb654667545222ce2b3157e78acd9 | [
"MIT"
] | null | null | null | judge/templatetags/markdown_tags.py | TheAvidDev/pnoj-site | 63299e873b1fb654667545222ce2b3157e78acd9 | [
"MIT"
] | null | null | null | import requests
import markdown as markdown_pkg
from django import template
from django.utils.safestring import mark_safe
register = template.Library()
# @register.filter
# def markdown(markdown_content, mode="gfm"):
# post_content = {'text': markdown_content, 'mode': mode, 'context': 'pnoj/site'}
# rendered_markdown = requests.post("https://api.github.com/markdown", json=post_content)
# rendered_markdown.raise_for_status()
# return mark_safe(rendered_markdown.text)
@register.filter
def markdown(markdown_content):
html = markdown_pkg.markdown(markdown_content)
return mark_safe(html)
| 31 | 93 | 0.759677 | 78 | 620 | 5.833333 | 0.448718 | 0.131868 | 0.151648 | 0.10989 | 0.175824 | 0.175824 | 0 | 0 | 0 | 0 | 0 | 0 | 0.129032 | 620 | 19 | 94 | 32.631579 | 0.842593 | 0.519355 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.111111 | false | 0 | 0.444444 | 0 | 0.666667 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
2e5729c4ea10db3d5b4d1d20228ad56d25fb7cd3 | 147 | py | Python | CURSO UDEMY/TEORICAS/8.py | CamilliCerutti/Exercicios-de-Python-curso-em-video | 6571a5c5cb7b4398352a7778c55588c0c16f13c2 | [
"MIT"
] | null | null | null | CURSO UDEMY/TEORICAS/8.py | CamilliCerutti/Exercicios-de-Python-curso-em-video | 6571a5c5cb7b4398352a7778c55588c0c16f13c2 | [
"MIT"
] | null | null | null | CURSO UDEMY/TEORICAS/8.py | CamilliCerutti/Exercicios-de-Python-curso-em-video | 6571a5c5cb7b4398352a7778c55588c0c16f13c2 | [
"MIT"
] | null | null | null | """
USO DO JOIN
"""
string = 'O brasil é penta.'
lista = string.split(' ')
strint_2 = ','.join(lista)
print(string)
print(lista)
print(strint_2) | 12.25 | 28 | 0.646259 | 22 | 147 | 4.227273 | 0.590909 | 0.150538 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.016129 | 0.156463 | 147 | 12 | 29 | 12.25 | 0.733871 | 0.07483 | 0 | 0 | 0 | 0 | 0.147287 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0.5 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 2 |
2e5c752c5c755fd94c0e7098d1bc261aa38549db | 344 | py | Python | 0x0A-python-inheritance/3-is_kind_of_class.py | Dev-Loup/holbertonschool-higher_level_programming | af6fe9a05c87dcdbb88270eec4c7ec81d6a70d9b | [
"FSFAP"
] | null | null | null | 0x0A-python-inheritance/3-is_kind_of_class.py | Dev-Loup/holbertonschool-higher_level_programming | af6fe9a05c87dcdbb88270eec4c7ec81d6a70d9b | [
"FSFAP"
] | null | null | null | 0x0A-python-inheritance/3-is_kind_of_class.py | Dev-Loup/holbertonschool-higher_level_programming | af6fe9a05c87dcdbb88270eec4c7ec81d6a70d9b | [
"FSFAP"
] | null | null | null | #!/usr/bin/python3
""" Class check module
Functions:
is_kind_of_class: checks if obj is inherit
from determined class
"""
def is_kind_of_class(obj, a_class):
""" checks class inheritance
Args:
obj: object to evaluate
a_class: suspect father
"""
return isinstance(obj, a_class)
| 20.235294 | 50 | 0.619186 | 44 | 344 | 4.636364 | 0.613636 | 0.088235 | 0.078431 | 0.127451 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.004132 | 0.296512 | 344 | 16 | 51 | 21.5 | 0.838843 | 0.601744 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.5 | false | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
2e6851db4eb6b0d98f1ae630e0bb8dd940964688 | 1,619 | py | Python | cinemanio/api/schema/properties.py | cinemanio/backend | c393dc8c2d59dc99aa2c3314d3372b6e2bf5497f | [
"MIT"
] | 4 | 2018-07-05T07:00:04.000Z | 2021-02-03T22:02:13.000Z | cinemanio/api/schema/properties.py | cinemanio/backend | c393dc8c2d59dc99aa2c3314d3372b6e2bf5497f | [
"MIT"
] | 19 | 2018-09-03T23:27:49.000Z | 2020-02-12T00:09:02.000Z | cinemanio/api/schema/properties.py | cinemanio/backend | c393dc8c2d59dc99aa2c3314d3372b6e2bf5497f | [
"MIT"
] | null | null | null | import graphene
from graphene_django import DjangoObjectType
from cinemanio.api.helpers import global_id
from cinemanio.api.utils import DjangoObjectTypeMixin
from cinemanio.core.models import Genre, Language, Country, Role
from cinemanio.core.utils.languages import translated_fields
PROPERTY_FIELDS = ('id',) + translated_fields('name')
class RoleNode(DjangoObjectTypeMixin, DjangoObjectType):
class Meta:
model = Role
only_fields = PROPERTY_FIELDS
def resolve_id(self, info):
return global_id(Role(id=self.pk))
class GenreNode(DjangoObjectType):
class Meta:
model = Genre
only_fields = PROPERTY_FIELDS
def resolve_id(self, info):
return global_id(Genre(id=self.pk))
class LanguageNode(DjangoObjectType):
class Meta:
model = Language
only_fields = PROPERTY_FIELDS
def resolve_id(self, info):
return global_id(Language(id=self.pk))
class CountryNode(DjangoObjectType):
class Meta:
model = Country
only_fields = PROPERTY_FIELDS + ('code',)
def resolve_id(self, info):
return global_id(Country(id=self.pk))
class PropertiesQuery:
roles = graphene.List(RoleNode)
genres = graphene.List(GenreNode)
languages = graphene.List(LanguageNode)
countries = graphene.List(CountryNode)
def resolve_roles(self, _):
return Role.objects.all()
def resolve_genres(self, _):
return Genre.objects.all()
def resolve_languages(self, _):
return Language.objects.all()
def resolve_countries(self, _):
return Country.objects.all()
| 24.907692 | 64 | 0.702285 | 187 | 1,619 | 5.925134 | 0.240642 | 0.072202 | 0.090253 | 0.108303 | 0.187726 | 0.187726 | 0.187726 | 0.187726 | 0.15704 | 0.15704 | 0 | 0 | 0.209389 | 1,619 | 64 | 65 | 25.296875 | 0.865625 | 0 | 0 | 0.25 | 0 | 0 | 0.006177 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.181818 | false | 0 | 0.136364 | 0.181818 | 0.795455 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 2 |
2e6fb3af88737869eb321c1147f1789b5d1ec474 | 5,827 | py | Python | dsb.py | edbezci/mapOverlayHumanoid | 95d5e16fb983a7384abea6f51599483274ff0f62 | [
"MIT"
] | null | null | null | dsb.py | edbezci/mapOverlayHumanoid | 95d5e16fb983a7384abea6f51599483274ff0f62 | [
"MIT"
] | null | null | null | dsb.py | edbezci/mapOverlayHumanoid | 95d5e16fb983a7384abea6f51599483274ff0f62 | [
"MIT"
] | null | null | null | '''
this is the file holding the description texts to be inserted
this file is imported to the src.py
'''
bf_desc = [
"Brute-Force Algorithm:",
" ",
"Summary:",
"The brute force algorithm is very aggressive.",
"It checks every single line segment against every other line segment for an intersection.",
"This is done through vector mathematics, direction vectors and scalars.",
" ",
"Order List:",
"This algorithm produces an ordered list of intersection points, in order of intersections from left to right.",
" ",
"Efficiency:",
"The efficiency of this algorithm is O(n*n). This is due to the fact that the presence of",
"intersections has to be checked between all line segments. This is computationally expensive.",
"There is no consideration of shortcuts, rather all possibilities are computed till it finds a solution."
]
bo_desc = [
"Bentley-Ottmann Algorithm:",
" ",
"Summary:",
"The Bentley-Ottmann algorithm incorporates the idea of an imaginary line.",
"This line will sweep from left-to-right over the line segments to compute",
"all the intersecting pairs of line segments. Once again, this is done through",
"vector mathematics, direction vectors and scalars.",
" ",
"Event Queue:",
"This algorithm keeps an event queue.",
"Adding a line-segment to the list when its leftmost endpoint is discovered during",
"the sweep and also deleting a line-segment from the list when its rightmost endpoint",
"is discovered during the sweep. This way, when the sweep reaches the end of the plane,",
"the event queue should be empty.",
" ",
"Order List:",
"This algorithm produces an ordered list of intersection points, in order of",
"when they are discovered by the sweep-line."
" "
"Efficiency:",
"The efficiency of this algorithm is O((n + k)logn). This algorithm is output-sensitive",
"as the running time is sensitive to the size of the output. This algorithm is also intersection-sensitive",
"as the number of intersections contributes to the size of the output generated."
]
sh_desc = [
"Shamos-Hoey Algorithm:",
" ",
"Summary:",
"The Shamos-Hoey algorithm also incorporates the idea of an imaginary line.",
"This line will sweep from left-to-right over the line segments. Once it discovers its first intersection,",
"the algorithm will stop. Once again, this is done through vector mathematics, direction vectors and scalars.",
" ",
"Event Queue:",
"This algorithm keeps an event queue. Adding a line-segment to the list when its leftmost endpoint is discovered",
"during the sweep and also deleting a line-segment from the list when its rightmost endpoint is discovered during the sweep.",
"As the algorithm stops at the first intersection that is discovered, the event queue will not be empty by the time the algorithm terminates.",
" ",
"Order List:",
"This algorithm produces an ordered list of intersection points, in order of when they are discovered by the sweep-line.",
" ",
"Efficiency:",
"The efficiency of this algorithm is O(nlogn) time to compute due to it terminating on the first intersection point that it discovers.",
"As the algorithm terminates at the first intersection point, its efficiency is not sensitive to the number of intersections that it discovers.",
]
effic_desc = [
"Efficiency:",
" ",
"Brute-Force Algorithm:",
"O(n*n) is very computationally expensive. Out of all the algorithms, where we see a high number of line segments,the brute-force algorithm",
"will always be the most inefficient.",
" ",
"Bentley-Ottmann Algorithm:",
"O((n + k)logn) is very efficient in terms of taking into consideration the number of intersections. Where we see a high number of line",
"segments but low number of intersections, the brute-force algorithm will play its part as an efficient algorithm.",
" ",
"Shamos-Hoey Algorithm:",
"O(nlogn) is also very efficient which is all due to how the algorithm terminates at the first intersection",
"point that it discovers. Because of this, the efficiency is not hindered by a large number of intersection points within the plane.",
" ",
"Summary:",
"If we look at the map-overlay problem, we wish to discover every intersection point that exists within the plane. The likeliness that when two thematic",
"map layers overlap, all of their line segments intersect is slim. Knowing this, the better suited algorithm would be the Bentley-Ottmann algorithm rather",
"than the Brute-Force algorithm. We have a plane with many line segments whereby, all intersections in existence need to be identified and we know that",
"not every pair of line segments intersect. Here, the Shamos-Hoey algorithm would not be suitable as we are interested in finding more than one intersection.",
"However, where we concern ourself with robotic movement, a given motion trajectory between two ligaments such as the humanoids arms, we only need to look at",
"whether this motion trajectory has any intersection. We are not interested in searching for every single intersection within the plane. For this, the Shamos-Hoey algorithm",
"would be better suited. Furthermore, the efficiency O(nlogn) of the Shamos-Hoey algorithm compared to O((n+k)logn) is also another key reason the Shamos-Hoey would be a better suit.",
"We would expect the movement of a humanoid to be flawless and not at any stage have to pause for a long-period of time to calculate its next movements. The Shamos-Hoey algorithm yielding",
"a higher efficiency would mean that intersections can be calculated faster, which will in turn, contribute towards the flawless movement of the humanoid robot."
]
| 61.336842 | 192 | 0.72902 | 862 | 5,827 | 4.935035 | 0.277262 | 0.030559 | 0.031265 | 0.025858 | 0.370945 | 0.341796 | 0.332393 | 0.319464 | 0.296427 | 0.269864 | 0 | 0 | 0.201819 | 5,827 | 94 | 193 | 61.989362 | 0.912492 | 0.016647 | 0 | 0.37931 | 0 | 0.252874 | 0.879413 | 0.003845 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2e718f603be7a18012f5634d1852d85958615512 | 111 | py | Python | ww1.py | blogs1801/test | 2a005cb9d9340419aa9e15c7e97dcfaec3763e54 | [
"Apache-2.0"
] | null | null | null | ww1.py | blogs1801/test | 2a005cb9d9340419aa9e15c7e97dcfaec3763e54 | [
"Apache-2.0"
] | null | null | null | ww1.py | blogs1801/test | 2a005cb9d9340419aa9e15c7e97dcfaec3763e54 | [
"Apache-2.0"
] | null | null | null | import uuid
pass
def func():
obj = uuid.uuid4()
return obj.hex
if __name__=='__main__':
func()
| 9.25 | 24 | 0.603604 | 15 | 111 | 3.933333 | 0.8 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.012195 | 0.261261 | 111 | 11 | 25 | 10.090909 | 0.707317 | 0 | 0 | 0 | 0 | 0 | 0.073395 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.142857 | false | 0.142857 | 0.142857 | 0 | 0.428571 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
2e732e50c64bd0890499ea5c064de7eca475d3e6 | 96 | py | Python | intform.py | chidanandpujar/Python_scripts | 0ee70e07ef4ab4d8c04955466ea9b305bdac0a53 | [
"Unlicense"
] | null | null | null | intform.py | chidanandpujar/Python_scripts | 0ee70e07ef4ab4d8c04955466ea9b305bdac0a53 | [
"Unlicense"
] | null | null | null | intform.py | chidanandpujar/Python_scripts | 0ee70e07ef4ab4d8c04955466ea9b305bdac0a53 | [
"Unlicense"
] | null | null | null | try:
n = int(input("Enter number"))
print(n*n)
except:
print("Non integer entered")
| 16 | 34 | 0.604167 | 14 | 96 | 4.142857 | 0.785714 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.229167 | 96 | 5 | 35 | 19.2 | 0.783784 | 0 | 0 | 0 | 0 | 0 | 0.322917 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0.4 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2e88c24aefa6a32a03f2918d4a607a6af1094875 | 938 | py | Python | services/scraper.py | AlperRehaYAZGAN/ytu-web-data-mining-termpaper | d86f6963f0dd2cb08af521ade5bbe568dac98ffc | [
"MIT"
] | null | null | null | services/scraper.py | AlperRehaYAZGAN/ytu-web-data-mining-termpaper | d86f6963f0dd2cb08af521ade5bbe568dac98ffc | [
"MIT"
] | null | null | null | services/scraper.py | AlperRehaYAZGAN/ytu-web-data-mining-termpaper | d86f6963f0dd2cb08af521ade5bbe568dac98ffc | [
"MIT"
] | null | null | null | from urllib.request import urlopen
from bs4 import BeautifulSoup
import re
class Scraper():
Newlines = re.compile(r'[\r\n]\s+')
def __init__(self):
pass
def scrape_url_text_content(self,url):
return self.__get_page_text_content(url)
def __get_page_text_content(self,url):
# given a url, get page content
data = urlopen(url).read()
# parse as html structured document
bs = BeautifulSoup(data,"html.parser")
# kill javascript content
for s in bs.findAll('script'):
s.replaceWith('')
# find body and extract text
txt = bs.find('body').getText('\n')
# remove multiple linebreaks and whitespace
return self.Newlines.sub('\n', txt)
#def __get_content_with_trafilatura(self,url):
# downloaded = trafilatura.fetch_url(url)
# return trafilatura.extract(downloaded)
pass
| 29.3125 | 52 | 0.6258 | 115 | 938 | 4.904348 | 0.513043 | 0.058511 | 0.053191 | 0.06383 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.001468 | 0.273987 | 938 | 31 | 53 | 30.258065 | 0.826725 | 0.304904 | 0 | 0.117647 | 0 | 0 | 0.052877 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.176471 | false | 0.117647 | 0.176471 | 0.058824 | 0.588235 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 2 |
2e89e09da8031427416db5dc051f730ed4de3c8a | 1,361 | py | Python | gcn/anal.py | s1998/gcn | 8b92342d4f4a8d037593732072ed89cfd8aa9be9 | [
"MIT"
] | null | null | null | gcn/anal.py | s1998/gcn | 8b92342d4f4a8d037593732072ed89cfd8aa9be9 | [
"MIT"
] | null | null | null | gcn/anal.py | s1998/gcn | 8b92342d4f4a8d037593732072ed89cfd8aa9be9 | [
"MIT"
] | 1 | 2019-11-26T14:59:20.000Z | 2019-11-26T14:59:20.000Z | import pickle
import operator
import numpy as np
import csv
import os.path
with open ('y_test', 'rb') as f:
y_test=pickle.load(f)
dicvocab={}
f=open("data/vocab.csv")
vocab=csv.reader(f)
for word in vocab:
if word[0]!='':
dicvocab[int(word[0])-1]=word[1]
f.close()
label_size=y_test.shape[1]
topics=["/Artificial_Intelligence/Machine_Learning/Case-Based/", "/Artificial_Intelligence/Machine_Learning/Genetic_Algorithms/", "/Artificial_Intelligence/Machine_Learning/Neural_Networks/", "/Artificial_Intelligence/Machine_Learning/Probabilistic_Methods/", "/Artificial_Intelligence/Machine_Learning/Reinforcement_Learning/", "/Artificial_Intelligence/Machine_Learning/Rule_Learning/", "/Artificial_Intelligence/Machine_Learning/Theory/"]
maxlabel=np.argmax(y_test, axis=1)
for ind in range(label_size+1):
st='dictionary' + str(ind)
if not os.path.isfile(st):
continue
if ind<label_size: print("Class ",ind, "enabled")
else: print("All Classes enabled")
with open(st, 'rb') as f:
dic= pickle.load(f)
for i in range(label_size):
dic2={}
print("Top 5 Highest Relevance Features for Class ", topics[i], "->", end='')
for x in dic[i]:
if x not in dic2: dic2[x]=0
dic2[x]+=1
k=sorted(dic2.items(), key=lambda kv: (kv[1], kv[0]), reverse=True)
for z in k[:15]:
print((dicvocab[z[0]],z[1]),end=',')
print()
print()
print() | 33.195122 | 441 | 0.71712 | 209 | 1,361 | 4.54067 | 0.401914 | 0.162276 | 0.213909 | 0.272919 | 0.094837 | 0 | 0 | 0 | 0 | 0 | 0 | 0.017456 | 0.116091 | 1,361 | 41 | 442 | 33.195122 | 0.771405 | 0 | 0 | 0.081081 | 0 | 0 | 0.380323 | 0.298091 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.135135 | 0 | 0.135135 | 0.189189 | 0 | 0 | 0 | null | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
5cf9a7c1bb1d09d465374c4ca2f91186c8631750 | 345 | py | Python | solvers/common/cell.py | andrinmeier/solvers | 01c5ba29d6c880a9c22cb897ad0e7e006ab1816b | [
"MIT"
] | null | null | null | solvers/common/cell.py | andrinmeier/solvers | 01c5ba29d6c880a9c22cb897ad0e7e006ab1816b | [
"MIT"
] | 1 | 2022-03-31T14:10:33.000Z | 2022-03-31T20:11:51.000Z | solvers/common/cell.py | andrinmeier/solvers | 01c5ba29d6c880a9c22cb897ad0e7e006ab1816b | [
"MIT"
] | null | null | null | from typing import Optional
class Cell:
def __init__(self, row: int, column: int, value: int = None) -> None:
self.row = row
self.column = column
self.value = value
def set_value(self, new_value: int) -> None:
self.value = new_value
def get_value(self) -> Optional[int]:
return self.value
| 23 | 73 | 0.611594 | 47 | 345 | 4.319149 | 0.382979 | 0.133005 | 0.118227 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.284058 | 345 | 14 | 74 | 24.642857 | 0.821862 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.3 | false | 0 | 0.1 | 0.1 | 0.6 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
cf0a981285b4ae44a0016c805a358ea2a5c148e3 | 324 | py | Python | geometric_algebra_attention/keras/Multivector2Vector.py | klarh/geometric_algebra_attention | 327f5d964b5bf72b6bf54b503c23ad8a0d7dc438 | [
"MIT"
] | 5 | 2021-10-14T22:24:00.000Z | 2022-03-24T20:11:59.000Z | geometric_algebra_attention/keras/Multivector2Vector.py | klarh/geometric_algebra_attention | 327f5d964b5bf72b6bf54b503c23ad8a0d7dc438 | [
"MIT"
] | 1 | 2021-12-03T18:51:19.000Z | 2021-12-03T18:51:19.000Z | geometric_algebra_attention/keras/Multivector2Vector.py | klarh/geometric_algebra_attention | 327f5d964b5bf72b6bf54b503c23ad8a0d7dc438 | [
"MIT"
] | 2 | 2021-10-14T22:26:07.000Z | 2022-03-24T20:23:05.000Z |
from tensorflow import keras
from .. import base
class Multivector2Vector(base.Multivector2Vector, keras.layers.Layer):
__doc__ = base.Multivector2Vector.__doc__
def call(self, inputs, mask=None):
return self._evaluate(inputs)
keras.utils.get_custom_objects()['Multivector2Vector'] = Multivector2Vector
| 24.923077 | 75 | 0.771605 | 35 | 324 | 6.828571 | 0.628571 | 0.1841 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.017857 | 0.135802 | 324 | 12 | 76 | 27 | 0.835714 | 0 | 0 | 0 | 0 | 0 | 0.055728 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.142857 | false | 0 | 0.285714 | 0.142857 | 0.857143 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 2 |
cf0cc6c5c4f6131b0f8dc9785310f78758084d2b | 603 | py | Python | accounts/admin.py | lakshaykhatter/djangox-project-attempt | 754d6ce58af06855125db3654e3a92b1c854883e | [
"MIT"
] | null | null | null | accounts/admin.py | lakshaykhatter/djangox-project-attempt | 754d6ce58af06855125db3654e3a92b1c854883e | [
"MIT"
] | null | null | null | accounts/admin.py | lakshaykhatter/djangox-project-attempt | 754d6ce58af06855125db3654e3a92b1c854883e | [
"MIT"
] | null | null | null | from django.contrib import admin
from django.contrib.auth import get_user_model
from django.contrib.auth.admin import UserAdmin
from .forms import CustomUserCreationForm, CustomUserChangeForm
from .models import CustomUser
class CustomUserAdmin(UserAdmin):
add_form = CustomUserCreationForm
form = CustomUserChangeForm
model = CustomUser
list_display = ['email', 'username']
fieldsets = UserAdmin.fieldsets + (
("Bio", {'fields': ('bio',)}), ("Social Media links", {'fields': ('instagram_url','tiktok_url','twitter_url','youtube_url',)}),
)
admin.site.register(CustomUser, CustomUserAdmin) | 31.736842 | 131 | 0.769486 | 66 | 603 | 6.909091 | 0.545455 | 0.065789 | 0.111842 | 0.092105 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.107794 | 603 | 19 | 132 | 31.736842 | 0.847584 | 0 | 0 | 0 | 0 | 0 | 0.155629 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.357143 | 0 | 0.785714 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
cf10c6d9fa3cd81af14cc3cf34915ce513e1c988 | 2,290 | py | Python | src/Service/Sandbox/runners/PythonRunner/test_frameworks/ck1_test/__init__.py | jakhax/code-runner-sandbox | 049bc2ae6c581decff06291140d72f223e997137 | [
"MIT"
] | null | null | null | src/Service/Sandbox/runners/PythonRunner/test_frameworks/ck1_test/__init__.py | jakhax/code-runner-sandbox | 049bc2ae6c581decff06291140d72f223e997137 | [
"MIT"
] | null | null | null | src/Service/Sandbox/runners/PythonRunner/test_frameworks/ck1_test/__init__.py | jakhax/code-runner-sandbox | 049bc2ae6c581decff06291140d72f223e997137 | [
"MIT"
] | null | null | null | import unittest
import traceback
from time import perf_counter
class CodeKombatTestRunner(object):
def __init__(self): pass
def run(self, test):
r = CodeKombatTestResult()
s = perf_counter()
print("\n<DESCRIBE::>Tests")
try:
test(r)
finally:
pass
print("\n<COMPLETEDIN::>{:.4f}".format(1000*(perf_counter() - s)))
return r
__unittest = True
class CodeKombatTestResult(unittest.TestResult):
def __init__(self):
super().__init__()
self.start = 0.0
def startTest(self, test):
print("\n<IT::>" + test._testMethodName)
super().startTest(test)
self.start = perf_counter()
def stopTest(self, test):
print("\n<COMPLETEDIN::>{:.4f}".format(1000*(perf_counter() - self.start)))
super().stopTest(test)
def addSuccess(self, test):
print("\n<PASSED::>Test Passed")
super().addSuccess(test)
def addError(self, test, err):
print("\n<ERROR::>Unhandled Exception")
print("\n<LOG:ESC:Error>" + esc(''.join(traceback.format_exception_only(err[0], err[1]))))
print("\n<LOG:ESC:Traceback>" + esc(self._exc_info_to_string(err, test)))
super().addError(test, err)
def addFailure(self, test, err):
print("\n<FAILED::>Test Failed")
print("\n<LOG:ESC:Failure>" + esc(''.join(traceback.format_exception_only(err[0], err[1]))))
super().addFailure(test, err)
# from unittest/result.py
def _exc_info_to_string(self, err, test):
exctype, value, tb = err
# Skip test runner traceback levels
while tb and self._is_relevant_tb_level(tb):
tb = tb.tb_next
if exctype is test.failureException:
length = self._count_relevant_tb_levels(tb) # Skip assert*() traceback levels
else:
length = None
return ''.join(traceback.format_tb(tb, limit=length))
def _is_relevant_tb_level(self, tb):
return '__unittest' in tb.tb_frame.f_globals
def _count_relevant_tb_levels(self, tb):
length = 0
while tb and not self._is_relevant_tb_level(tb):
length += 1
tb = tb.tb_next
return length
def esc(s):
return s.replace("\n", "<:LF:>")
| 31.805556 | 100 | 0.60524 | 287 | 2,290 | 4.623693 | 0.303136 | 0.045215 | 0.02939 | 0.03165 | 0.185381 | 0.159759 | 0.125094 | 0.125094 | 0.064808 | 0.064808 | 0 | 0.010526 | 0.253275 | 2,290 | 71 | 101 | 32.253521 | 0.765497 | 0.038865 | 0 | 0.034483 | 0 | 0 | 0.101957 | 0.030496 | 0 | 0 | 0 | 0 | 0 | 1 | 0.206897 | false | 0.051724 | 0.051724 | 0.034483 | 0.37931 | 0.172414 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
cf2215f3d2c850c77ba0ec41befba0d5ea8de6de | 1,013 | py | Python | sdk/ml/azure-ai-ml/tests/online_services/unittests/test_resource_requirements_settings.py | dubiety/azure-sdk-for-python | 62ffa839f5d753594cf0fe63668f454a9d87a346 | [
"MIT"
] | 1 | 2022-02-01T18:50:12.000Z | 2022-02-01T18:50:12.000Z | sdk/ml/azure-ai-ml/tests/online_services/unittests/test_resource_requirements_settings.py | ellhe-blaster/azure-sdk-for-python | 82193ba5e81cc5e5e5a5239bba58abe62e86f469 | [
"MIT"
] | null | null | null | sdk/ml/azure-ai-ml/tests/online_services/unittests/test_resource_requirements_settings.py | ellhe-blaster/azure-sdk-for-python | 82193ba5e81cc5e5e5a5239bba58abe62e86f469 | [
"MIT"
] | null | null | null | import pytest
from azure.ai.ml.entities import ResourceSettings
@pytest.mark.unittest
class TestResourceRequirementsSettings:
def test_resource_requirements_settings_from_object(self) -> None:
rest_resource_settings = ResourceSettings(cpu="1", memory="1.0Gi", gpu="1")
resource_settings = ResourceSettings._from_rest_object(settings=rest_resource_settings)
assert resource_settings.cpu == rest_resource_settings.cpu
assert resource_settings.memory == rest_resource_settings.memory
assert resource_settings.gpu == rest_resource_settings.gpu
def test_resource_requirements_settings_to_objects(self) -> None:
resource_settings = ResourceSettings(cpu="1", memory="1.0Gi", gpu="1")
rest_resource_settings = resource_settings._to_rest_object()
assert resource_settings.cpu == rest_resource_settings.cpu
assert resource_settings.memory == rest_resource_settings.memory
assert resource_settings.gpu == rest_resource_settings.gpu
| 48.238095 | 95 | 0.773939 | 119 | 1,013 | 6.226891 | 0.243697 | 0.388664 | 0.242915 | 0.072874 | 0.634278 | 0.539811 | 0.539811 | 0.539811 | 0.539811 | 0.539811 | 0 | 0.009259 | 0.147088 | 1,013 | 20 | 96 | 50.65 | 0.84838 | 0 | 0 | 0.375 | 0 | 0 | 0.01382 | 0 | 0 | 0 | 0 | 0 | 0.375 | 1 | 0.125 | false | 0 | 0.125 | 0 | 0.3125 | 0 | 0 | 0 | 0 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
cf22e5b27bb848a7487923ed2552186be004e856 | 1,230 | py | Python | soda/core/soda/telemetry/memory_span_exporter.py | duyet/soda-core | 92a52e0d7c1e88624d0637123cfcb2610af6d112 | [
"Apache-2.0"
] | 4 | 2022-03-23T02:43:42.000Z | 2022-03-31T15:20:54.000Z | soda/core/soda/telemetry/memory_span_exporter.py | duyet/soda-core | 92a52e0d7c1e88624d0637123cfcb2610af6d112 | [
"Apache-2.0"
] | 543 | 2022-03-22T09:02:17.000Z | 2022-03-31T16:29:41.000Z | soda/core/soda/telemetry/memory_span_exporter.py | duyet/soda-core | 92a52e0d7c1e88624d0637123cfcb2610af6d112 | [
"Apache-2.0"
] | 1 | 2022-03-27T03:37:55.000Z | 2022-03-27T03:37:55.000Z | import json
from typing import Dict, List, Sequence
from opentelemetry.sdk.trace import ReadableSpan
from opentelemetry.sdk.trace.export import SpanExporter, SpanExportResult
class MemorySpanExporter(SpanExporter):
"""Implementation of :class:`SpanExporter` that saves spans in memory.
This class can be used for diagnostic purposes, multi-threaded scenarios etc.
"""
__instance = None
__spans = []
@staticmethod
def get_instance():
if MemorySpanExporter.__instance is None:
MemorySpanExporter()
return MemorySpanExporter.__instance
def __init__(self):
if MemorySpanExporter.__instance is not None:
raise Exception("This class is a singleton!")
else:
MemorySpanExporter.__instance = self
def export(self, spans: Sequence[ReadableSpan]) -> SpanExportResult:
for span in spans:
self.__spans.append(span)
return SpanExportResult.SUCCESS
def reset(self):
self.__spans = []
@property
def spans(self) -> List[ReadableSpan]:
return self.__spans
@property
def span_dicts(self) -> List[Dict]:
return [json.loads(span.to_json()) for span in self.spans]
| 27.954545 | 81 | 0.679675 | 132 | 1,230 | 6.143939 | 0.439394 | 0.055487 | 0.049322 | 0.061652 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.239837 | 1,230 | 43 | 82 | 28.604651 | 0.86738 | 0.118699 | 0 | 0.068966 | 0 | 0 | 0.024322 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.206897 | false | 0 | 0.137931 | 0.068966 | 0.586207 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
cf3453b50dda53baa027b0bcfd23dbe385ff3da8 | 1,234 | py | Python | setup.py | Yasumoto/sapling | 73c51a2f93441ab9c03441b4864cf735e57c8e2a | [
"Apache-2.0"
] | 24 | 2015-02-10T18:44:17.000Z | 2021-04-02T13:29:54.000Z | setup.py | Yasumoto/sapling | 73c51a2f93441ab9c03441b4864cf735e57c8e2a | [
"Apache-2.0"
] | 2 | 2015-08-26T02:01:29.000Z | 2018-11-05T19:02:34.000Z | setup.py | Yasumoto/sapling | 73c51a2f93441ab9c03441b4864cf735e57c8e2a | [
"Apache-2.0"
] | 3 | 2015-12-13T08:32:49.000Z | 2020-03-06T19:13:02.000Z | from setuptools import setup
from sapversion import version
setup(
name = 'sapling',
version = version(),
author = 'John Sirois',
author_email = 'john.sirois@gmail.com',
description = 'A git porcelain to manage bidirectional subtree syncing with foreign git '
'repositories',
license = 'Apache License Version 2.0',
url = 'http://github.com/jsirois/sapling',
provides = 'sapling',
install_requires = (
'gitdb >= 0.5.1',
'GitPython > 0.2, < 0.4',
),
packages = [ 'saplib', 'sapversion' ],
package_data = { 'sapversion': [ 'version.txt' ] },
scripts = [ 'sapling.py' ],
classifiers = [
'Programming Language :: Python',
'Programming Language :: Python :: 2.6',
'Development Status :: 2 - Pre-Alpha',
'Environment :: Console',
'Intended Audience :: Developers',
'License :: OSI Approved :: Apache Software License',
# TODO(jsirois): the sapling.py --install action is actually unix/symlink dependant -
# perhaps detect windows and just copy the sapling.py script to git-core/git-sap ?
'Operating System :: OS Independent',
'Topic :: Software Development :: Version Control'
],
)
| 30.097561 | 93 | 0.619125 | 132 | 1,234 | 5.765152 | 0.674242 | 0.03548 | 0.065703 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.012987 | 0.251216 | 1,234 | 40 | 94 | 30.85 | 0.810606 | 0.132901 | 0 | 0 | 0 | 0 | 0.524836 | 0.019681 | 0 | 0 | 0 | 0.025 | 0 | 1 | 0 | true | 0 | 0.066667 | 0 | 0.066667 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
cf35fe110ed3af6b7439bbe3ebaf4b01b4c2e0d8 | 200 | py | Python | BAEKJOON/Python/23806.py | cmsong111/NJ_code | 2df6176d179e168a2789a825ddeb977a82eb8d97 | [
"MIT"
] | null | null | null | BAEKJOON/Python/23806.py | cmsong111/NJ_code | 2df6176d179e168a2789a825ddeb977a82eb8d97 | [
"MIT"
] | null | null | null | BAEKJOON/Python/23806.py | cmsong111/NJ_code | 2df6176d179e168a2789a825ddeb977a82eb8d97 | [
"MIT"
] | null | null | null | count = int(input())
for i in range(count):
print("@"*(count*5))
for i in range(count*3):
print("@"*(count)," "*(count*3),"@"*(count),sep="")
for i in range(count):
print("@"*(count*5)) | 20 | 55 | 0.54 | 31 | 200 | 3.483871 | 0.354839 | 0.111111 | 0.166667 | 0.305556 | 0.648148 | 0.5 | 0.5 | 0.5 | 0 | 0 | 0 | 0.023952 | 0.165 | 200 | 10 | 56 | 20 | 0.622754 | 0 | 0 | 0.571429 | 0 | 0 | 0.024876 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0.428571 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 2 |
cf3b1afdd01e9db4470b50c71ad86d907678aa51 | 196 | py | Python | 06. Django + React.js apps/Todo app with CRUD functionality/backend/todolistapp/todoapp/urls.py | rexsimiloluwah/Python-Experiments | 63291ab7fe11e61cce2a936dd41b31f0eb35cc1f | [
"MIT"
] | 1 | 2021-01-21T11:39:07.000Z | 2021-01-21T11:39:07.000Z | 06. Django + React.js apps/Todo app with CRUD functionality/backend/todolistapp/todoapp/urls.py | rexsimiloluwah/Python-Experiments | 63291ab7fe11e61cce2a936dd41b31f0eb35cc1f | [
"MIT"
] | null | null | null | 06. Django + React.js apps/Todo app with CRUD functionality/backend/todolistapp/todoapp/urls.py | rexsimiloluwah/Python-Experiments | 63291ab7fe11e61cce2a936dd41b31f0eb35cc1f | [
"MIT"
] | 1 | 2021-01-21T11:39:19.000Z | 2021-01-21T11:39:19.000Z | from django.urls import path
from .views import TodoView, TodoDetailView
urlpatterns = [
path('tasks', TodoView.as_view()),
path('tasks/<int:id>', TodoDetailView.as_view()),
] | 19.6 | 54 | 0.668367 | 23 | 196 | 5.608696 | 0.608696 | 0.139535 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.188776 | 196 | 10 | 55 | 19.6 | 0.811321 | 0 | 0 | 0 | 0 | 0 | 0.096447 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.333333 | 0 | 0.333333 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 2 |
cf3fbcf2fb4c741b1eea2adbe119fe0d876a02e8 | 1,374 | py | Python | etabli/dquery.py | antoine-gallix/dev_tools | 9d55c7a1e52b9a1cee1d80d3d0cf8bf40ef125c9 | [
"MIT"
] | null | null | null | etabli/dquery.py | antoine-gallix/dev_tools | 9d55c7a1e52b9a1cee1d80d3d0cf8bf40ef125c9 | [
"MIT"
] | null | null | null | etabli/dquery.py | antoine-gallix/dev_tools | 9d55c7a1e52b9a1cee1d80d3d0cf8bf40ef125c9 | [
"MIT"
] | null | null | null | """Classes to filter dictionaries
"""
from pprint import pformat
class Filter_Equal:
def __init__(self, key, value):
self.key = key
self.value = value
def __call__(self, d):
return d[self.key] == self.value
class Filter_Keys:
def __init__(self, keys):
self.keys = keys
def __call__(self, d):
return {key: d[key] for key in self.keys}
class Query(dict):
def filter_keys(self, keys):
"""Select a subset of items
keys : list of keys to keep
"""
return Query(Filter_Keys(keys)(self))
def apply(self, func, key):
"""Apply filter to item
func : filter function
key : item key
"""
obj = self.copy()
obj[key] = list(map(func, obj[key]))
return Query(obj)
def filter(self, func, key):
"""Apply filter to item
func : filter function
key : item key
"""
obj = self.copy()
obj[key] = list(filter(func, obj[key]))
return Query(obj)
def get(self, key):
"""Get element
key : item key
"""
obj = self.get(key)
return Query(obj)
def get_path(self, path):
"""Get element
path : list of keys
"""
obj = self
for key in path:
obj = obj[key]
return Query(obj)
| 19.913043 | 49 | 0.526929 | 175 | 1,374 | 4.017143 | 0.228571 | 0.078236 | 0.079659 | 0.096728 | 0.4367 | 0.332859 | 0.295875 | 0.219061 | 0.219061 | 0.219061 | 0 | 0 | 0.359534 | 1,374 | 68 | 50 | 20.205882 | 0.798864 | 0.192868 | 0 | 0.258065 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.290323 | false | 0 | 0.032258 | 0.064516 | 0.645161 | 0.032258 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
cf51fb0a687304d6915ac8357600edc9bc78ac6c | 256 | py | Python | rateApp/urls.py | enockabere/Project_Rating | b50d1474927b94d3d08a708eaff026e91ec9f950 | [
"Unlicense"
] | null | null | null | rateApp/urls.py | enockabere/Project_Rating | b50d1474927b94d3d08a708eaff026e91ec9f950 | [
"Unlicense"
] | null | null | null | rateApp/urls.py | enockabere/Project_Rating | b50d1474927b94d3d08a708eaff026e91ec9f950 | [
"Unlicense"
] | null | null | null | from django.urls import path,include
from . import views
urlpatterns = [
path('api/projects/', views.ProjectList.as_view()),
path('api/projects/profile', views.ProfileList.as_view()),
path('api/projects/ratings', views.RatingList.as_view()),
] | 32 | 62 | 0.71875 | 33 | 256 | 5.484848 | 0.515152 | 0.116022 | 0.248619 | 0.143646 | 0.232044 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.117188 | 256 | 8 | 63 | 32 | 0.800885 | 0 | 0 | 0 | 0 | 0 | 0.206226 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.285714 | 0 | 0.285714 | 0 | 0 | 0 | 0 | null | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
cf571f1032d71d97c904c8951ea3ac1d6579fde4 | 2,089 | py | Python | tests/test_projectq_import.py | rmoyard/pennylane-pq | e229f5fe38a1330b3e3a84080f72ced4a2b55a65 | [
"Apache-2.0"
] | 2 | 2020-08-17T14:46:01.000Z | 2020-08-19T02:41:51.000Z | tests/test_projectq_import.py | rmoyard/pennylane-pq | e229f5fe38a1330b3e3a84080f72ced4a2b55a65 | [
"Apache-2.0"
] | 12 | 2020-08-17T14:00:27.000Z | 2022-03-28T20:16:10.000Z | tests/test_projectq_import.py | rmoyard/pennylane-pq | e229f5fe38a1330b3e3a84080f72ced4a2b55a65 | [
"Apache-2.0"
] | 2 | 2020-08-17T14:46:07.000Z | 2021-08-03T15:06:17.000Z | # Copyright 2018 Xanadu Quantum Technologies Inc.
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# http://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""
Unit tests for the :mod:`pennylane_pq` devices' behavior when applying unsupported operations.
"""
import unittest
import logging as log
import sys
from unittest import mock
from pkg_resources import iter_entry_points
from defaults import pennylane as qml, BaseTest
log.getLogger('defaults')
class ProjectQImportTest(BaseTest):
"""test of projectq import.
"""
def test_projectq_import(self):
"""Check that from projectq.ops import MatrixGate can raise an exception without problems, this ensures backward compatibility with older versions of ProjectQ
"""
del sys.modules["pennylane_pq.pqops"]
import projectq.ops
if 'MatrixGate' in projectq.ops.__dict__:
del projectq.ops.__dict__['MatrixGate']
import pennylane_pq.pqops
del sys.modules["pennylane_pq.pqops"]
import projectq.ops
if 'MatrixGate' not in projectq.ops.__dict__:
projectq.ops.__dict__['MatrixGate'] = projectq.ops.__dict__['BasicGate']
import pennylane_pq.pqops
# restore
del sys.modules["projectq.ops"]
import pennylane_pq.pqops
if __name__ == '__main__':
print('Testing PennyLane ProjectQ Plugin version ' + qml.version() + ', import test.')
# run the tests in this file
suite = unittest.TestSuite()
for t in (ProjectQImportTest, ):
ttt = unittest.TestLoader().loadTestsFromTestCase(t)
suite.addTests(ttt)
unittest.TextTestRunner().run(suite)
| 34.816667 | 166 | 0.716611 | 268 | 2,089 | 5.440299 | 0.492537 | 0.067901 | 0.05487 | 0.045267 | 0.079561 | 0.079561 | 0.079561 | 0.079561 | 0.079561 | 0.079561 | 0 | 0.004799 | 0.202011 | 2,089 | 59 | 167 | 35.40678 | 0.869826 | 0.428435 | 0 | 0.25 | 0 | 0 | 0.145064 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.035714 | false | 0 | 0.535714 | 0 | 0.607143 | 0.035714 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
cf6239aa8d4a645b53190ef28a34898e081f0419 | 365 | py | Python | papers/PACMOO/utils.py | mindspore-ai/contrib | 85dccac7a2ba6e962092ecd51aefd962d7f2aeac | [
"Apache-2.0"
] | 2 | 2021-11-10T06:16:55.000Z | 2022-02-22T11:30:04.000Z | papers/PACMOO/utils.py | mindspore-ai/contrib | 85dccac7a2ba6e962092ecd51aefd962d7f2aeac | [
"Apache-2.0"
] | null | null | null | papers/PACMOO/utils.py | mindspore-ai/contrib | 85dccac7a2ba6e962092ecd51aefd962d7f2aeac | [
"Apache-2.0"
] | 1 | 2022-03-22T06:03:15.000Z | 2022-03-22T06:03:15.000Z | """
:author: hxq, shy
"""
import numpy as np
from mindspore import ops
DIV = ops.Div()
def l2_regularizer(input_x, axis=1):
"""
:param input_x:
:param axis:
:return:
"""
return DIV(input_x, ((input_x**2).sum(axis=axis, keepdims=True))**0.5)
def set_rng_seed(seed):
"""
:param seed:
:return:
"""
np.random.seed(seed)
| 14.6 | 74 | 0.583562 | 53 | 365 | 3.886792 | 0.566038 | 0.116505 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.017986 | 0.238356 | 365 | 24 | 75 | 15.208333 | 0.723022 | 0.210959 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.285714 | false | 0 | 0.285714 | 0 | 0.714286 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
cf67b619d87d5ce5eeae0b24a7585eb4348c40f3 | 896 | py | Python | tests/dtqw/mesh/percolation/test_permanent.py | alfabr90/sparkquantum | e17ec73c0ba0a7a244419cc1ac99c5c6a181db1a | [
"MIT"
] | 2 | 2020-04-07T18:25:03.000Z | 2020-04-07T18:25:21.000Z | tests/dtqw/mesh/percolation/test_permanent.py | alfabr90/sparkquantum | e17ec73c0ba0a7a244419cc1ac99c5c6a181db1a | [
"MIT"
] | null | null | null | tests/dtqw/mesh/percolation/test_permanent.py | alfabr90/sparkquantum | e17ec73c0ba0a7a244419cc1ac99c5c6a181db1a | [
"MIT"
] | null | null | null | import unittest
from tests.base import Base
from sparkquantum.dtqw.mesh.percolation.percolation import is_percolation
from sparkquantum.dtqw.mesh.percolation.permanent import Permanent, is_permanent
# TODO: implement test_generate
class TestPermanent(Base):
def setUp(self):
super().setUp()
self.edges = [2, 4]
self.percolation = Permanent(self.edges)
def test_is_percolation(self):
self.assertTrue(is_percolation(self.percolation))
def test_str(self):
self.assertEqual(str(self.percolation),
'Permanent percolations generator with {} percolations'.format(len(self.edges)))
def test_is_permanent(self):
self.assertTrue(is_permanent(self.percolation))
def test_edges(self):
self.assertTupleEqual(self.percolation.edges, tuple(self.edges))
if __name__ == '__main__':
unittest.main()
| 28 | 105 | 0.708705 | 104 | 896 | 5.923077 | 0.355769 | 0.121753 | 0.064935 | 0.077922 | 0.172078 | 0 | 0 | 0 | 0 | 0 | 0 | 0.002755 | 0.189732 | 896 | 31 | 106 | 28.903226 | 0.84573 | 0.032366 | 0 | 0 | 0 | 0 | 0.07052 | 0 | 0 | 0 | 0 | 0.032258 | 0.2 | 1 | 0.25 | false | 0 | 0.2 | 0 | 0.5 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
cf6f2fdeb86ed51353e8adf7aa58ca052fa342b7 | 338 | py | Python | bookmarks/models.py | jlugao/elephant-bot | e764573fba133c6ec4acde0634505e41f84f803f | [
"Apache-2.0"
] | null | null | null | bookmarks/models.py | jlugao/elephant-bot | e764573fba133c6ec4acde0634505e41f84f803f | [
"Apache-2.0"
] | null | null | null | bookmarks/models.py | jlugao/elephant-bot | e764573fba133c6ec4acde0634505e41f84f803f | [
"Apache-2.0"
] | null | null | null | from django.db import models
from utils.models import CreateUpdateTracker, nb, GetOrNoneManager
from taggit.managers import TaggableManager
# Create your models here.
class Bookmark(CreateUpdateTracker):
user = models.ForeignKey("tgbot.User", on_delete=models.CASCADE)
url = models.URLField(**nb)
tags = TaggableManager()
| 26 | 68 | 0.775148 | 39 | 338 | 6.692308 | 0.666667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.139053 | 338 | 12 | 69 | 28.166667 | 0.896907 | 0.071006 | 0 | 0 | 0 | 0 | 0.032051 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.428571 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
cf73022d4934564176367a695184cf012d8ff519 | 1,717 | py | Python | vdibroker/db/sqlalchemy/types.py | cloudbase/vdi-broker | e6250d65f62fbc9f8d1c0026208bc318b6161c83 | [
"Apache-2.0"
] | 29 | 2017-05-10T20:04:55.000Z | 2021-11-19T04:50:40.000Z | vdibroker/db/sqlalchemy/types.py | cloudbase/vdi-broker | e6250d65f62fbc9f8d1c0026208bc318b6161c83 | [
"Apache-2.0"
] | 1 | 2017-11-21T15:24:56.000Z | 2020-12-29T11:30:07.000Z | vdibroker/db/sqlalchemy/types.py | cloudbase/vdi-broker | e6250d65f62fbc9f8d1c0026208bc318b6161c83 | [
"Apache-2.0"
] | 17 | 2017-07-18T09:50:35.000Z | 2021-12-23T12:22:49.000Z | # Copyright 2016 Cloudbase Solutions Srl
# All Rights Reserved.
#
# Licensed under the Apache License, Version 2.0 (the "License"); you may
# not use this file except in compliance with the License. You may obtain
# a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS, WITHOUT
# WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the
# License for the specific language governing permissions and limitations
# under the License.
from oslo_serialization import jsonutils
from sqlalchemy.dialects import mysql
from sqlalchemy import types
class LongText(types.TypeDecorator):
impl = types.Text
def load_dialect_impl(self, dialect):
if dialect.name == 'mysql':
return dialect.type_descriptor(mysql.LONGTEXT())
else:
return self.impl
class Json(LongText):
def process_bind_param(self, value, dialect):
return jsonutils.dumps(value)
def process_result_value(self, value, dialect):
if value is None:
return None
return jsonutils.loads(value)
class List(types.TypeDecorator):
impl = types.Text
def load_dialect_impl(self, dialect):
if dialect.name == 'mysql':
return dialect.type_descriptor(mysql.LONGTEXT())
else:
return self.impl
def process_bind_param(self, value, dialect):
return jsonutils.dumps(value)
def process_result_value(self, value, dialect):
if value is None:
return None
return jsonutils.loads(value)
| 28.616667 | 78 | 0.685498 | 221 | 1,717 | 5.257919 | 0.457014 | 0.051635 | 0.055077 | 0.027539 | 0.483649 | 0.483649 | 0.483649 | 0.483649 | 0.483649 | 0.483649 | 0 | 0.006144 | 0.241701 | 1,717 | 59 | 79 | 29.101695 | 0.886329 | 0.354688 | 0 | 0.8 | 0 | 0 | 0.009149 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.2 | false | 0 | 0.1 | 0.066667 | 0.8 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
cf850a6e6ee611e8ea993e5d6c53ca7432236b2d | 123 | py | Python | src/genie/libs/parser/generic/tests/ShowVersion/cli/equal/golden_output_ios_3_expected.py | ykoehler/genieparser | b62cf622c3d8eab77c7b69e932c214ed04a2565a | [
"Apache-2.0"
] | null | null | null | src/genie/libs/parser/generic/tests/ShowVersion/cli/equal/golden_output_ios_3_expected.py | ykoehler/genieparser | b62cf622c3d8eab77c7b69e932c214ed04a2565a | [
"Apache-2.0"
] | null | null | null | src/genie/libs/parser/generic/tests/ShowVersion/cli/equal/golden_output_ios_3_expected.py | ykoehler/genieparser | b62cf622c3d8eab77c7b69e932c214ed04a2565a | [
"Apache-2.0"
] | null | null | null | expected_output = {
'pid': 'CISCO3945-CHASSIS',
'os': 'ios',
'platform': 'c3900',
'version': '15.0(1)M7',
} | 20.5 | 31 | 0.528455 | 14 | 123 | 4.571429 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.135417 | 0.219512 | 123 | 6 | 32 | 20.5 | 0.53125 | 0 | 0 | 0 | 0 | 0 | 0.435484 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
cf85ee5002545689e378db4eb7a20ca699c82d2e | 4,877 | py | Python | tests/unit/rjgtoys/xc/test_raises_basics.py | bobgautier/rjgtoys-xc | f20a352633b6e1781af213a5a307cb0017ddc830 | [
"MIT"
] | 2 | 2020-09-19T17:03:13.000Z | 2021-05-28T21:04:25.000Z | tests/unit/rjgtoys/xc/test_raises_basics.py | bobgautier/rjgtoys-xc | f20a352633b6e1781af213a5a307cb0017ddc830 | [
"MIT"
] | null | null | null | tests/unit/rjgtoys/xc/test_raises_basics.py | bobgautier/rjgtoys-xc | f20a352633b6e1781af213a5a307cb0017ddc830 | [
"MIT"
] | null | null | null | """
Test the constraint mechanisms in rjgtoys.xc.raises
"""
from rjgtoys.xc.raises import raises, may_raise, raises_exception
from rjgtoys.xc import BadExceptionBug, BadExceptionsInTestBug
import pytest
from unittest.mock import patch
# Fixtures
class Allowed1(Exception):
"""First allowed exception."""
pass
class Allowed2(Exception):
"""Second allowed exception."""
pass
def raise_a1():
raise Allowed1()
def test_default_may_raise():
"""The raise_a1() function has the correct constraint and works correctly."""
# Constraint was not given, so it can do anything
assert may_raise(raise_a1) == set((Exception,))
# It always raises the exception.
with pytest.raises(Allowed1):
raise_a1()
@raises(Allowed2)
def raise_a2(x):
"""A function that sometimes raises Allowed2."""
if x:
raise Allowed2()
def test_raises_decorator():
"""The constraint on raises_a2 has been correctly recorded."""
assert raise_a2._raises__xc_raises == (Allowed2,)
@raises(Allowed1)
def raise_bad(x):
"""This function can raise a bad exception."""
if x:
raise Allowed1()
raise Allowed2()
@raises(None)
def may_not_raise():
"""This function is not allowed to raise any exceptions, but does."""
raise Allowed2()
def test_raise_bad():
"""Test that the may_not_raise() function works as expected."""
with pytest.raises(BadExceptionBug):
may_not_raise()
def test_raise_ok():
"""Test that raise_a2() works as expected."""
with pytest.raises(Allowed2):
raise_a2(True)
# Does not raise...
raise_a2(False)
# raise_bad behaves as expected
with pytest.raises(Allowed1):
raise_bad(True)
with pytest.raises(BadExceptionBug):
raise_bad(False)
def test_try_behaviour_assumptions():
"""Test that Python except clauses work as expected."""
x = []
try:
x.append('start')
raise Allowed1()
x.append('notreached')
except () as e:
raise Exception("Caught nothing")
except Allowed1 as e:
x.append('caught')
assert x == ['start','caught']
#
# Set up and try the test fixture stuff
#
class LowerEx(Exception):
"""May be raised by a low level function"""
pass
class LowerEx1(LowerEx):
"""A subclass of :class:`LowerEx`"""
pass
class OtherEx(Exception):
"""An exception unrelated to :class:`LowerEx`"""
pass
@raises(LowerEx,OtherEx,LowerEx1)
def lower(x):
"""Low-level function that may raise an exception."""
if x:
raise LowerEx()
def upper(x):
"""Upper-level function that catches an exception."""
try:
lower(x)
return None
except Exception as e:
print("lower raised %s" % (repr(e)))
return e
def test_raises_exception():
"""The raises_exception function generates the exceptions it is passed."""
print("lower may raise %s" % (may_raise(lower)))
# Pretend that the lower() function raises some different exceptions
exceptions = [LowerEx(), LowerEx1()]
results = []
for _ in raises_exception(__name__+'.lower',*exceptions):
# print "Here we go..."
results.append(upper(False))
assert results == exceptions
def test_raises_exception_detects_bad_list():
"""Tests that raises_exception refuses to raise an exception
that the target is not declared capable of raising
"""
print("lower may raise %s" %(may_raise(lower)))
with pytest.raises(BadExceptionsInTestBug):
for _ in raises_exception(__name__+'.lower',Exception('bang'),LowerEx(),LowerEx1()):
upper(False)
#
# Test awkward cases in raises_exception:
#
# Something goes wrong with the exception list
#
class UnexpectedExc(Exception):
"""
This is raised by my fake Raiser
to trigger some error paths
"""
pass
class BadRaiser(object):
"""Replaces _raises.Raiser with a rogue
implementation that always raises an unexpected
and disallowed exception type"""
def __init__(self):
pass
def configure(self, exceptions):
pass
def __call__(self,*args,**kwargs):
raise UnexpectedExc()
class NonRaiser(object):
"""Replaces _raises.Raiser with a rogue
implementation that fails to raise an exception"""
def __init__(self):
pass
def configure(self, exceptions):
pass
def __call__(self,*args,**kwargs):
return
def test_raises_exception_error_case():
with patch('rjgtoys.xc.raises.Raiser',BadRaiser):
for _ in raises_exception(__name__+'.lower',LowerEx(),LowerEx1()):
upper(False)
def test_raises_exception_nonraising_case():
with patch('rjgtoys.xc.raises.Raiser',NonRaiser):
for _ in raises_exception(__name__+'.lower',LowerEx(),LowerEx1()):
upper(False)
| 21.021552 | 92 | 0.661062 | 601 | 4,877 | 5.196339 | 0.262895 | 0.057637 | 0.03074 | 0.028178 | 0.213897 | 0.192123 | 0.153698 | 0.131924 | 0.111431 | 0.076849 | 0 | 0.008495 | 0.227599 | 4,877 | 231 | 93 | 21.112554 | 0.820547 | 0.312897 | 0 | 0.368932 | 0 | 0 | 0.054181 | 0.015033 | 0 | 0 | 0 | 0 | 0.038835 | 1 | 0.203884 | false | 0.097087 | 0.038835 | 0.009709 | 0.349515 | 0.029126 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
d83dc036c13b6c16c8316be498b029548f3f5345 | 997 | py | Python | okdata/sdk/permission/user_types.py | oslokommune/okdata-sdk-python | 39d9f79b96b2fe4c33136bc9344043f33cc0ee4c | [
"MIT"
] | 2 | 2021-01-13T06:53:04.000Z | 2021-08-02T05:14:06.000Z | okdata/sdk/permission/user_types.py | oslokommune/okdata-sdk-python | 39d9f79b96b2fe4c33136bc9344043f33cc0ee4c | [
"MIT"
] | 4 | 2021-04-21T06:14:36.000Z | 2021-08-03T08:35:14.000Z | okdata/sdk/permission/user_types.py | oslokommune/okdata-sdk-python | 39d9f79b96b2fe4c33136bc9344043f33cc0ee4c | [
"MIT"
] | 1 | 2021-08-02T05:14:09.000Z | 2021-08-02T05:14:09.000Z | # TODO: Use these simplified dataclasses once support for Python 3.6 is
# dropped. Meanwhile we'll use the "polyfill" classes defined below.
#
# from dataclasses import dataclass, field
#
# @dataclass
# class Client:
# user_id: str
# user_type: str = field(default="client", init=False)
#
#
# @dataclass
# class Team:
# user_id: str
# user_type: str = field(default="team", init=False)
#
#
# @dataclass
# class User:
# user_id: str
# user_type: str = field(default="user", init=False)
class Client:
user_id: str
user_type: str
def __init__(self, user_id):
self.user_id = user_id
self.user_type = "client"
class Team:
user_id: str
user_type: str
def __init__(self, user_id):
self.user_id = user_id
self.user_type = "team"
class User:
user_id: str
user_type: str
def __init__(self, user_id):
self.user_id = user_id
self.user_type = "user"
def asdict(obj):
return obj.__dict__
| 18.811321 | 71 | 0.642929 | 141 | 997 | 4.262411 | 0.29078 | 0.14975 | 0.08985 | 0.129784 | 0.580699 | 0.580699 | 0.580699 | 0.580699 | 0.324459 | 0.324459 | 0 | 0.00267 | 0.248746 | 997 | 52 | 72 | 19.173077 | 0.799733 | 0.467402 | 0 | 0.6 | 0 | 0 | 0.027505 | 0 | 0 | 0 | 0 | 0.019231 | 0 | 1 | 0.2 | false | 0 | 0 | 0.05 | 0.7 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
d83ead17e7240cba519bb5e00d5b470cc24573f7 | 286 | py | Python | ABC/abc051-abc100/abc055/b.py | KATO-Hiro/AtCoder | cbbdb18e95110b604728a54aed83a6ed6b993fde | [
"CC0-1.0"
] | 2 | 2020-06-12T09:54:23.000Z | 2021-05-04T01:34:07.000Z | ABC/abc051-abc100/abc055/b.py | KATO-Hiro/AtCoder | cbbdb18e95110b604728a54aed83a6ed6b993fde | [
"CC0-1.0"
] | 961 | 2020-06-23T07:26:22.000Z | 2022-03-31T21:34:52.000Z | ABC/abc051-abc100/abc055/b.py | KATO-Hiro/AtCoder | cbbdb18e95110b604728a54aed83a6ed6b993fde | [
"CC0-1.0"
] | null | null | null | '''input
100000
457992974
3
6
10
3628800
'''
# -*- coding: utf-8 -*-
# AtCoder Beginner Contest
# Problem B
if __name__ == '__main__':
from math import factorial
training_count = int(input())
print(factorial(training_count) % (10 ** 9 + 7))
| 11.44 | 53 | 0.58042 | 33 | 286 | 4.727273 | 0.848485 | 0.217949 | 0.282051 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.152709 | 0.29021 | 286 | 24 | 54 | 11.916667 | 0.615764 | 0.339161 | 0 | 0 | 0 | 0 | 0.051613 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.25 | 0 | 0.25 | 0.25 | 0 | 0 | 0 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d849235fea8740c9dde6dc042e6617422a1ce9e6 | 1,753 | py | Python | pokr/views/statement.py | teampopong/pokr.kr | 6cdc32d81c299d75a8e565a3c1478f4e44df0360 | [
"Apache-2.0"
] | 76 | 2015-01-19T12:39:43.000Z | 2021-10-14T06:10:25.000Z | pokr/views/statement.py | teampopong/pokr.kr | 6cdc32d81c299d75a8e565a3c1478f4e44df0360 | [
"Apache-2.0"
] | 22 | 2015-01-03T01:00:53.000Z | 2019-09-14T11:55:06.000Z | pokr/views/statement.py | teampopong/pokr.kr | 6cdc32d81c299d75a8e565a3c1478f4e44df0360 | [
"Apache-2.0"
] | 28 | 2015-01-14T15:45:00.000Z | 2020-06-03T13:29:41.000Z | #!/usr/bin/env python
# -*- encoding: utf-8 -*-
from datetime import date
import os.path
import re
from flask import abort, current_app, render_template, redirect, request, send_file, url_for
from flask.ext.babel import gettext, format_date
from sqlalchemy import and_
from sqlalchemy.orm import undefer, undefer_group
from sqlalchemy.orm.exc import NoResultFound
from pokr.cache import cache
from pokr.database import db_session
from pokr.models.statement import Statement
from pokr.views.meeting import generate_glossary_js
from pokr.widgets.year import year
from utils.jinja import breadcrumb
def register(app):
app.views['statement'] = 'statement_main'
gettext('statement') # for babel extraction
@app.route('/statement/', methods=['GET'])
@breadcrumb(app)
def statement_main():
statements = Statement.query
return render_template('statements.html', statements=statements)
@app.route('/statement/<id>', methods=['GET'])
@breadcrumb(app, 'statement')
def statement(id):
glossary_js = generate_glossary_js()
try:
statement = Statement.query.filter_by(id=id).one()
except NoResultFound, e:
abort(404)
before_statement = Statement.query.filter(and_(\
Statement.meeting_id==statement.meeting_id,
Statement.sequence==statement.sequence - 1)).first()
next_statement = Statement.query.filter(and_(\
Statement.meeting_id==statement.meeting_id,
Statement.sequence==statement.sequence + 1)).first()
return render_template('statement.html', statement=statement,\
before=before_statement, next=next_statement,
glossary_js=glossary_js)
| 33.075472 | 92 | 0.69652 | 208 | 1,753 | 5.725962 | 0.375 | 0.033585 | 0.060453 | 0.09068 | 0.18136 | 0.18136 | 0.18136 | 0.18136 | 0.18136 | 0.18136 | 0 | 0.004283 | 0.200799 | 1,753 | 52 | 93 | 33.711538 | 0.845824 | 0.037079 | 0 | 0.051282 | 0 | 0 | 0.060534 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0 | 0.358974 | null | null | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 2 |
d84db89f8bb8b23b91622b1fef840cf65fc1f8d3 | 687 | py | Python | ils_loc_mapper/settings_app.py | birkin/ils_location_mapper_project | 59b4b2a5b97092649f80f38580b8e229e2e2064a | [
"MIT"
] | null | null | null | ils_loc_mapper/settings_app.py | birkin/ils_location_mapper_project | 59b4b2a5b97092649f80f38580b8e229e2e2064a | [
"MIT"
] | 2 | 2020-06-05T19:19:12.000Z | 2021-03-10T21:14:15.000Z | ils_loc_mapper/settings_app.py | birkin/ils_location_mapper_project | 59b4b2a5b97092649f80f38580b8e229e2e2064a | [
"MIT"
] | 1 | 2020-11-02T20:26:10.000Z | 2020-11-02T20:26:10.000Z | # -*- coding: utf-8 -*-
import json, os
README_URL = os.environ['ILS_LOC_MPR__README_URL']
## auth
SUPER_USERS = json.loads( os.environ['ILS_LOC_MPR__SUPER_USERS_JSON'] )
STAFF_USERS = json.loads( os.environ['ILS_LOC_MPR__STAFF_USERS_JSON'] ) # users permitted access to admin
STAFF_GROUP = os.environ['ILS_LOC_MPR__STAFF_GROUP'] # not grouper-group; rather, name of django-admin group for permissions
TEST_META_DCT = json.loads( os.environ['ILS_LOC_MPR__TEST_META_DCT_JSON'] )
POST_LOGIN_ADMIN_REVERSE_URL = os.environ['ILS_LOC_MPR__POST_LOGIN_ADMIN_REVERSE_URL'] # tricky; for a direct-view of a model, the string would be in the form of: `admin:APP-NAME_MODEL-NAME_changelist`
| 49.071429 | 202 | 0.786026 | 116 | 687 | 4.232759 | 0.422414 | 0.10998 | 0.14664 | 0.183299 | 0.419552 | 0.327902 | 0.185336 | 0.130346 | 0 | 0 | 0 | 0.001631 | 0.107715 | 687 | 13 | 203 | 52.846154 | 0.799347 | 0.350801 | 0 | 0 | 0 | 0 | 0.403189 | 0.403189 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.142857 | 0 | 0.142857 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d85f71549d035c587ee70d47ce5fe31ded2c467e | 1,014 | py | Python | saleor/order/__init__.py | austineinstein/Dsaleor | d181f395f66bbaa7ba24edf9860a8f52c3c2af65 | [
"BSD-3-Clause"
] | null | null | null | saleor/order/__init__.py | austineinstein/Dsaleor | d181f395f66bbaa7ba24edf9860a8f52c3c2af65 | [
"BSD-3-Clause"
] | null | null | null | saleor/order/__init__.py | austineinstein/Dsaleor | d181f395f66bbaa7ba24edf9860a8f52c3c2af65 | [
"BSD-3-Clause"
] | null | null | null | from django.apps import AppConfig
from django.utils.translation import pgettext_lazy
class OrderAppConfig(AppConfig):
name = 'saleor.order'
def ready(self):
from payments.signals import status_changed
from .signals import order_status_change
status_changed.connect(order_status_change)
class OrderStatus:
UNFULFILLED = 'unfulfilled'
PARTIALLY_FULFILLED = 'partially fulfilled'
FULFILLED = 'fulfilled'
CANCELED = 'canceled'
CHOICES = [
(UNFULFILLED, pgettext_lazy('order status', 'Unfulfilled')),
(PARTIALLY_FULFILLED, pgettext_lazy(
'order status', 'Partially fulfilled')),
(FULFILLED, pgettext_lazy('order status', 'Fulfilled')),
(CANCELED, pgettext_lazy('order status', 'Canceled'))]
class FulfillmentStatus:
FULFILLED = 'fulfilled'
CANCELED = 'canceled'
CHOICES = [
(FULFILLED, pgettext_lazy('order status', 'Fulfilled')),
(CANCELED, pgettext_lazy('order status', 'Canceled'))]
| 28.971429 | 68 | 0.684418 | 97 | 1,014 | 7 | 0.309278 | 0.129602 | 0.150221 | 0.20324 | 0.403535 | 0.235641 | 0.235641 | 0.235641 | 0.235641 | 0.235641 | 0 | 0 | 0.209073 | 1,014 | 34 | 69 | 29.823529 | 0.846633 | 0 | 0 | 0.4 | 0 | 0 | 0.209073 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.04 | false | 0 | 0.16 | 0 | 0.68 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
d863aebfff144fa33466b0d7026410974d9c8595 | 418 | py | Python | coding/python/day01/operations.py | dkapanidis/my-tutorials | f3b72c35487782609b556016aba03b275cc6b105 | [
"MIT"
] | null | null | null | coding/python/day01/operations.py | dkapanidis/my-tutorials | f3b72c35487782609b556016aba03b275cc6b105 | [
"MIT"
] | null | null | null | coding/python/day01/operations.py | dkapanidis/my-tutorials | f3b72c35487782609b556016aba03b275cc6b105 | [
"MIT"
] | null | null | null | add = 3+2
print (add)
subtract = 3-2
print (subtract)
multiply = 3*2
print (multiply)
division = 3/2
print (division)
modulus = 3%2
print (modulus)
lessThan = 3<2
print (lessThan)
greaterThan = 3>2
print(greaterThan)
equals = 3==3
print (equals)
logicalAnd = (2==2) and (3==3) and (4==4)
print (logicalAnd)
logicalOr = (2==1) or (2==2) or (2==3)
print (logicalOr)
logicalNot = not (3==2)
print (logicalNot)
| 12.294118 | 41 | 0.655502 | 68 | 418 | 4.029412 | 0.279412 | 0.058394 | 0.20438 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.087209 | 0.177033 | 418 | 33 | 42 | 12.666667 | 0.709302 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0.5 | 0 | 0 | 0 | null | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 2 |
d87300fd270142bce547f78097ac49bba8ab4b60 | 327 | py | Python | masterserver/__init__.py | TheAssassin/python-masterserver | 8a6f5168bd5374ff047cb2a8c67299a2a1a4fc7b | [
"MIT"
] | null | null | null | masterserver/__init__.py | TheAssassin/python-masterserver | 8a6f5168bd5374ff047cb2a8c67299a2a1a4fc7b | [
"MIT"
] | null | null | null | masterserver/__init__.py | TheAssassin/python-masterserver | 8a6f5168bd5374ff047cb2a8c67299a2a1a4fc7b | [
"MIT"
] | 1 | 2020-12-18T15:17:15.000Z | 2020-12-18T15:17:15.000Z | # first we need to import the logging module
from ._logging import get_logger, setup_logging # noqa: F401
# then we make sure the codec is available
from ._codec import register_codec
register_codec()
# now the regular imports may follow
from .masterserver import MasterServer # noqa: F401 E402
__all__ = (MasterServer,)
| 25.153846 | 61 | 0.779817 | 47 | 327 | 5.212766 | 0.617021 | 0.065306 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.033088 | 0.168196 | 327 | 12 | 62 | 27.25 | 0.867647 | 0.443425 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.6 | 0 | 0.6 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
d88766f6debf7c8e4659bf9a480c441e2c87dd2a | 345 | py | Python | monero_glue/misc/bip/bip39_deriv.py | ph4r05/monero-agent | 0bac0e6f33142b2bb885565bfd1ef8ac04559280 | [
"MIT"
] | 20 | 2018-04-05T22:06:10.000Z | 2021-09-18T10:43:44.000Z | monero_glue/misc/bip/bip39_deriv.py | ph4r05/monero-agent | 0bac0e6f33142b2bb885565bfd1ef8ac04559280 | [
"MIT"
] | null | null | null | monero_glue/misc/bip/bip39_deriv.py | ph4r05/monero-agent | 0bac0e6f33142b2bb885565bfd1ef8ac04559280 | [
"MIT"
] | 5 | 2018-08-06T15:06:04.000Z | 2021-07-16T01:58:43.000Z | import hashlib
import hmac
from Crypto.Protocol.KDF import PBKDF2
def mnemonics_to_seed(seed, passphrase=b""):
salt = b"mnemonic" + passphrase
def prf(p, s):
hx = hmac.new(p, msg=s, digestmod=hashlib.sha512)
return hx.digest()
res = PBKDF2(password=seed, salt=salt, dkLen=64, prf=prf, count=2048)
return res
| 21.5625 | 73 | 0.672464 | 51 | 345 | 4.509804 | 0.627451 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.040293 | 0.208696 | 345 | 15 | 74 | 23 | 0.802198 | 0 | 0 | 0 | 0 | 0 | 0.023188 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.2 | false | 0.3 | 0.3 | 0 | 0.7 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 2 |
d887ec97cfb7b09577411dad65c207085491fced | 261 | py | Python | output/models/nist_data/atomic/short/schema_instance/nistschema_sv_iv_atomic_short_max_exclusive_4_xsd/__init__.py | tefra/xsdata-w3c-tests | b6b6a4ac4e0ab610e4b50d868510a8b7105b1a5f | [
"MIT"
] | 1 | 2021-08-14T17:59:21.000Z | 2021-08-14T17:59:21.000Z | output/models/nist_data/atomic/short/schema_instance/nistschema_sv_iv_atomic_short_max_exclusive_4_xsd/__init__.py | tefra/xsdata-w3c-tests | b6b6a4ac4e0ab610e4b50d868510a8b7105b1a5f | [
"MIT"
] | 4 | 2020-02-12T21:30:44.000Z | 2020-04-15T20:06:46.000Z | output/models/nist_data/atomic/short/schema_instance/nistschema_sv_iv_atomic_short_max_exclusive_4_xsd/__init__.py | tefra/xsdata-w3c-tests | b6b6a4ac4e0ab610e4b50d868510a8b7105b1a5f | [
"MIT"
] | null | null | null | from output.models.nist_data.atomic.short.schema_instance.nistschema_sv_iv_atomic_short_max_exclusive_4_xsd.nistschema_sv_iv_atomic_short_max_exclusive_4 import NistschemaSvIvAtomicShortMaxExclusive4
__all__ = [
"NistschemaSvIvAtomicShortMaxExclusive4",
]
| 43.5 | 199 | 0.896552 | 30 | 261 | 7.1 | 0.633333 | 0.15493 | 0.131455 | 0.187793 | 0.356808 | 0.356808 | 0.356808 | 0.356808 | 0 | 0 | 0 | 0.016194 | 0.05364 | 261 | 5 | 200 | 52.2 | 0.846154 | 0 | 0 | 0 | 0 | 0 | 0.145594 | 0.145594 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.25 | 0 | 0.25 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d88c118502a2f95d15026c4565828a1c3fdcf124 | 705 | py | Python | reservationsystem/views/stations.py | RajaFaizanNazir/bus-booking-system | df895793930535d7c1c50d84393d557be73780f3 | [
"MIT"
] | 1 | 2021-01-21T20:44:53.000Z | 2021-01-21T20:44:53.000Z | reservationsystem/views/stations.py | RajaFaizanNazir/bus-booking-system | df895793930535d7c1c50d84393d557be73780f3 | [
"MIT"
] | 7 | 2020-05-02T09:45:54.000Z | 2021-04-08T20:19:17.000Z | reservationsystem/views/stations.py | RajaFaizanNazir/bus-booking-system | df895793930535d7c1c50d84393d557be73780f3 | [
"MIT"
] | 1 | 2021-11-22T17:21:22.000Z | 2021-11-22T17:21:22.000Z | from rest_framework import permissions, serializers
from rest_framework.response import Response
from rest_framework.views import APIView
from reservationsystem.models import BusStation
from reservationsystem.services.stations import get_all_stations
class StationListApi(APIView):
"""
List all BusStations
"""
permission_classes = [permissions.AllowAny]
class OutputSerializer(serializers.ModelSerializer):
class Meta:
model = BusStation
fields = ['id', 'name']
def get(self, request, format=None):
stations = get_all_stations()
serializer = self.OutputSerializer(stations, many=True)
return Response(serializer.data)
| 28.2 | 64 | 0.72766 | 72 | 705 | 7.013889 | 0.555556 | 0.047525 | 0.10099 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.2 | 705 | 24 | 65 | 29.375 | 0.89539 | 0.028369 | 0 | 0 | 0 | 0 | 0.008969 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.066667 | false | 0 | 0.333333 | 0 | 0.733333 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
d88fd27b14017c81fe95fd446d02e358a7e9865c | 645 | py | Python | core/propabilistic_assignment.py | cerm-cirmmp/picasso | d7be216f266ba43d28a2ed8ea199874c195a840d | [
"MIT"
] | null | null | null | core/propabilistic_assignment.py | cerm-cirmmp/picasso | d7be216f266ba43d28a2ed8ea199874c195a840d | [
"MIT"
] | null | null | null | core/propabilistic_assignment.py | cerm-cirmmp/picasso | d7be216f266ba43d28a2ed8ea199874c195a840d | [
"MIT"
] | null | null | null |
"""
For each single peak, set a probability distribution over all the possibile assignment.
Given a function phi(p,p') = {1/dist(p, p')} / {\sum_s 1/dist(p, s)}
definiamo le probabilità in base allo scarto con il valor medio
anzichè assegnare il particolare picco tale per cui lo scarto con il valor medio sia minimo,
ovvero che minimizzi la seguente funzione di costo: cost(p,p') = ||csp(i) - avg_csp(i)||,
noi definiamo una distribuzione di probabilità P = {1/cost(p, p')} / {\sum_s 1/cost(p, s)}
Poi realizziamo gli assegnamenti usando beam-search
Quindi aggiorniamo tutte le distribuzioni
Ripetiamo la cosa fino a convergenza.
""" | 30.714286 | 92 | 0.736434 | 107 | 645 | 4.411215 | 0.672897 | 0.016949 | 0.025424 | 0.025424 | 0.118644 | 0 | 0 | 0 | 0 | 0 | 0 | 0.007435 | 0.165891 | 645 | 21 | 93 | 30.714286 | 0.869888 | 0.979845 | 0 | null | 0 | null | 0 | 0 | null | 0 | 0 | 0 | null | 1 | null | true | 0 | 0 | null | null | null | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d894647f6b7d42d939fc4f38468477e81261eb26 | 1,347 | py | Python | python-codes/github-follow-sync/follow-sync.py | yjwx0017/test | 80071d6b4b83e78282a7607e6311f5c71c87bb3c | [
"MIT"
] | null | null | null | python-codes/github-follow-sync/follow-sync.py | yjwx0017/test | 80071d6b4b83e78282a7607e6311f5c71c87bb3c | [
"MIT"
] | 1 | 2016-09-29T05:34:12.000Z | 2016-09-30T16:26:07.000Z | python-codes/github-follow-sync/follow-sync.py | yjwx0017/test | 80071d6b4b83e78282a7607e6311f5c71c87bb3c | [
"MIT"
] | null | null | null | #!/usr/bin/env python
# coding: utf-8
# GitHub
# Follow我的, Follow之
# 未Follow我的,从Following中删除之
# 即同步互Follow关系
import getpass
from github import Github
from github import PaginatedList
from github import NamedUser
# 始终Follow
ALWAYS_FOLLOW = [
'torvalds',
'jiangdon2007',
'michaelliao',
'zcbenz',
'ruanyf',
]
def sync():
username = raw_input('Username:')
password = getpass.getpass()
print 'Please wait...'
g = Github(username, password)
me = g.get_user()
followers = me.get_followers()
following = me.get_following()
followers_names = [x.login for x in followers]
following_names = [x.login for x in following]
all_is_ok = True
for user in following_names:
is_my_follower = user in followers_names
in_always_list = user in ALWAYS_FOLLOW
if (not is_my_follower) and (not in_always_list):
me.remove_from_following(g.get_user(user))
print 'User \'%s\' has been removed from following list!' % user
all_is_ok = False
for user in followers_names:
if user not in following_names:
me.add_to_following(g.get_user(user))
print 'New user \'%s\' has been followed!' % user
all_is_ok = False
if all_is_ok:
print 'All is OK!'
if __name__ == "__main__":
sync()
| 22.830508 | 76 | 0.644395 | 177 | 1,347 | 4.666667 | 0.384181 | 0.030266 | 0.042373 | 0.033898 | 0.142857 | 0.104116 | 0 | 0 | 0 | 0 | 0 | 0.005015 | 0.259837 | 1,347 | 58 | 77 | 23.224138 | 0.82347 | 0.078693 | 0 | 0.052632 | 0 | 0 | 0.127332 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0.078947 | 0.105263 | null | null | 0.105263 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
d8994f5246bb8f2bf569beae9a291cf57dfe8d89 | 9,348 | py | Python | src/Streamer.py | jaredmichaelsmith/PyMiner | 22af188d6f11bbab2c999636d8c2fb49dff45ed7 | [
"MIT"
] | null | null | null | src/Streamer.py | jaredmichaelsmith/PyMiner | 22af188d6f11bbab2c999636d8c2fb49dff45ed7 | [
"MIT"
] | null | null | null | src/Streamer.py | jaredmichaelsmith/PyMiner | 22af188d6f11bbab2c999636d8c2fb49dff45ed7 | [
"MIT"
] | null | null | null | '''
Jared Smith
PyMiner, Version 0.1
Streamer.py
Authored under MIT License.
'''
# Built-in Imports
from __future__ import print_function
import json
import re
import logging
import threading
import sys
# 3rd-Party Imports
import tweepy
from tweepy.models import Status
from tweepy.utils import import_simplejson, urlencode_noplus
# Define global json to be from tweepy simplejson module
json = import_simplejson()
# Thread-safe print method for use iin printing tweets
print_thread = lambda x: sys.stdout.write("%s\n" % x)
# Stream class does handling of Twitter Stream API
class Stream:
# Initialize class
def __init__(self, consumer_key, consumer_secret,
key, secret):
self.auth = tweepy.OAuthHandler(consumer_key, consumer_secret)
self.auth.set_access_token(key, secret)
self.tweetsBuffer = TweetsBuffer()
self.logger = logging.getLogger('TwitterCollector')
# If credentials invalid for tokens provides, exit on error
if not tweepy.API(self.auth).verify_credentials():
print("Invalid credentials provided.\nExiting...")
logging.error("Invalid credentials provided.\nExiting...")
exit(0)
# Run the stream in a thread and return the thread to Collector.py
def run(self, filters, filter_type):
# Initialize the listener and the buffer for the stream
sl = StreamListener()
sl.init(self.tweetsBuffer)
# Insatiate the streamer
streamer = tweepy.Stream(self.auth, sl)
filter_list = filters.split(',')
locations = [-124.848974, 24.396308, -66.885444, 49.384358, -140.9,55.1,-129.8,60.3, -169.6,53.3,-140.9,71.5, -172.0,10.6,-143.3,28.8]
stream_thread = threading.Thread(target=streamer.filter, kwargs=dict(locations=locations))
stream_thread.start()
'''# Check for filter type provided form config file and for filter parameters.
# This will either be a list of lat-lon pairs for geofencing, or keywords
if filter_type == 'location':
locations = filter_list
for location in locations:
location = float(location)
elif filter_type == 'keyword':
keywords = filter_list
stream_thread = threading.Thread(target=streamer.filter, kwargs=dict(track=keywords))
stream_thread.start()
else:
print("Invalid argument provided for config property filter_type.\nExiting...")
logging.error("Invalid argument provided for config property filter_type.\nExiting...")
exit(0)'''
return stream_thread
# Returns the tweepy tweet buffer
def getTweetsBuffer(self):
return self.tweetsBuffer
# Listener class handles what to do when data comes through stream to our endpoint
class StreamListener(tweepy.StreamListener):
# Initialize the tweet buffer
def init(self, tweetsBuffer):
self.tweetsBuffer = tweetsBuffer
# Parses status into python dictionary object for tweet and user
def parse_status(self, status, retweet = False):
tweet = {
'tweet_id':status.id,
'tweet_text':status.text,
'created_at':status.created_at,
'geo_lat':status.coordinates['coordinates'][0]
if not status.coordinates is None
else 0,
'geo_long': status.coordinates['coordinates'][1]
if not status.coordinates is None
else 0,
'user_id':status.user.id,
'tweet_url':"http://twitter.com/"+status.user.id_str+"/status/"+status.id_str,
'retweet_count':status.retweet_count,
'original_tweet_id':status.retweeted_status.id
if not retweet and (status.retweet_count > 0)
else 0,
'urls': status.entities['urls'],
'hashtags':status.entities['hashtags'],
'mentions': status.entities['user_mentions']
}
user = {
'user_id':status.user.id,
'screen_name': status.user.screen_name,
'name': status.user.name,
'followers_count': status.user.followers_count,
'friends_count': status.user.friends_count,
'description': status.user.description
if not status.user.description is None
else "N/A",
'image_url': status.user.profile_image_url,
'location': status.user.location
if not status.user.location is None
else "N/A",
'created_at': status.user.created_at
}
return {'tweet':tweet, 'user':user}
# When data is recieved from stream, this could be in the form of several things
# Essentially, handle replys, deletes, and rate limiting responses from stream,
# and everything else is unneccessary apart from statuses which will be handled
# by on_status
def on_data(self, data):
if 'in_reply_to_status_id' in data:
status = Status.parse(self.api, json.loads(data))
if self.on_status(status, data) is False:
return False
elif 'delete' in data:
delete = json.loads(data)['delete']['status']
if self.on_delete(delete['id'], delete['user_id']) is False:
return False
elif 'limit' in data:
if self.on_limit(json.loads(data)['limit']['track']) is False:
return False
# When status is recieved. print the status out, parse the tweets and retweets, and
# insert data into the tweet buffer
def on_status(self, status, rawJsonData):
keyword_string = 'christmas,holidays,holiday,santa,santa claus,tacky sweater,snowflake,drummer boy,little drummer boy,nutcracker,clause,santa clause,holly jolly,ho ho ho,ho,shepard,Lord,manger,kwanzaa,hanukkah,Apple,apple,windows,Windows,PC,pc,android,Android,Google,google,church,christmas eve,family,toys,decorating,mistletoe,stockings,presents,cookies milk,chimney,north,pole,ornaments,jingle bells,sleigh,elf,rudolph,reindeer,dasher,dixin,prancer,stocking stuffer,holiday spirit,joy,merry,Merry Christmas,happy,white elephant,greetings,new year,happy new year,season,jolly,silent night,wish list,iOS,gmail,samsung,htc,nexus,andorid L, android lollipop, google tablet,macbook pro, macbook air, ipad, ipad mini, ipad air,imac, macbook,yosemite,mavericks,osx,os x,10.10,iOS 8, iwork,ilife,iphoto,macpro,wp8,wp7,windows 8, windows 8.1, windows 7, windows phone,gift,secret santa,letter,christmas tree,christmas lights,ornaments,angel,nativity scene,jesus,jesus birthday,jubilee,festival,yule,yuletide,tidings,scrooge,noel,Noel,Frosty,cards,candy canes,wreath,holly,pageant,savior,wisemen,Lord,Mary,Joseph,Bethlehem,artificial,cedar,icicles,tinsel,pine,lights,fir,star,ribbon,wrapping paper,dolls,elves,sled,sleigh bells,excited,anticipating,exhausted,vixan,donner,cupid,comet,blitzer,carol,Christmas Carol,carolers,Christmas Dinner'
keyword_list = keyword_string.split(',')
keyword_list = [element.lower() for element in keyword_list]
patterns = [r'\b%s\b' % re.escape(s.strip()) for s in keyword_list]
rgx = re.compile('|'.join(patterns))
try:
if rgx.search(status.text.lower()):
print_thread(status.text)
tweet = self.parse_status(status)
tweet['raw_json'] = rawJsonData
self.tweetsBuffer.insert(tweet)
if tweet['tweet']['retweet_count'] > 0:
if rgx.search(status.retweeted_status.text.lower()):
retweet = self.parse_status(status.retweeted_status, True)
retweet['raw_json'] = None
self.tweetsBuffer.insert(retweet)
# On exception (i.e. Unicode errors in tweet), ignore error and move on
# to avoid halting collection process
except Exception, e:
pass
# TweetsBuffer class handles the inserting and popping of tweets off the buffer
# for tweets. This is here to allow for a data structure from which to pop off
# tweets and insert into database
class TweetsBuffer():
tweetsBuffer = []
# Initialize the lock
def __init__(self):
self.lock = threading.Lock()
# Acquire the lock, insert the tweet, and release the lock
def insert(self, tweet):
self.lock.acquire()
self.tweetsBuffer.append(tweet)
self.lock.release()
# Acquire the lock, pop off the tweet, release the lock, and return tweet to collector
def pop(self):
self.lock.acquire()
tweet = self.tweetsBuffer.pop() if len(self.tweetsBuffer) > 0 else None
self.lock.release()
return tweet
| 46.049261 | 1,340 | 0.619705 | 1,114 | 9,348 | 5.117594 | 0.369838 | 0.022803 | 0.007718 | 0.009472 | 0.070163 | 0.051921 | 0.051921 | 0.051921 | 0.040344 | 0 | 0 | 0.014872 | 0.287869 | 9,348 | 202 | 1,341 | 46.277228 | 0.84152 | 0.153402 | 0 | 0.136752 | 0 | 0.008547 | 0.256895 | 0.15027 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0.008547 | 0.08547 | null | null | 0.034188 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d8b2283db0ddbff68c69ac26c223a626f6c34ebd | 2,818 | py | Python | tests/testapp/migrations/0001_initial.py | codingjoe/django-pictures | 57fb83d7a3a0b3f29fbe7bcfe639e3a036398a06 | [
"BSD-2-Clause"
] | 16 | 2022-03-26T19:27:30.000Z | 2022-03-29T20:29:46.000Z | tests/testapp/migrations/0001_initial.py | codingjoe/django-pictures | 57fb83d7a3a0b3f29fbe7bcfe639e3a036398a06 | [
"BSD-2-Clause"
] | 7 | 2022-03-27T13:30:32.000Z | 2022-03-31T08:03:16.000Z | tests/testapp/migrations/0001_initial.py | codingjoe/django-pictures | 57fb83d7a3a0b3f29fbe7bcfe639e3a036398a06 | [
"BSD-2-Clause"
] | 1 | 2022-03-29T16:15:12.000Z | 2022-03-29T16:15:12.000Z | # Generated by Django 4.0.2 on 2022-03-27 14:17
from django.db import migrations, models
import pictures.models
class Migration(migrations.Migration):
initial = True
dependencies = []
operations = [
migrations.CreateModel(
name="Profile",
fields=[
(
"id",
models.BigAutoField(
auto_created=True,
primary_key=True,
serialize=False,
verbose_name="ID",
),
),
("name", models.CharField(max_length=100)),
(
"picture",
pictures.models.PictureField(
aspect_ratios=[None, "3/2", "16/9"],
breakpoints={
"l": 1200,
"m": 992,
"s": 768,
"xl": 1400,
"xs": 576,
},
container_width=1200,
file_types=["WEBP"],
grid_columns=12,
pixel_densities=[1, 2],
upload_to="testapp/profile/",
),
),
],
),
migrations.CreateModel(
name="SimpleModel",
fields=[
(
"id",
models.BigAutoField(
auto_created=True,
primary_key=True,
serialize=False,
verbose_name="ID",
),
),
("picture_width", models.PositiveIntegerField(null=True)),
("picture_height", models.PositiveIntegerField(null=True)),
(
"picture",
pictures.models.PictureField(
aspect_ratios=[None, "3/2", "16/9"],
blank=True,
breakpoints={
"l": 1200,
"m": 992,
"s": 768,
"xl": 1400,
"xs": 576,
},
container_width=1200,
file_types=["WEBP"],
grid_columns=12,
height_field="picture_height",
null=True,
pixel_densities=[1, 2],
upload_to="testapp/simplemodel/",
width_field="picture_width",
),
),
],
),
]
| 32.390805 | 75 | 0.334989 | 175 | 2,818 | 5.251429 | 0.457143 | 0.045702 | 0.054407 | 0.056583 | 0.616975 | 0.535365 | 0.535365 | 0.4679 | 0.4679 | 0.4679 | 0 | 0.064677 | 0.572037 | 2,818 | 86 | 76 | 32.767442 | 0.697347 | 0.015969 | 0 | 0.692308 | 1 | 0 | 0.06135 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.025641 | 0 | 0.076923 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d8ba4a37eb25e82fd0aa5fe28371f7449c460cef | 1,020 | py | Python | game_servers_status/__init__.py | hamsteruser/gameservers_checking_tool | 1c9dc05b203f08cdf6053f1f379641b57e1368e0 | [
"MIT"
] | null | null | null | game_servers_status/__init__.py | hamsteruser/gameservers_checking_tool | 1c9dc05b203f08cdf6053f1f379641b57e1368e0 | [
"MIT"
] | null | null | null | game_servers_status/__init__.py | hamsteruser/gameservers_checking_tool | 1c9dc05b203f08cdf6053f1f379641b57e1368e0 | [
"MIT"
] | null | null | null | import importlib
class PingTesterBase():
''' Init module imports a file that is match the "game" argument '''
def __init__(self, game, host, port=None, timeout=10):
if ":" in host:
_host = host.split(':')[0]
port = int(host.split(':')[1])
else:
_host = host
self.game = __import__(game, globals(), level=1).TargetGame(_host, port, timeout)
def getServerPing(self, *args, **kwargs):
return self.game.get_server_ping(*args, **kwargs)
def isServerAlive(self, *args, **kwargs):
return self.game.is_server_alive(*args, **kwargs)
def Monitor(self, *args, **kwargs):
''' Creates two attributes: self.game.latency and self.game.is_alive and returns answer from server
Can be used instead of getServerPing and isServerAlive '''
return self.game.server_monitoring(*args, **kwargs)
def __del__(self):
del(self.game)
| 34 | 107 | 0.579412 | 118 | 1,020 | 4.830508 | 0.483051 | 0.112281 | 0.073684 | 0.070175 | 0.098246 | 0.098246 | 0 | 0 | 0 | 0 | 0 | 0.006983 | 0.298039 | 1,020 | 30 | 108 | 34 | 0.789106 | 0.208824 | 0 | 0 | 0 | 0 | 0.003881 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.294118 | false | 0 | 0.117647 | 0.117647 | 0.647059 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 2 |
d8c1325b6e3da71eb09b6e90fc27a95ea97336d7 | 44,932 | py | Python | ultracart/models/screen_recording.py | UltraCart/rest_api_v2_sdk_python | d734ea13fabc7a57872ff68bac06861edb8fd882 | [
"Apache-2.0"
] | 1 | 2018-03-15T16:56:23.000Z | 2018-03-15T16:56:23.000Z | ultracart/models/screen_recording.py | UltraCart/rest_api_v2_sdk_python | d734ea13fabc7a57872ff68bac06861edb8fd882 | [
"Apache-2.0"
] | null | null | null | ultracart/models/screen_recording.py | UltraCart/rest_api_v2_sdk_python | d734ea13fabc7a57872ff68bac06861edb8fd882 | [
"Apache-2.0"
] | null | null | null | # coding: utf-8
"""
UltraCart Rest API V2
UltraCart REST API Version 2 # noqa: E501
OpenAPI spec version: 2.0.0
Contact: support@ultracart.com
Generated by: https://github.com/swagger-api/swagger-codegen.git
"""
import pprint
import re # noqa: F401
import six
class ScreenRecording(object):
"""NOTE: This class is auto generated by the swagger code generator program.
Do not edit the class manually.
"""
"""
Attributes:
swagger_types (dict): The key is attribute name
and the value is attribute type.
attribute_map (dict): The key is attribute name
and the value is json key in definition.
"""
swagger_types = {
'ad_platform': 'ScreenRecordingAdPlatform',
'analytics_client_oid': 'int',
'analytics_session_dts': 'int',
'analytics_session_oid': 'int',
'communications_campaign_name': 'str',
'communications_campaign_uuid': 'str',
'communications_email_subject': 'str',
'communications_email_uuid': 'str',
'communications_flow_name': 'str',
'communications_flow_uuid': 'str',
'email': 'str',
'email_domain': 'str',
'end_timestamp': 'str',
'esp_customer_uuid': 'str',
'events_gz_size': 'int',
'events_json_key': 'str',
'favorite': 'bool',
'favorites': 'list[int]',
'geolocation': 'GeoPoint',
'geolocation_country': 'str',
'geolocation_state': 'str',
'language_iso_code': 'str',
'merchant_id': 'str',
'merchant_notes': 'str',
'missing_external_tracking': 'bool',
'order_id': 'str',
'page_view_count': 'int',
'page_views': 'list[ScreenRecordingPageView]',
'preferred_language': 'str',
'referrer_domain': 'str',
'rrweb_version': 'str',
'screen_recording_uuid': 'str',
'signed_download_url': 'str',
'start_timestamp': 'str',
'storefront_oids': 'list[int]',
'storefronts': 'list[ScreenRecordingStoreFront]',
'tags': 'list[str]',
'time_on_site': 'int',
'ucacid': 'str',
'user_agent': 'ScreenRecordingUserAgent',
'user_agent_raw': 'str',
'user_ip': 'str',
'user_properties': 'list[ScreenRecordingUserProperty]',
'utm_campaign': 'str',
'utm_source': 'str',
'visitor_first_seen': 'str',
'visitor_number': 'int',
'watched': 'bool',
'window_height': 'int',
'window_width': 'int'
}
attribute_map = {
'ad_platform': 'ad_platform',
'analytics_client_oid': 'analytics_client_oid',
'analytics_session_dts': 'analytics_session_dts',
'analytics_session_oid': 'analytics_session_oid',
'communications_campaign_name': 'communications_campaign_name',
'communications_campaign_uuid': 'communications_campaign_uuid',
'communications_email_subject': 'communications_email_subject',
'communications_email_uuid': 'communications_email_uuid',
'communications_flow_name': 'communications_flow_name',
'communications_flow_uuid': 'communications_flow_uuid',
'email': 'email',
'email_domain': 'email_domain',
'end_timestamp': 'end_timestamp',
'esp_customer_uuid': 'esp_customer_uuid',
'events_gz_size': 'events_gz_size',
'events_json_key': 'events_json_key',
'favorite': 'favorite',
'favorites': 'favorites',
'geolocation': 'geolocation',
'geolocation_country': 'geolocation_country',
'geolocation_state': 'geolocation_state',
'language_iso_code': 'language_iso_code',
'merchant_id': 'merchant_id',
'merchant_notes': 'merchant_notes',
'missing_external_tracking': 'missing_external_tracking',
'order_id': 'order_id',
'page_view_count': 'page_view_count',
'page_views': 'page_views',
'preferred_language': 'preferred_language',
'referrer_domain': 'referrer_domain',
'rrweb_version': 'rrweb_version',
'screen_recording_uuid': 'screen_recording_uuid',
'signed_download_url': 'signed_download_url',
'start_timestamp': 'start_timestamp',
'storefront_oids': 'storefront_oids',
'storefronts': 'storefronts',
'tags': 'tags',
'time_on_site': 'time_on_site',
'ucacid': 'ucacid',
'user_agent': 'user_agent',
'user_agent_raw': 'user_agent_raw',
'user_ip': 'user_ip',
'user_properties': 'user_properties',
'utm_campaign': 'utm_campaign',
'utm_source': 'utm_source',
'visitor_first_seen': 'visitor_first_seen',
'visitor_number': 'visitor_number',
'watched': 'watched',
'window_height': 'window_height',
'window_width': 'window_width'
}
def __init__(self, ad_platform=None, analytics_client_oid=None, analytics_session_dts=None, analytics_session_oid=None, communications_campaign_name=None, communications_campaign_uuid=None, communications_email_subject=None, communications_email_uuid=None, communications_flow_name=None, communications_flow_uuid=None, email=None, email_domain=None, end_timestamp=None, esp_customer_uuid=None, events_gz_size=None, events_json_key=None, favorite=None, favorites=None, geolocation=None, geolocation_country=None, geolocation_state=None, language_iso_code=None, merchant_id=None, merchant_notes=None, missing_external_tracking=None, order_id=None, page_view_count=None, page_views=None, preferred_language=None, referrer_domain=None, rrweb_version=None, screen_recording_uuid=None, signed_download_url=None, start_timestamp=None, storefront_oids=None, storefronts=None, tags=None, time_on_site=None, ucacid=None, user_agent=None, user_agent_raw=None, user_ip=None, user_properties=None, utm_campaign=None, utm_source=None, visitor_first_seen=None, visitor_number=None, watched=None, window_height=None, window_width=None): # noqa: E501
"""ScreenRecording - a model defined in Swagger""" # noqa: E501
self._ad_platform = None
self._analytics_client_oid = None
self._analytics_session_dts = None
self._analytics_session_oid = None
self._communications_campaign_name = None
self._communications_campaign_uuid = None
self._communications_email_subject = None
self._communications_email_uuid = None
self._communications_flow_name = None
self._communications_flow_uuid = None
self._email = None
self._email_domain = None
self._end_timestamp = None
self._esp_customer_uuid = None
self._events_gz_size = None
self._events_json_key = None
self._favorite = None
self._favorites = None
self._geolocation = None
self._geolocation_country = None
self._geolocation_state = None
self._language_iso_code = None
self._merchant_id = None
self._merchant_notes = None
self._missing_external_tracking = None
self._order_id = None
self._page_view_count = None
self._page_views = None
self._preferred_language = None
self._referrer_domain = None
self._rrweb_version = None
self._screen_recording_uuid = None
self._signed_download_url = None
self._start_timestamp = None
self._storefront_oids = None
self._storefronts = None
self._tags = None
self._time_on_site = None
self._ucacid = None
self._user_agent = None
self._user_agent_raw = None
self._user_ip = None
self._user_properties = None
self._utm_campaign = None
self._utm_source = None
self._visitor_first_seen = None
self._visitor_number = None
self._watched = None
self._window_height = None
self._window_width = None
self.discriminator = None
if ad_platform is not None:
self.ad_platform = ad_platform
if analytics_client_oid is not None:
self.analytics_client_oid = analytics_client_oid
if analytics_session_dts is not None:
self.analytics_session_dts = analytics_session_dts
if analytics_session_oid is not None:
self.analytics_session_oid = analytics_session_oid
if communications_campaign_name is not None:
self.communications_campaign_name = communications_campaign_name
if communications_campaign_uuid is not None:
self.communications_campaign_uuid = communications_campaign_uuid
if communications_email_subject is not None:
self.communications_email_subject = communications_email_subject
if communications_email_uuid is not None:
self.communications_email_uuid = communications_email_uuid
if communications_flow_name is not None:
self.communications_flow_name = communications_flow_name
if communications_flow_uuid is not None:
self.communications_flow_uuid = communications_flow_uuid
if email is not None:
self.email = email
if email_domain is not None:
self.email_domain = email_domain
if end_timestamp is not None:
self.end_timestamp = end_timestamp
if esp_customer_uuid is not None:
self.esp_customer_uuid = esp_customer_uuid
if events_gz_size is not None:
self.events_gz_size = events_gz_size
if events_json_key is not None:
self.events_json_key = events_json_key
if favorite is not None:
self.favorite = favorite
if favorites is not None:
self.favorites = favorites
if geolocation is not None:
self.geolocation = geolocation
if geolocation_country is not None:
self.geolocation_country = geolocation_country
if geolocation_state is not None:
self.geolocation_state = geolocation_state
if language_iso_code is not None:
self.language_iso_code = language_iso_code
if merchant_id is not None:
self.merchant_id = merchant_id
if merchant_notes is not None:
self.merchant_notes = merchant_notes
if missing_external_tracking is not None:
self.missing_external_tracking = missing_external_tracking
if order_id is not None:
self.order_id = order_id
if page_view_count is not None:
self.page_view_count = page_view_count
if page_views is not None:
self.page_views = page_views
if preferred_language is not None:
self.preferred_language = preferred_language
if referrer_domain is not None:
self.referrer_domain = referrer_domain
if rrweb_version is not None:
self.rrweb_version = rrweb_version
if screen_recording_uuid is not None:
self.screen_recording_uuid = screen_recording_uuid
if signed_download_url is not None:
self.signed_download_url = signed_download_url
if start_timestamp is not None:
self.start_timestamp = start_timestamp
if storefront_oids is not None:
self.storefront_oids = storefront_oids
if storefronts is not None:
self.storefronts = storefronts
if tags is not None:
self.tags = tags
if time_on_site is not None:
self.time_on_site = time_on_site
if ucacid is not None:
self.ucacid = ucacid
if user_agent is not None:
self.user_agent = user_agent
if user_agent_raw is not None:
self.user_agent_raw = user_agent_raw
if user_ip is not None:
self.user_ip = user_ip
if user_properties is not None:
self.user_properties = user_properties
if utm_campaign is not None:
self.utm_campaign = utm_campaign
if utm_source is not None:
self.utm_source = utm_source
if visitor_first_seen is not None:
self.visitor_first_seen = visitor_first_seen
if visitor_number is not None:
self.visitor_number = visitor_number
if watched is not None:
self.watched = watched
if window_height is not None:
self.window_height = window_height
if window_width is not None:
self.window_width = window_width
@property
def ad_platform(self):
"""Gets the ad_platform of this ScreenRecording. # noqa: E501
:return: The ad_platform of this ScreenRecording. # noqa: E501
:rtype: ScreenRecordingAdPlatform
"""
return self._ad_platform
@ad_platform.setter
def ad_platform(self, ad_platform):
"""Sets the ad_platform of this ScreenRecording.
:param ad_platform: The ad_platform of this ScreenRecording. # noqa: E501
:type: ScreenRecordingAdPlatform
"""
self._ad_platform = ad_platform
@property
def analytics_client_oid(self):
"""Gets the analytics_client_oid of this ScreenRecording. # noqa: E501
:return: The analytics_client_oid of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._analytics_client_oid
@analytics_client_oid.setter
def analytics_client_oid(self, analytics_client_oid):
"""Sets the analytics_client_oid of this ScreenRecording.
:param analytics_client_oid: The analytics_client_oid of this ScreenRecording. # noqa: E501
:type: int
"""
self._analytics_client_oid = analytics_client_oid
@property
def analytics_session_dts(self):
"""Gets the analytics_session_dts of this ScreenRecording. # noqa: E501
:return: The analytics_session_dts of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._analytics_session_dts
@analytics_session_dts.setter
def analytics_session_dts(self, analytics_session_dts):
"""Sets the analytics_session_dts of this ScreenRecording.
:param analytics_session_dts: The analytics_session_dts of this ScreenRecording. # noqa: E501
:type: int
"""
self._analytics_session_dts = analytics_session_dts
@property
def analytics_session_oid(self):
"""Gets the analytics_session_oid of this ScreenRecording. # noqa: E501
:return: The analytics_session_oid of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._analytics_session_oid
@analytics_session_oid.setter
def analytics_session_oid(self, analytics_session_oid):
"""Sets the analytics_session_oid of this ScreenRecording.
:param analytics_session_oid: The analytics_session_oid of this ScreenRecording. # noqa: E501
:type: int
"""
self._analytics_session_oid = analytics_session_oid
@property
def communications_campaign_name(self):
"""Gets the communications_campaign_name of this ScreenRecording. # noqa: E501
Campaign Name # noqa: E501
:return: The communications_campaign_name of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._communications_campaign_name
@communications_campaign_name.setter
def communications_campaign_name(self, communications_campaign_name):
"""Sets the communications_campaign_name of this ScreenRecording.
Campaign Name # noqa: E501
:param communications_campaign_name: The communications_campaign_name of this ScreenRecording. # noqa: E501
:type: str
"""
self._communications_campaign_name = communications_campaign_name
@property
def communications_campaign_uuid(self):
"""Gets the communications_campaign_uuid of this ScreenRecording. # noqa: E501
Campaign UUID # noqa: E501
:return: The communications_campaign_uuid of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._communications_campaign_uuid
@communications_campaign_uuid.setter
def communications_campaign_uuid(self, communications_campaign_uuid):
"""Sets the communications_campaign_uuid of this ScreenRecording.
Campaign UUID # noqa: E501
:param communications_campaign_uuid: The communications_campaign_uuid of this ScreenRecording. # noqa: E501
:type: str
"""
self._communications_campaign_uuid = communications_campaign_uuid
@property
def communications_email_subject(self):
"""Gets the communications_email_subject of this ScreenRecording. # noqa: E501
Email subject # noqa: E501
:return: The communications_email_subject of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._communications_email_subject
@communications_email_subject.setter
def communications_email_subject(self, communications_email_subject):
"""Sets the communications_email_subject of this ScreenRecording.
Email subject # noqa: E501
:param communications_email_subject: The communications_email_subject of this ScreenRecording. # noqa: E501
:type: str
"""
self._communications_email_subject = communications_email_subject
@property
def communications_email_uuid(self):
"""Gets the communications_email_uuid of this ScreenRecording. # noqa: E501
Email UUID # noqa: E501
:return: The communications_email_uuid of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._communications_email_uuid
@communications_email_uuid.setter
def communications_email_uuid(self, communications_email_uuid):
"""Sets the communications_email_uuid of this ScreenRecording.
Email UUID # noqa: E501
:param communications_email_uuid: The communications_email_uuid of this ScreenRecording. # noqa: E501
:type: str
"""
self._communications_email_uuid = communications_email_uuid
@property
def communications_flow_name(self):
"""Gets the communications_flow_name of this ScreenRecording. # noqa: E501
Flow Name # noqa: E501
:return: The communications_flow_name of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._communications_flow_name
@communications_flow_name.setter
def communications_flow_name(self, communications_flow_name):
"""Sets the communications_flow_name of this ScreenRecording.
Flow Name # noqa: E501
:param communications_flow_name: The communications_flow_name of this ScreenRecording. # noqa: E501
:type: str
"""
self._communications_flow_name = communications_flow_name
@property
def communications_flow_uuid(self):
"""Gets the communications_flow_uuid of this ScreenRecording. # noqa: E501
Flow UUID # noqa: E501
:return: The communications_flow_uuid of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._communications_flow_uuid
@communications_flow_uuid.setter
def communications_flow_uuid(self, communications_flow_uuid):
"""Sets the communications_flow_uuid of this ScreenRecording.
Flow UUID # noqa: E501
:param communications_flow_uuid: The communications_flow_uuid of this ScreenRecording. # noqa: E501
:type: str
"""
self._communications_flow_uuid = communications_flow_uuid
@property
def email(self):
"""Gets the email of this ScreenRecording. # noqa: E501
:return: The email of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._email
@email.setter
def email(self, email):
"""Sets the email of this ScreenRecording.
:param email: The email of this ScreenRecording. # noqa: E501
:type: str
"""
self._email = email
@property
def email_domain(self):
"""Gets the email_domain of this ScreenRecording. # noqa: E501
:return: The email_domain of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._email_domain
@email_domain.setter
def email_domain(self, email_domain):
"""Sets the email_domain of this ScreenRecording.
:param email_domain: The email_domain of this ScreenRecording. # noqa: E501
:type: str
"""
self._email_domain = email_domain
@property
def end_timestamp(self):
"""Gets the end_timestamp of this ScreenRecording. # noqa: E501
Ending timestamp # noqa: E501
:return: The end_timestamp of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._end_timestamp
@end_timestamp.setter
def end_timestamp(self, end_timestamp):
"""Sets the end_timestamp of this ScreenRecording.
Ending timestamp # noqa: E501
:param end_timestamp: The end_timestamp of this ScreenRecording. # noqa: E501
:type: str
"""
self._end_timestamp = end_timestamp
@property
def esp_customer_uuid(self):
"""Gets the esp_customer_uuid of this ScreenRecording. # noqa: E501
:return: The esp_customer_uuid of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._esp_customer_uuid
@esp_customer_uuid.setter
def esp_customer_uuid(self, esp_customer_uuid):
"""Sets the esp_customer_uuid of this ScreenRecording.
:param esp_customer_uuid: The esp_customer_uuid of this ScreenRecording. # noqa: E501
:type: str
"""
self._esp_customer_uuid = esp_customer_uuid
@property
def events_gz_size(self):
"""Gets the events_gz_size of this ScreenRecording. # noqa: E501
:return: The events_gz_size of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._events_gz_size
@events_gz_size.setter
def events_gz_size(self, events_gz_size):
"""Sets the events_gz_size of this ScreenRecording.
:param events_gz_size: The events_gz_size of this ScreenRecording. # noqa: E501
:type: int
"""
self._events_gz_size = events_gz_size
@property
def events_json_key(self):
"""Gets the events_json_key of this ScreenRecording. # noqa: E501
:return: The events_json_key of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._events_json_key
@events_json_key.setter
def events_json_key(self, events_json_key):
"""Sets the events_json_key of this ScreenRecording.
:param events_json_key: The events_json_key of this ScreenRecording. # noqa: E501
:type: str
"""
self._events_json_key = events_json_key
@property
def favorite(self):
"""Gets the favorite of this ScreenRecording. # noqa: E501
True if the user calling the API has favorited this particular screen recording. # noqa: E501
:return: The favorite of this ScreenRecording. # noqa: E501
:rtype: bool
"""
return self._favorite
@favorite.setter
def favorite(self, favorite):
"""Sets the favorite of this ScreenRecording.
True if the user calling the API has favorited this particular screen recording. # noqa: E501
:param favorite: The favorite of this ScreenRecording. # noqa: E501
:type: bool
"""
self._favorite = favorite
@property
def favorites(self):
"""Gets the favorites of this ScreenRecording. # noqa: E501
Array of user ids that favorited this particular screen recording. # noqa: E501
:return: The favorites of this ScreenRecording. # noqa: E501
:rtype: list[int]
"""
return self._favorites
@favorites.setter
def favorites(self, favorites):
"""Sets the favorites of this ScreenRecording.
Array of user ids that favorited this particular screen recording. # noqa: E501
:param favorites: The favorites of this ScreenRecording. # noqa: E501
:type: list[int]
"""
self._favorites = favorites
@property
def geolocation(self):
"""Gets the geolocation of this ScreenRecording. # noqa: E501
:return: The geolocation of this ScreenRecording. # noqa: E501
:rtype: GeoPoint
"""
return self._geolocation
@geolocation.setter
def geolocation(self, geolocation):
"""Sets the geolocation of this ScreenRecording.
:param geolocation: The geolocation of this ScreenRecording. # noqa: E501
:type: GeoPoint
"""
self._geolocation = geolocation
@property
def geolocation_country(self):
"""Gets the geolocation_country of this ScreenRecording. # noqa: E501
:return: The geolocation_country of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._geolocation_country
@geolocation_country.setter
def geolocation_country(self, geolocation_country):
"""Sets the geolocation_country of this ScreenRecording.
:param geolocation_country: The geolocation_country of this ScreenRecording. # noqa: E501
:type: str
"""
self._geolocation_country = geolocation_country
@property
def geolocation_state(self):
"""Gets the geolocation_state of this ScreenRecording. # noqa: E501
:return: The geolocation_state of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._geolocation_state
@geolocation_state.setter
def geolocation_state(self, geolocation_state):
"""Sets the geolocation_state of this ScreenRecording.
:param geolocation_state: The geolocation_state of this ScreenRecording. # noqa: E501
:type: str
"""
self._geolocation_state = geolocation_state
@property
def language_iso_code(self):
"""Gets the language_iso_code of this ScreenRecording. # noqa: E501
Language ISO code # noqa: E501
:return: The language_iso_code of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._language_iso_code
@language_iso_code.setter
def language_iso_code(self, language_iso_code):
"""Sets the language_iso_code of this ScreenRecording.
Language ISO code # noqa: E501
:param language_iso_code: The language_iso_code of this ScreenRecording. # noqa: E501
:type: str
"""
self._language_iso_code = language_iso_code
@property
def merchant_id(self):
"""Gets the merchant_id of this ScreenRecording. # noqa: E501
:return: The merchant_id of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._merchant_id
@merchant_id.setter
def merchant_id(self, merchant_id):
"""Sets the merchant_id of this ScreenRecording.
:param merchant_id: The merchant_id of this ScreenRecording. # noqa: E501
:type: str
"""
self._merchant_id = merchant_id
@property
def merchant_notes(self):
"""Gets the merchant_notes of this ScreenRecording. # noqa: E501
:return: The merchant_notes of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._merchant_notes
@merchant_notes.setter
def merchant_notes(self, merchant_notes):
"""Sets the merchant_notes of this ScreenRecording.
:param merchant_notes: The merchant_notes of this ScreenRecording. # noqa: E501
:type: str
"""
self._merchant_notes = merchant_notes
@property
def missing_external_tracking(self):
"""Gets the missing_external_tracking of this ScreenRecording. # noqa: E501
True if external page view was not tracked # noqa: E501
:return: The missing_external_tracking of this ScreenRecording. # noqa: E501
:rtype: bool
"""
return self._missing_external_tracking
@missing_external_tracking.setter
def missing_external_tracking(self, missing_external_tracking):
"""Sets the missing_external_tracking of this ScreenRecording.
True if external page view was not tracked # noqa: E501
:param missing_external_tracking: The missing_external_tracking of this ScreenRecording. # noqa: E501
:type: bool
"""
self._missing_external_tracking = missing_external_tracking
@property
def order_id(self):
"""Gets the order_id of this ScreenRecording. # noqa: E501
:return: The order_id of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._order_id
@order_id.setter
def order_id(self, order_id):
"""Sets the order_id of this ScreenRecording.
:param order_id: The order_id of this ScreenRecording. # noqa: E501
:type: str
"""
self._order_id = order_id
@property
def page_view_count(self):
"""Gets the page_view_count of this ScreenRecording. # noqa: E501
:return: The page_view_count of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._page_view_count
@page_view_count.setter
def page_view_count(self, page_view_count):
"""Sets the page_view_count of this ScreenRecording.
:param page_view_count: The page_view_count of this ScreenRecording. # noqa: E501
:type: int
"""
self._page_view_count = page_view_count
@property
def page_views(self):
"""Gets the page_views of this ScreenRecording. # noqa: E501
:return: The page_views of this ScreenRecording. # noqa: E501
:rtype: list[ScreenRecordingPageView]
"""
return self._page_views
@page_views.setter
def page_views(self, page_views):
"""Sets the page_views of this ScreenRecording.
:param page_views: The page_views of this ScreenRecording. # noqa: E501
:type: list[ScreenRecordingPageView]
"""
self._page_views = page_views
@property
def preferred_language(self):
"""Gets the preferred_language of this ScreenRecording. # noqa: E501
ISO 3 Letter language code that the customer would prefer # noqa: E501
:return: The preferred_language of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._preferred_language
@preferred_language.setter
def preferred_language(self, preferred_language):
"""Sets the preferred_language of this ScreenRecording.
ISO 3 Letter language code that the customer would prefer # noqa: E501
:param preferred_language: The preferred_language of this ScreenRecording. # noqa: E501
:type: str
"""
self._preferred_language = preferred_language
@property
def referrer_domain(self):
"""Gets the referrer_domain of this ScreenRecording. # noqa: E501
:return: The referrer_domain of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._referrer_domain
@referrer_domain.setter
def referrer_domain(self, referrer_domain):
"""Sets the referrer_domain of this ScreenRecording.
:param referrer_domain: The referrer_domain of this ScreenRecording. # noqa: E501
:type: str
"""
self._referrer_domain = referrer_domain
@property
def rrweb_version(self):
"""Gets the rrweb_version of this ScreenRecording. # noqa: E501
:return: The rrweb_version of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._rrweb_version
@rrweb_version.setter
def rrweb_version(self, rrweb_version):
"""Sets the rrweb_version of this ScreenRecording.
:param rrweb_version: The rrweb_version of this ScreenRecording. # noqa: E501
:type: str
"""
self._rrweb_version = rrweb_version
@property
def screen_recording_uuid(self):
"""Gets the screen_recording_uuid of this ScreenRecording. # noqa: E501
:return: The screen_recording_uuid of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._screen_recording_uuid
@screen_recording_uuid.setter
def screen_recording_uuid(self, screen_recording_uuid):
"""Sets the screen_recording_uuid of this ScreenRecording.
:param screen_recording_uuid: The screen_recording_uuid of this ScreenRecording. # noqa: E501
:type: str
"""
self._screen_recording_uuid = screen_recording_uuid
@property
def signed_download_url(self):
"""Gets the signed_download_url of this ScreenRecording. # noqa: E501
:return: The signed_download_url of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._signed_download_url
@signed_download_url.setter
def signed_download_url(self, signed_download_url):
"""Sets the signed_download_url of this ScreenRecording.
:param signed_download_url: The signed_download_url of this ScreenRecording. # noqa: E501
:type: str
"""
self._signed_download_url = signed_download_url
@property
def start_timestamp(self):
"""Gets the start_timestamp of this ScreenRecording. # noqa: E501
Starting timestamp # noqa: E501
:return: The start_timestamp of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._start_timestamp
@start_timestamp.setter
def start_timestamp(self, start_timestamp):
"""Sets the start_timestamp of this ScreenRecording.
Starting timestamp # noqa: E501
:param start_timestamp: The start_timestamp of this ScreenRecording. # noqa: E501
:type: str
"""
self._start_timestamp = start_timestamp
@property
def storefront_oids(self):
"""Gets the storefront_oids of this ScreenRecording. # noqa: E501
:return: The storefront_oids of this ScreenRecording. # noqa: E501
:rtype: list[int]
"""
return self._storefront_oids
@storefront_oids.setter
def storefront_oids(self, storefront_oids):
"""Sets the storefront_oids of this ScreenRecording.
:param storefront_oids: The storefront_oids of this ScreenRecording. # noqa: E501
:type: list[int]
"""
self._storefront_oids = storefront_oids
@property
def storefronts(self):
"""Gets the storefronts of this ScreenRecording. # noqa: E501
:return: The storefronts of this ScreenRecording. # noqa: E501
:rtype: list[ScreenRecordingStoreFront]
"""
return self._storefronts
@storefronts.setter
def storefronts(self, storefronts):
"""Sets the storefronts of this ScreenRecording.
:param storefronts: The storefronts of this ScreenRecording. # noqa: E501
:type: list[ScreenRecordingStoreFront]
"""
self._storefronts = storefronts
@property
def tags(self):
"""Gets the tags of this ScreenRecording. # noqa: E501
:return: The tags of this ScreenRecording. # noqa: E501
:rtype: list[str]
"""
return self._tags
@tags.setter
def tags(self, tags):
"""Sets the tags of this ScreenRecording.
:param tags: The tags of this ScreenRecording. # noqa: E501
:type: list[str]
"""
self._tags = tags
@property
def time_on_site(self):
"""Gets the time_on_site of this ScreenRecording. # noqa: E501
:return: The time_on_site of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._time_on_site
@time_on_site.setter
def time_on_site(self, time_on_site):
"""Sets the time_on_site of this ScreenRecording.
:param time_on_site: The time_on_site of this ScreenRecording. # noqa: E501
:type: int
"""
self._time_on_site = time_on_site
@property
def ucacid(self):
"""Gets the ucacid of this ScreenRecording. # noqa: E501
:return: The ucacid of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._ucacid
@ucacid.setter
def ucacid(self, ucacid):
"""Sets the ucacid of this ScreenRecording.
:param ucacid: The ucacid of this ScreenRecording. # noqa: E501
:type: str
"""
self._ucacid = ucacid
@property
def user_agent(self):
"""Gets the user_agent of this ScreenRecording. # noqa: E501
:return: The user_agent of this ScreenRecording. # noqa: E501
:rtype: ScreenRecordingUserAgent
"""
return self._user_agent
@user_agent.setter
def user_agent(self, user_agent):
"""Sets the user_agent of this ScreenRecording.
:param user_agent: The user_agent of this ScreenRecording. # noqa: E501
:type: ScreenRecordingUserAgent
"""
self._user_agent = user_agent
@property
def user_agent_raw(self):
"""Gets the user_agent_raw of this ScreenRecording. # noqa: E501
:return: The user_agent_raw of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._user_agent_raw
@user_agent_raw.setter
def user_agent_raw(self, user_agent_raw):
"""Sets the user_agent_raw of this ScreenRecording.
:param user_agent_raw: The user_agent_raw of this ScreenRecording. # noqa: E501
:type: str
"""
self._user_agent_raw = user_agent_raw
@property
def user_ip(self):
"""Gets the user_ip of this ScreenRecording. # noqa: E501
:return: The user_ip of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._user_ip
@user_ip.setter
def user_ip(self, user_ip):
"""Sets the user_ip of this ScreenRecording.
:param user_ip: The user_ip of this ScreenRecording. # noqa: E501
:type: str
"""
self._user_ip = user_ip
@property
def user_properties(self):
"""Gets the user_properties of this ScreenRecording. # noqa: E501
:return: The user_properties of this ScreenRecording. # noqa: E501
:rtype: list[ScreenRecordingUserProperty]
"""
return self._user_properties
@user_properties.setter
def user_properties(self, user_properties):
"""Sets the user_properties of this ScreenRecording.
:param user_properties: The user_properties of this ScreenRecording. # noqa: E501
:type: list[ScreenRecordingUserProperty]
"""
self._user_properties = user_properties
@property
def utm_campaign(self):
"""Gets the utm_campaign of this ScreenRecording. # noqa: E501
UTM Campaign # noqa: E501
:return: The utm_campaign of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._utm_campaign
@utm_campaign.setter
def utm_campaign(self, utm_campaign):
"""Sets the utm_campaign of this ScreenRecording.
UTM Campaign # noqa: E501
:param utm_campaign: The utm_campaign of this ScreenRecording. # noqa: E501
:type: str
"""
self._utm_campaign = utm_campaign
@property
def utm_source(self):
"""Gets the utm_source of this ScreenRecording. # noqa: E501
UTM Source # noqa: E501
:return: The utm_source of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._utm_source
@utm_source.setter
def utm_source(self, utm_source):
"""Sets the utm_source of this ScreenRecording.
UTM Source # noqa: E501
:param utm_source: The utm_source of this ScreenRecording. # noqa: E501
:type: str
"""
self._utm_source = utm_source
@property
def visitor_first_seen(self):
"""Gets the visitor_first_seen of this ScreenRecording. # noqa: E501
Timestamp this visitor was first seen # noqa: E501
:return: The visitor_first_seen of this ScreenRecording. # noqa: E501
:rtype: str
"""
return self._visitor_first_seen
@visitor_first_seen.setter
def visitor_first_seen(self, visitor_first_seen):
"""Sets the visitor_first_seen of this ScreenRecording.
Timestamp this visitor was first seen # noqa: E501
:param visitor_first_seen: The visitor_first_seen of this ScreenRecording. # noqa: E501
:type: str
"""
self._visitor_first_seen = visitor_first_seen
@property
def visitor_number(self):
"""Gets the visitor_number of this ScreenRecording. # noqa: E501
:return: The visitor_number of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._visitor_number
@visitor_number.setter
def visitor_number(self, visitor_number):
"""Sets the visitor_number of this ScreenRecording.
:param visitor_number: The visitor_number of this ScreenRecording. # noqa: E501
:type: int
"""
self._visitor_number = visitor_number
@property
def watched(self):
"""Gets the watched of this ScreenRecording. # noqa: E501
:return: The watched of this ScreenRecording. # noqa: E501
:rtype: bool
"""
return self._watched
@watched.setter
def watched(self, watched):
"""Sets the watched of this ScreenRecording.
:param watched: The watched of this ScreenRecording. # noqa: E501
:type: bool
"""
self._watched = watched
@property
def window_height(self):
"""Gets the window_height of this ScreenRecording. # noqa: E501
:return: The window_height of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._window_height
@window_height.setter
def window_height(self, window_height):
"""Sets the window_height of this ScreenRecording.
:param window_height: The window_height of this ScreenRecording. # noqa: E501
:type: int
"""
self._window_height = window_height
@property
def window_width(self):
"""Gets the window_width of this ScreenRecording. # noqa: E501
:return: The window_width of this ScreenRecording. # noqa: E501
:rtype: int
"""
return self._window_width
@window_width.setter
def window_width(self, window_width):
"""Sets the window_width of this ScreenRecording.
:param window_width: The window_width of this ScreenRecording. # noqa: E501
:type: int
"""
self._window_width = window_width
def to_dict(self):
"""Returns the model properties as a dict"""
result = {}
for attr, _ in six.iteritems(self.swagger_types):
value = getattr(self, attr)
if isinstance(value, list):
result[attr] = list(map(
lambda x: x.to_dict() if hasattr(x, "to_dict") else x,
value
))
elif hasattr(value, "to_dict"):
result[attr] = value.to_dict()
elif isinstance(value, dict):
result[attr] = dict(map(
lambda item: (item[0], item[1].to_dict())
if hasattr(item[1], "to_dict") else item,
value.items()
))
else:
result[attr] = value
if issubclass(ScreenRecording, dict):
for key, value in self.items():
result[key] = value
return result
def to_str(self):
"""Returns the string representation of the model"""
return pprint.pformat(self.to_dict())
def __repr__(self):
"""For `print` and `pprint`"""
return self.to_str()
def __eq__(self, other):
"""Returns true if both objects are equal"""
if not isinstance(other, ScreenRecording):
return False
return self.__dict__ == other.__dict__
def __ne__(self, other):
"""Returns true if both objects are not equal"""
return not self == other
| 31.59775 | 1,138 | 0.650227 | 5,143 | 44,932 | 5.402683 | 0.039277 | 0.043187 | 0.151155 | 0.13496 | 0.668322 | 0.515044 | 0.446124 | 0.320197 | 0.232671 | 0.099655 | 0 | 0.017421 | 0.273102 | 44,932 | 1,421 | 1,139 | 31.619986 | 0.833318 | 0.374299 | 0 | 0.08769 | 1 | 0 | 0.105106 | 0.03577 | 0 | 0 | 0 | 0 | 0 | 1 | 0.178752 | false | 0 | 0.005059 | 0 | 0.283305 | 0.003373 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d8c1b6dc7746f50d73bb6b0da867becc6f435563 | 793 | py | Python | algorithms/leetcode/medium/0075_颜色分类.py | bigfoolliu/liu_aistuff | aa661d37c05c257ee293285dd0868fb7e8227628 | [
"MIT"
] | 1 | 2019-11-25T07:23:42.000Z | 2019-11-25T07:23:42.000Z | algorithms/leetcode/medium/0075_颜色分类.py | bigfoolliu/liu_aistuff | aa661d37c05c257ee293285dd0868fb7e8227628 | [
"MIT"
] | 13 | 2020-01-07T16:09:47.000Z | 2022-03-02T12:51:44.000Z | algorithms/leetcode/medium/0075_颜色分类.py | bigfoolliu/liu_aistuff | aa661d37c05c257ee293285dd0868fb7e8227628 | [
"MIT"
] | null | null | null | #!/usr/bin/env python3
# -*- coding:utf-8 -*-
# author: bigfoolliu
"""
给定一个包含红色、白色和蓝色,一共 n 个元素的数组,原地对它们进行排序,使得相同颜色的元素相邻,并按照红色、白色、蓝色顺序排列。
此题中,我们使用整数 0、 1 和 2 分别表示红色、白色和蓝色。
示例 1:
输入:nums = [2,0,2,1,1,0]
输出:[0,0,1,1,2,2]
示例 2:
输入:nums = [2,0,1]
输出:[0,1,2]
示例 3:
输入:nums = [0]
输出:[0]
示例 4:
输入:nums = [1]
输出:[1]
提示:
n == nums.length
1 <= n <= 300
nums[i] 为 0、1 或 2
进阶:
你可以不使用代码库中的排序函数来解决这道题吗?
你能想出一个仅使用常数空间的一趟扫描算法吗?
来源:力扣(LeetCode)
链接:https://leetcode-cn.com/problems/sort-colors
著作权归领扣网络所有。商业转载请联系官方授权,非商业转载请注明出处。
"""
import doctest
from typing import List
class Solution:
def sortColors(self, nums: List[int]) -> None:
"""
Do not return anything, modify nums in-place instead.
"""
pass
if __name__ == '__main__':
doctest.testmod()
| 12.790323 | 65 | 0.627995 | 130 | 793 | 3.769231 | 0.607692 | 0.020408 | 0.028571 | 0.032653 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.059937 | 0.200504 | 793 | 61 | 66 | 13 | 0.712934 | 0.721311 | 0 | 0 | 0 | 0 | 0.042553 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.142857 | false | 0.142857 | 0.285714 | 0 | 0.571429 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 2 |
d8d13d5b81321e856bb7820071fa5fbfd97dadfa | 278 | py | Python | scripts/validate_route.py | katharosada/busshaming | c8d7cd4baf9ff049cda49c92da4d5ca10f68e6a9 | [
"MIT"
] | 42 | 2018-01-20T01:12:25.000Z | 2022-02-02T01:40:17.000Z | scripts/validate_route.py | katharosada/busshaming | c8d7cd4baf9ff049cda49c92da4d5ca10f68e6a9 | [
"MIT"
] | 2 | 2018-01-24T03:58:17.000Z | 2018-06-10T01:05:57.000Z | scripts/validate_route.py | katharosada/busshaming | c8d7cd4baf9ff049cda49c92da4d5ca10f68e6a9 | [
"MIT"
] | 7 | 2018-01-24T05:49:13.000Z | 2018-12-03T08:47:43.000Z | import sys
import django
django.setup()
from busshaming.data_processing import realtime_validator
if __name__ == '__main__':
if len(sys.argv) != 2:
print(f'Usage: {sys.argv[0]} <route_id>')
sys.exit(1)
realtime_validator.validate_route(sys.argv[1])
| 18.533333 | 57 | 0.68705 | 39 | 278 | 4.564103 | 0.641026 | 0.117978 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.017621 | 0.183453 | 278 | 14 | 58 | 19.857143 | 0.76652 | 0 | 0 | 0 | 0 | 0 | 0.140794 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.333333 | 0 | 0.333333 | 0.111111 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 2 |
d8d2d5d416e44985fcf456b29776b2640ac83b4a | 25,239 | py | Python | day5.py | Lajnold/adventofcode2015 | cd99969c5701d1afd5ec58afc76d7c03681d0648 | [
"MIT"
] | null | null | null | day5.py | Lajnold/adventofcode2015 | cd99969c5701d1afd5ec58afc76d7c03681d0648 | [
"MIT"
] | null | null | null | day5.py | Lajnold/adventofcode2015 | cd99969c5701d1afd5ec58afc76d7c03681d0648 | [
"MIT"
] | null | null | null | #!/usr/bin/env python3
strings = [
"sszojmmrrkwuftyv",
"isaljhemltsdzlum",
"fujcyucsrxgatisb",
"qiqqlmcgnhzparyg",
"oijbmduquhfactbc",
"jqzuvtggpdqcekgk",
"zwqadogmpjmmxijf",
"uilzxjythsqhwndh",
"gtssqejjknzkkpvw",
"wrggegukhhatygfi",
"vhtcgqzerxonhsye",
"tedlwzdjfppbmtdx",
"iuvrelxiapllaxbg",
"feybgiimfthtplui",
"qxmmcnirvkzfrjwd",
"vfarmltinsriqxpu",
"oanqfyqirkraesfq",
"xilodxfuxphuiiii",
"yukhnchvjkfwcbiq",
"bdaibcbzeuxqplop",
"ivegnnpbiyxqsion",
"ybahkbzpditgwdgt",
"dmebdomwabxgtctu",
"ibtvimgfaeonknoh",
"jsqraroxudetmfyw",
"dqdbcwtpintfcvuz",
"tiyphjunlxddenpj",
"fgqwjgntxagidhah",
"nwenhxmakxqkeehg",
"zdoheaxqpcnlhnen",
"tfetfqojqcdzlpbm",
"qpnxkuldeiituggg",
"xwttlbdwxohahwar",
"hjkwzadmtrkegzye",
"koksqrqcfwcaxeof",
"wulwmrptktliyxeq",
"gyufbedqhhyqgqzj",
"txpunzodohikzlmj",
"jloqfuejfkemcrvu",
"amnflshcheuddqtc",
"pdvcsduggcogbiia",
"yrioavgfmeafjpcz",
"uyhbtmbutozzqfvq",
"mwhgfwsgyuwcdzik",
"auqylgxhmullxpaa",
"lgelzivplaeoivzh",
"uyvcepielfcmswoa",
"qhirixgwkkccuzlp",
"zoonniyosmkeejfg",
"iayfetpixkedyana",
"ictqeyzyqswdskiy",
"ejsgqteafvmorwxe",
"lhaiqrlqqwfbrqdx",
"ydjyboqwhfpqfydc",
"dwhttezyanrnbybv",
"edgzkqeqkyojowvr",
"rmjfdwsqamjqehdq",
"ozminkgnkwqctrxz",
"bztjhxpjthchhfcd",
"vrtioawyxkivrpiq",
"dpbcsznkpkaaclyy",
"vpoypksymdwttpvz",
"hhdlruwclartkyap",
"bqkrcbrksbzcggbo",
"jerbbbnxlwfvlaiw",
"dwkasufidwjrjfbf",
"kkfxtjhbnmqbmfwf",
"vmnfziwqxmioukmj",
"rqxvcultipkecdtu",
"fhmfdibhtjzkiqsd",
"hdpjbuzzbyafqrpd",
"emszboysjuvwwvts",
"msyigmwcuybfiooq",
"druyksfnbluvnwoh",
"fvgstvynnfbvxhsx",
"bmzalvducnqtuune",
"lzwkzfzttsvpllei",
"olmplpvjamynfyfd",
"padcwfkhystsvyfb",
"wjhbvxkwtbfqdilb",
"hruaqjwphonnterf",
"bufjobjtvxtzjpmj",
"oiedrjvmlbtwyyuy",
"sgiemafwfztwsyju",
"nsoqqfudrtwszyqf",
"vonbxquiiwxnazyl",
"yvnmjxtptujwqudn",
"rrnybqhvrcgwvrkq",
"taktoxzgotzxntfu",
"quffzywzpxyaepxa",
"rfvjebfiddcfgmwv",
"iaeozntougqwnzoh",
"scdqyrhoqmljhoil",
"bfmqticltmfhxwld",
"brbuktbyqlyfpsdl",
"oidnyhjkeqenjlhd",
"kujsaiqojopvrygg",
"vebzobmdbzvjnjtk",
"uunoygzqjopwgmbg",
"piljqxgicjzgifso",
"ikgptwcjzywswqnw",
"pujqsixoisvhdvwi",
"trtuxbgigogfsbbk",
"mplstsqclhhdyaqk",
"gzcwflvmstogdpvo",
"tfjywbkmimyyqcjd",
"gijutvhruqcsiznq",
"ibxkhjvzzxgavkha",
"btnxeqvznkxjsgmq",
"tjgofgauxaelmjoq",
"sokshvyhlkxerjrv",
"ltogbivktqmtezta",
"uduwytzvqvfluyuf",
"msuckpthtgzhdxan",
"fqmcglidvhvpirzr",
"gwztkqpcwnutvfga",
"bsjfgsrntdhlpqbx",
"xloczbqybxmiopwt",
"orvevzyjliomkkgu",
"mzjbhmfjjvaziget",
"tlsdxuhwdmghdyjb",
"atoecyjhwmznaewi",
"pyxpyvvipbqibiox",
"ajbfmpqqobfsmesj",
"siknbzefjblnohgd",
"eqfhgewbblwdfkmc",
"opylbscrotckkrbk",
"lbwxbofgjkzdxkle",
"ceixfjstaptdomvm",
"hnkrqxifjmmjktie",
"aqykzeuzvvetoygd",
"fouahjimfcisxima",
"prkzhutbqsyrhjzx",
"qqwliakathnsbzne",
"sayhgqtlcqqidqhj",
"ygduolbysehdudra",
"zricvxhdzznuxuce",
"ucvzakslykpgsixd",
"udirhgcttmyspgsb",
"yuwzppjzfsjhhdzi",
"gtqergjiuwookwre",
"xvxexbjyjkxovvwf",
"mlpaqhnnkqxrmwmm",
"ezuqbrjozwuqafhb",
"mcarusdthcbsonoq",
"weeguqeheeiigrue",
"pngtfugozxofaqxv",
"copphvbjcmfspenv",
"jiyahihykjjkdaya",
"gdqnmesvptuyrfwp",
"vbdscfywqmfxbohh",
"crtrfuxyjypzubrg",
"seihvevtxywxhflp",
"fvvpmgttnapklwou",
"qmqaqsajmqwhetpk",
"zetxvrgjmblxvakr",
"kpvwblrizaabmnhz",
"mwpvvzaaicntrkcp",
"clqyjiegtdsswqfm",
"ymrcnqgcpldgfwtm",
"nzyqpdenetncgnwq",
"cmkzevgacnmdkqro",
"kzfdsnamjqbeirhi",
"kpxrvgvvxapqlued",
"rzskbnfobevzrtqu",
"vjoahbfwtydugzap",
"ykbbldkoijlvicbl",
"mfdmroiztsgjlasb",
"quoigfyxwtwprmdr",
"ekxjqafwudgwfqjm",
"obtvyjkiycxfcdpb",
"lhoihfnbuqelthof",
"eydwzitgxryktddt",
"rxsihfybacnpoyny",
"bsncccxlplqgygtw",
"rvmlaudsifnzhcqh",
"huxwsyjyebckcsnn",
"gtuqzyihwhqvjtes",
"zreeyomtngvztveq",
"nwddzjingsarhkxb",
"nuqxqtctpoldrlsh",
"wkvnrwqgjooovhpf",
"kwgueyiyffudtbyg",
"tpkzapnjxefqnmew",
"ludwccvkihagvxal",
"lfdtzhfadvabghna",
"njqmlsnrkcfhtvbb",
"cajzbqleghhnlgap",
"vmitdcozzvqvzatp",
"eelzefwqwjiywbcz",
"uyztcuptfqvymjpi",
"aorhnrpkjqqtgnfo",
"lfrxfdrduoeqmwwp",
"vszpjvbctblplinh",
"zexhadgpqfifcqrz",
"ueirfnshekpemqua",
"qfremlntihbwabtb",
"nwznunammfexltjc",
"zkyieokaaogjehwt",
"vlrxgkpclzeslqkq",
"xrqrwfsuacywczhs",
"olghlnfjdiwgdbqc",
"difnlxnedpqcsrdf",
"dgpuhiisybjpidsj",
"vlwmwrikmitmoxbt",
"sazpcmcnviynoktm",
"pratafauetiknhln",
"ilgteekhzwlsfwcn",
"ywvwhrwhkaubvkbl",
"qlaxivzwxyhvrxcf",
"hbtlwjdriizqvjfb",
"nrmsononytuwslsa",
"mpxqgdthpoipyhjc",
"mcdiwmiqeidwcglk",
"vfbaeavmjjemfrmo",
"qzcbzmisnynzibrc",
"shzmpgxhehhcejhb",
"wirtjadsqzydtyxd",
"qjlrnjfokkqvnpue",
"dxawdvjntlbxtuqc",
"wttfmnrievfestog",
"eamjfvsjhvzzaobg",
"pbvfcwzjgxahlrag",
"omvmjkqqnobvnzkn",
"lcwmeibxhhlxnkzv",
"uiaeroqfbvlazegs",
"twniyldyuonfyzqw",
"wgjkmsbwgfotdabi",
"hnomamxoxvrzvtew",
"ycrcfavikkrxxfgw",
"isieyodknagzhaxy",
"mgzdqwikzullzyco",
"mumezgtxjrrejtrs",
"nwmwjcgrqiwgfqel",
"wjgxmebfmyjnxyyp",
"durpspyljdykvzxf",
"zuslbrpooyetgafh",
"kuzrhcjwbdouhyme",
"wyxuvbciodscbvfm",
"kbnpvuqwmxwfqtqe",
"zddzercqogdpxmft",
"sigrdchxtgavzzjh",
"lznjolnorbuddgcs",
"ycnqabxlcajagwbt",
"bnaudeaexahdgxsj",
"rlnykxvoctfwanms",
"jngyetkoplrstfzt",
"tdpxknwacksotdub",
"yutqgssfoptvizgr",
"lzmqnxeqjfnsxmsa",
"iqpgfsfmukovsdgu",
"qywreehbidowtjyz",
"iozamtgusdctvnkw",
"ielmujhtmynlwcfd",
"hzxnhtbnmmejlkyf",
"ftbslbzmiqkzebtd",
"bcwdqgiiizmohack",
"dqhfkzeddjzbdlxu",
"mxopokqffisxosci",
"vciatxhtuechbylk",
"khtkhcvelidjdena",
"blatarwzfqcapkdt",
"elamngegnczctcck",
"xeicefdbwrxhuxuf",
"sawvdhjoeahlgcdr",
"kmdcimzsfkdfpnir",
"axjayzqlosrduajb",
"mfhzreuzzumvoggr",
"iqlbkbhrkptquldb",
"xcvztvlshiefuhgb",
"pkvwyqmyoazocrio",
"ajsxkdnerbmhyxaj",
"tudibgsbnpnizvsi",
"cxuiydkgdccrqvkh",
"cyztpjesdzmbcpot",
"nnazphxpanegwitx",
"uphymczbmjalmsct",
"yyxiwnlrogyzwqmg",
"gmqwnahjvvdyhnfa",
"utolskxpuoheugyl",
"mseszdhyzoyavepd",
"ycqknvbuvcjfgmlc",
"sknrxhxbfpvpeorn",
"zqxqjetooqcodwml",
"sesylkpvbndrdhsy",
"fryuxvjnsvnjrxlw",
"mfxusewqurscujnu",
"mbitdjjtgzchvkfv",
"ozwlyxtaalxofovd",
"wdqcduaykxbunpie",
"rlnhykxiraileysk",
"wgoqfrygttlamobg",
"kflxzgxvcblkpsbz",
"tmkisflhativzhde",
"owsdrfgkaamogjzd",
"gaupjkvkzavhfnes",
"wknkurddcknbdleg",
"lltviwincmbtduap",
"qwzvspgbcksyzzmb",
"ydzzkumecryfjgnk",
"jzvmwgjutxoysaam",
"icrwpyhxllbardkr",
"jdopyntshmvltrve",
"afgkigxcuvmdbqou",
"mfzzudntmvuyhjzt",
"duxhgtwafcgrpihc",
"tsnhrkvponudumeb",
"sqtvnbeiigdzbjgv",
"eczmkqwvnsrracuo",
"mhehsgqwiczaiaxv",
"kaudmfvifovrimpd",
"lupikgivechdbwfr",
"mwaaysrndiutuiqx",
"aacuiiwgaannunmm",
"tjqjbftaqitukwzp",
"lrcqyskykbjpaekn",
"lirrvofbcqpjzxmr",
"jurorvzpplyelfml",
"qonbllojmloykjqe",
"sllkzqujfnbauuqp",
"auexjwsvphvikali",
"usuelbssqmbrkxyc",
"wyuokkfjexikptvv",
"wmfedauwjgbrgytl",
"sfwvtlzzebxzmuvw",
"rdhqxuechjsjcvaf",
"kpavhqkukugocsxu",
"ovnjtumxowbxduts",
"zgerpjufauptxgat",
"pevvnzjfwhjxdoxq",
"pmmfwxajgfziszcs",
"difmeqvaghuitjhs",
"icpwjbzcmlcterwm",
"ngqpvhajttxuegyh",
"mosjlqswdngwqsmi",
"frlvgpxrjolgodlu",
"eazwgrpcxjgoszeg",
"bbtsthgkjrpkiiyk",
"tjonoglufuvsvabe",
"xhkbcrofytmbzrtk",
"kqftfzdmpbxjynps",
"kmeqpocbnikdtfyv",
"qjjymgqxhnjwxxhp",
"dmgicrhgbngdtmjt",
"zdxrhdhbdutlawnc",
"afvoekuhdboxghvx",
"hiipezngkqcnihty",
"bbmqgheidenweeov",
"suprgwxgxwfsgjnx",
"adeagikyamgqphrj",
"zzifqinoeqaorjxg",
"adhgppljizpaxzld",
"lvxyieypvvuqjiyc",
"nljoakatwwwoovzn",
"fcrkfxclcacshhmx",
"ownnxqtdhqbgthch",
"lmfylrcdmdkgpwnj",
"hlwjfbvlswbzpbjr",
"mkofhdtljdetcyvp",
"synyxhifbetzarpo",
"agnggugngadrcxoc",
"uhttadmdmhidpyjw",
"ohfwjfhunalbubpr",
"pzkkkkwrlvxiuysn",
"kmidbxmyzkjrwjhu",
"egtitdydwjxmajnw",
"civoeoiuwtwgbqqs",
"dfptsguzfinqoslk",
"tdfvkreormspprer",
"zvnvbrmthatzztwi",
"ffkyddccrrfikjde",
"hrrmraevdnztiwff",
"qaeygykcpbtjwjbr",
"purwhitkmrtybslh",
"qzziznlswjaussel",
"dfcxkvdpqccdqqxj",
"tuotforulrrytgyn",
"gmtgfofgucjywkev",
"wkyoxudvdkbgpwhd",
"qbvktvfvipftztnn",
"otckgmojziezmojb",
"inxhvzbtgkjxflay",
"qvxapbiatuudseno",
"krpvqosbesnjntut",
"oqeukkgjsfuqkjbb",
"prcjnyymnqwqksiz",
"vuortvjxgckresko",
"orqlyobvkuwgathr",
"qnpyxlnazyfuijox",
"zwlblfkoklqmqzkw",
"hmwurwtpwnrcsanl",
"jzvxohuakopuzgpf",
"sfcpnxrviphhvxmx",
"qtwdeadudtqhbely",
"dbmkmloasqphnlgj",
"olylnjtkxgrubmtk",
"nxsdbqjuvwrrdbpq",
"wbabpirnpcsmpipw",
"hjnkyiuxpqrlvims",
"enzpntcjnxdpuqch",
"vvvqhlstzcizyimn",
"triozhqndbttglhv",
"fukvgteitwaagpzx",
"uhcvukfbmrvskpen",
"tizcyupztftzxdmt",
"vtkpnbpdzsaluczz",
"wodfoyhoekidxttm",
"otqocljrmwfqbxzu",
"linfbsnfvixlwykn",
"vxsluutrwskslnye",
"zbshygtwugixjvsi",
"zdcqwxvwytmzhvoo",
"wrseozkkcyctrmei",
"fblgtvogvkpqzxiy",
"opueqnuyngegbtnf",
"qxbovietpacqqxok",
"zacrdrrkohfygddn",
"gbnnvjqmkdupwzpq",
"qgrgmsxeotozvcak",
"hnppukzvzfmlokid",
"dzbheurndscrrtcl",
"wbgdkadtszebbrcw",
"fdmzppzphhpzyuiz",
"bukomunhrjrypohj",
"ohodhelegxootqbj",
"rsplgzarlrknqjyh",
"punjjwpsxnhpzgvu",
"djdfahypfjvpvibm",
"mlgrqsmhaozatsvy",
"xwktrgyuhqiquxgn",
"wvfaoolwtkbrisvf",
"plttjdmguxjwmeqr",
"zlvvbwvlhauyjykw",
"cigwkbyjhmepikej",
"masmylenrusgtyxs",
"hviqzufwyetyznze",
"nzqfuhrooswxxhus",
"pdbdetaqcrqzzwxf",
"oehmvziiqwkzhzib",
"icgpyrukiokmytoy",
"ooixfvwtiafnwkce",
"rvnmgqggpjopkihs",
"wywualssrmaqigqk",
"pdbvflnwfswsrirl",
"jeaezptokkccpbuj",
"mbdwjntysntsaaby",
"ldlgcawkzcwuxzpz",
"lwktbgrzswbsweht",
"ecspepmzarzmgpjm",
"qmfyvulkmkxjncai",
"izftypvwngiukrns",
"zgmnyjfeqffbooww",
"nyrkhggnprhedows",
"yykzzrjmlevgffah",
"mavaemfxhlfejfki",
"cmegmfjbkvpncqwf",
"zxidlodrezztcrij",
"fseasudpgvgnysjv",
"fupcimjupywzpqzp",
"iqhgokavirrcvyys",
"wjmkcareucnmfhui",
"nftflsqnkgjaexhq",
"mgklahzlcbapntgw",
"kfbmeavfxtppnrxn",
"nuhyvhknlufdynvn",
"nviogjxbluwrcoec",
"tyozixxxaqiuvoys",
"kgwlvmvgtsvxojpr",
"moeektyhyonfdhrb",
"kahvevmmfsmiiqex",
"xcywnqzcdqtvhiwd",
"fnievhiyltbvtvem",
"jlmndqufirwgtdxd",
"muypbfttoeelsnbs",
"rypxzbnujitfwkou",
"ubmmjbznskildeoj",
"ofnmizdeicrmkjxp",
"rekvectjbmdnfcib",
"yohrojuvdexbctdh",
"gwfnfdeibynzjmhz",
"jfznhfcqdwlpjull",
"scrinzycfhwkmmso",
"mskutzossrwoqqsi",
"rygoebkzgyzushhr",
"jpjqiycflqkexemx",
"arbufysjqmgaapnl",
"dbjerflevtgweeoj",
"snybnnjlmwjvhois",
"fszuzplntraprmbj",
"mkvaatolvuggikvg",
"zpuzuqygoxesnuyc",
"wnpxvmxvllxalulm",
"eivuuafkvudeouwy",
"rvzckdyixetfuehr",
"qgmnicdoqhveahyx",
"miawwngyymshjmpj",
"pvckyoncpqeqkbmx",
"llninfenrfjqxurv",
"kzbjnlgsqjfuzqtp",
"rveqcmxomvpjcwte",
"bzotkawzbopkosnx",
"ktqvpiribpypaymu",
"wvlzkivbukhnvram",
"uohntlcoguvjqqdo",
"ajlsiksjrcnzepkt",
"xsqatbldqcykwusd",
"ihbivgzrwpmowkop",
"vfayesfojmibkjpb",
"uaqbnijtrhvqxjtb",
"hhovshsfmvkvymba",
"jerwmyxrfeyvxcgg",
"hncafjwrlvdcupma",
"qyvigggxfylbbrzt",
"hiiixcyohmvnkpgk",
"mmitpwopgxuftdfu",
"iaxderqpceboixoa",
"zodfmjhuzhnsqfcb",
"sthtcbadrclrazsi",
"bkkkkcwegvypbrio",
"wmpcofuvzemunlhj",
"gqwebiifvqoeynro",
"juupusqdsvxcpsgv",
"rbhdfhthxelolyse",
"kjimpwnjfrqlqhhz",
"rcuigrjzarzpjgfq",
"htxcejfyzhydinks",
"sxucpdxhvqjxxjwf",
"omsznfcimbcwaxal",
"gufmtdlhgrsvcosb",
"bssshaqujtmluerz",
"uukotwjkstgwijtr",
"kbqkneobbrdogrxk",
"ljqopjcjmelgrakz",
"rwtfnvnzryujwkfb",
"dedjjbrndqnilbeh",
"nzinsxnpptzagwlb",
"lwqanydfirhnhkxy",
"hrjuzfumbvfccxno",
"okismsadkbseumnp",
"sfkmiaiwlktxqvwa",
"hauwpjjwowbunbjj",
"nowkofejwvutcnui",
"bqzzppwoslaeixro",
"urpfgufwbtzenkpj",
"xgeszvuqwxeykhef",
"yxoldvkyuikwqyeq",
"onbbhxrnmohzskgg",
"qcikuxakrqeugpoa",
"lnudcqbtyzhlpers",
"nxduvwfrgzaailgl",
"xniuwvxufzxjjrwz",
"ljwithcqmgvntjdj",
"awkftfagrfzywkhs",
"uedtpzxyubeveuek",
"bhcqdwidbjkqqhzl",
"iyneqjdmlhowwzxx",
"kvshzltcrrururty",
"zgfpiwajegwezupo",
"tkrvyanujjwmyyri",
"ercsefuihcmoaiep",
"ienjrxpmetinvbos",
"jnwfutjbgenlipzq",
"bgohjmrptfuamzbz",
"rtsyamajrhxbcncw",
"tfjdssnmztvbnscs",
"bgaychdlmchngqlp",
"kfjljiobynhwfkjo",
"owtdxzcpqleftbvn",
"ltjtimxwstvzwzjj",
"wbrvjjjajuombokf",
"zblpbpuaqbkvsxye",
"gwgdtbpnlhyqspdi",
"abipqjihjqfofmkx",
"nlqymnuvjpvvgova",
"avngotmhodpoufzn",
"qmdyivtzitnrjuae",
"xfwjmqtqdljuerxi",
"csuellnlcyqaaamq",
"slqyrcurcyuoxquo",
"dcjmxyzbzpohzprl",
"uqfnmjwniyqgsowb",
"rbmxpqoblyxdocqc",
"ebjclrdbqjhladem",
"ainnfhxnsgwqnmyo",
"eyytjjwhvodtzquf",
"iabjgmbbhilrcyyp",
"pqfnehkivuelyccc",
"xgjbyhfgmtseiimt",
"jwxyqhdbjiqqqeyy",
"gxsbrncqkmvaryln",
"vhjisxjkinaejytk",
"seexagcdmaedpcvh",
"lvudfgrcpjxzdpvd",
"fxtegyrqjzhmqean",
"dnoiseraqcoossmc",
"nwrhmwwbykvwmgep",
"udmzskejvizmtlce",
"hbzvqhvudfdlegaa",
"cghmlfqejbxewskv",
"bntcmjqfwomtbwsb",
"qezhowyopjdyhzng",
"todzsocdkgfxanbz",
"zgjkssrjlwxuhwbk",
"eibzljqsieriyrzr",
"wamxvzqyycrxotjp",
"epzvfkispwqynadu",
"dwlpfhtrafrxlyie",
"qhgzujhgdruowoug",
"girstvkahaemmxvh",
"baitcrqmxhazyhbl",
"xyanqcchbhkajdmc",
"gfvjmmcgfhvgnfdq",
"tdfdbslwncbnkzyz",
"jojuselkpmnnbcbb",
"hatdslkgxtqpmavj",
"dvelfeddvgjcyxkj",
"gnsofhkfepgwltse",
"mdngnobasfpewlno",
"qssnbcyjgmkyuoga",
"glvcmmjytmprqwvn",
"gwrixumjbcdffsdl",
"lozravlzvfqtsuiq",
"sicaflbqdxbmdlch",
"inwfjkyyqbwpmqlq",
"cuvszfotxywuzhzi",
"igfxyoaacoarlvay",
"ucjfhgdmnjvgvuni",
"rvvkzjsytqgiposh",
"jduinhjjntrmqroz",
"yparkxbgsfnueyll",
"lyeqqeisxzfsqzuj",
"woncskbibjnumydm",
"lltucklragtjmxtl",
"ubiyvmyhlesfxotj",
"uecjseeicldqrqww",
"xxlxkbcthufnjbnm",
"lhqijovvhlffpxga",
"fzdgqpzijitlogjz",
"efzzjqvwphomxdpd",
"jvgzvuyzobeazssc",
"hejfycgxywfjgbfw",
"yhjjmvkqfbnbliks",
"sffvfyywtlntsdsz",
"dwmxqudvxqdenrur",
"asnukgppdemxrzaz",
"nwqfnumblwvdpphx",
"kqsmkkspqvxzuket",
"cpnraovljzqiquaz",
"qrzgrdlyyzbyykhg",
"opoahcbiydyhsmqe",
"hjknnfdauidjeydr",
"hczdjjlygoezadow",
"rtflowzqycimllfv",
"sfsrgrerzlnychhq",
"bpahuvlblcolpjmj",
"albgnjkgmcrlaicl",
"pijyqdhfxpaxzdex",
"eeymiddvcwkpbpux",
"rqwkqoabywgggnln",
"vckbollyhgbgmgwh",
"ylzlgvnuvpynybkm",
"hpmbxtpfosbsjixt",
"ocebeihnhvkhjfqz",
"tvctyxoujdgwayze",
"efvhwxtuhapqxjen",
"rusksgefyidldmpo",
"nkmtjvddfmhirmzz",
"whvtsuadwofzmvrt",
"iiwjqvsdxudhdzzk",
"gucirgxaxgcassyo",
"rmhfasfzexeykwmr",
"hynlxcvsbgosjbis",
"huregszrcaocueen",
"pifezpoolrnbdqtv",
"unatnixzvdbqeyox",
"xtawlpduxgacchfe",
"bdvdbflqfphndduf",
"xtdsnjnmzccfptyt",
"nkhsdkhqtzqbphhg",
"aqcubmfkczlaxiyb",
"moziflxpsfubucmv",
"srdgnnjtfehiimqx",
"pwfalehdfyykrohf",
"sysxssmvewyfjrve",
"brsemdzosgqvvlxe",
"bimbjoshuvflkiat",
"hkgjasmljkpkwwku",
"sbnmwjvodygobpqc",
"bbbqycejueruihhd",
"corawswvlvneipyc",
"gcyhknmwsczcxedh",
"kppakbffdhntmcqp",
"ynulzwkfaemkcefp",
"pyroowjekeurlbii",
"iwksighrswdcnmxf",
"glokrdmugreygnsg",
"xkmvvumnfzckryop",
"aesviofpufygschi",
"csloawlirnegsssq",
"fkqdqqmlzuxbkzbc",
"uzlhzcfenxdfjdzp",
"poaaidrktteusvyf",
"zrlyfzmjzfvivcfr",
"qwjulskbniitgqtx",
"gjeszjksbfsuejki",
"vczdejdbfixbduaq",
"knjdrjthitjxluth",
"jweydeginrnicirl",
"bottrfgccqhyycsl",
"eiquffofoadmbuhk",
"lbqfutmzoksscswf",
"xfmdvnvfcnzjprba",
"uvugkjbkhlaoxmyx",
"wadlgtpczgvcaqqv",
"inzrszbtossflsxk",
"dbzbtashaartczrj",
"qbjiqpccefcfkvod",
"hluujmokjywotvzy",
"thwlliksfztcmwzh",
"arahybspdaqdexrq",
"nuojrmsgyipdvwyx",
"hnajdwjwmzattvst",
"sulcgaxezkprjbgu",
"rjowuugwdpkjtypw",
"oeugzwuhnrgiaqga",
"wvxnyymwftfoswij",
"pqxklzkjpcqscvde",
"tuymjzknntekglqj",
"odteewktugcwlhln",
"exsptotlfecmgehc",
"eeswfcijtvzgrqel",
"vjhrkiwmunuiwqau",
"zhlixepkeijoemne",
"pavfsmwesuvebzdd",
"jzovbklnngfdmyws",
"nbajyohtzfeoiixz",
"ciozmhrsjzrwxvhz",
"gwucrxieqbaqfjuv",
"uayrxrltnohexawc",
"flmrbhwsfbcquffm",
"gjyabmngkitawlxc",
"rwwtggvaygfbovhg",
"xquiegaisynictjq",
"oudzwuhexrwwdbyy",
"lengxmguyrwhrebb",
"uklxpglldbgqsjls",
"dbmvlfeyguydfsxq",
"zspdwdqcrmtmdtsc",
"mqfnzwbfqlauvrgc",
"amcrkzptgacywvhv",
"ndxmskrwrqysrndf",
"mwjyhsufeqhwisju",
"srlrukoaenyevykt",
"tnpjtpwawrxbikct",
"geczalxmgxejulcv",
"tvkcbqdhmuwcxqci",
"tiovluvwezwwgaox",
"zrjhtbgajkjqzmfo",
"vcrywduwsklepirs",
"lofequdigsszuioy",
"wxsdzomkjqymlzat",
"iabaczqtrfbmypuy",
"ibdlmudbajikcncr",
"rqcvkzsbwmavdwnv",
"ypxoyjelhllhbeog",
"fdnszbkezyjbttbg",
"uxnhrldastpdjkdz",
"xfrjbehtxnlyzcka",
"omjyfhbibqwgcpbv",
"eguucnoxaoprszmp",
"xfpypldgcmcllyzz",
"aypnmgqjxjqceelv",
"mgzharymejlafvgf",
"tzowgwsubbaigdok",
"ilsehjqpcjwmylxc",
"pfmouwntfhfnmrwk",
"csgokybgdqwnduwp",
"eaxwvxvvwbrovypz",
"nmluqvobbbmdiwwb",
"lnkminvfjjzqbmio",
"mjiiqzycqdhfietz",
"towlrzriicyraevq",
"obiloewdvbrsfwjo",
"lmeooaajlthsfltw",
"ichygipzpykkesrw",
"gfysloxmqdsfskvt",
"saqzntehjldvwtsx",
"pqddoemaufpfcaew",
"mjrxvbvwcreaybwe",
"ngfbrwfqnxqosoai",
"nesyewxreiqvhald",
"kqhqdlquywotcyfy",
"liliptyoqujensfi",
"nsahsaxvaepzneqq",
"zaickulfjajhctye",
"gxjzahtgbgbabtht",
"koxbuopaqhlsyhrp",
"jhzejdjidqqtjnwe",
"dekrkdvprfqpcqki",
"linwlombdqtdeyop",
"dvckqqbnigdcmwmx",
"yaxygbjpzkvnnebv",
"rlzkdkgaagmcpxah",
"cfzuyxivtknirqvt",
"obivkajhsjnrxxhn",
"lmjhayymgpseuynn",
"bbjyewkwadaipyju",
"lmzyhwomfypoftuu",
"gtzhqlgltvatxack",
"jfflcfaqqkrrltgq",
"txoummmnzfrlrmcg",
"ohemsbfuqqpucups",
"imsfvowcbieotlok",
"tcnsnccdszxfcyde",
"qkcdtkwuaquajazz",
"arcfnhmdjezdbqku",
"srnocgyqrlcvlhkb",
"mppbzvfmcdirbyfw",
"xiuarktilpldwgwd",
"ypufwmhrvzqmexpc",
"itpdnsfkwgrdujmj",
"cmpxnodtsswkyxkr",
"wayyxtjklfrmvbfp",
"mfaxphcnjczhbbwy",
"sjxhgwdnqcofbdra",
"pnxmujuylqccjvjm",
"ivamtjbvairwjqwl",
"deijtmzgpfxrclss",
"bzkqcaqagsynlaer",
"tycefobvxcvwaulz",
"ctbhnywezxkdsswf",
"urrxxebxrthtjvib",
"fpfelcigwqwdjucv",
"ngfcyyqpqulwcphb",
"rltkzsiipkpzlgpw",
"qfdsymzwhqqdkykc",
"balrhhxipoqzmihj",
"rnwalxgigswxomga",
"ghqnxeogckshphgr",
"lyyaentdizaumnla",
"exriodwfzosbeoib",
"speswfggibijfejk",
"yxmxgfhvmshqszrq",
"hcqhngvahzgawjga",
"qmhlsrfpesmeksur",
"eviafjejygakodla",
"kvcfeiqhynqadbzv",
"fusvyhowslfzqttg",
"girqmvwmcvntrwau",
"yuavizroykfkdekz",
"jmcwohvmzvowrhxf",
"kzimlcpavapynfue",
"wjudcdtrewfabppq",
"yqpteuxqgbmqfgxh",
"xdgiszbuhdognniu",
"jsguxfwhpftlcjoh",
"whakkvspssgjzxre",
"ggvnvjurlyhhijgm",
"krvbhjybnpemeptr",
"pqedgfojyjybfbzr",
"jzhcrsgmnkwwtpdo",
"yyscxoxwofslncmp",
"gzjhnxytmyntzths",
"iteigbnqbtpvqumi",
"zjevfzusnjukqpfw",
"xippcyhkfuounxqk",
"mcnhrcfonfdgpkyh",
"pinkcyuhjkexbmzj",
"lotxrswlxbxlxufs",
"fmqajrtoabpckbnu",
"wfkwsgmcffdgaqxg",
"qfrsiwnohoyfbidr",
"czfqbsbmiuyusaqs",
"ieknnjeecucghpoo",
"cevdgqnugupvmsge",
"gjkajcyjnxdrtuvr",
"udzhrargnujxiclq",
"zqqrhhmjwermjssg",
"ggdivtmgoqajydzz",
"wnpfsgtxowkjiivl",
"afbhqawjbotxnqpd",
"xjpkifkhfjeqifdn",
"oyfggzsstfhvticp",
"kercaetahymeawxy",
"khphblhcgmbupmzt",
"iggoqtqpvaebtiol",
"ofknifysuasshoya",
"qxuewroccsbogrbv",
"apsbnbkiopopytgu",
"zyahfroovfjlythh",
"bxhjwfgeuxlviydq",
"uvbhdtvaypasaswa",
"qamcjzrmesqgqdiz",
"hjnjyzrxntiycyel",
"wkcrwqwniczwdxgq",
"hibxlvkqakusswkx",
"mzjyuenepwdgrkty",
"tvywsoqslfsulses",
"jqwcwuuisrclircv",
"xanwaoebfrzhurct",
"ykriratovsvxxasf",
"qyebvtqqxbjuuwuo",
"telrvlwvriylnder",
"acksrrptgnhkeiaa",
"yemwfjhiqlzsvdxf",
"banrornfkcymmkcc",
"ytbhxvaeiigjpcgm",
"crepyazgxquposkn",
"xlqwdrytzwnxzwzv",
"xtrbfbwopxscftps",
"kwbytzukgseeyjla",
"qtfdvavvjogybxjg",
"ytbmvmrcxwfkgvzw",
"nbscbdskdeocnfzr",
"sqquwjbdxsxhcseg",
"ewqxhigqcgszfsuw",
"cvkyfcyfmubzwsee",
"dcoawetekigxgygd",
"ohgqnqhfimyuqhvi",
"otisopzzpvnhctte",
"bauieohjejamzien",
"ewnnopzkujbvhwce",
"aeyqlskpaehagdiv",
"pncudvivwnnqspxy",
"ytugesilgveokxcg",
"zoidxeelqdjesxpr",
"ducjccsuaygfchzj",
"smhgllqqqcjfubfc",
"nlbyyywergronmir",
"prdawpbjhrzsbsvj",
"nmgzhnjhlpcplmui",
"eflaogtjghdjmxxz",
"qolvpngucbkprrdc",
"ixywxcienveltgho",
"mwnpqtocagenkxut",
"iskrfbwxonkguywx",
"ouhtbvcaczqzmpua",
"srewprgddfgmdbao",
"dyufrltacelchlvu",
"czmzcbrkecixuwzz",
"dtbeojcztzauofuk",
"prrgoehpqhngfgmw",
"baolzvfrrevxsyke",
"zqadgxshwiarkzwh",
"vsackherluvurqqj",
"surbpxdulvcvgjbd",
"wqxytarcxzgxhvtx",
"vbcubqvejcfsgrac",
"zqnjfeapshjowzja",
"hekvbhtainkvbynx",
"knnugxoktxpvoxnh",
"knoaalcefpgtvlwm",
"qoakaunowmsuvkus",
"ypkvlzcduzlezqcb",
"ujhcagawtyepyogh",
"wsilcrxncnffaxjf",
"gbbycjuscquaycrk",
"aduojapeaqwivnly",
"ceafyxrakviagcjy",
"nntajnghicgnrlst",
"vdodpeherjmmvbje",
"wyyhrnegblwvdobn",
"xlfurpghkpbzhhif",
"xyppnjiljvirmqjo",
"kglzqahipnddanpi",
"omjateouxikwxowr",
"ocifnoopfglmndcx",
"emudcukfbadyijev",
"ooktviixetfddfmh",
"wtvrhloyjewdeycg",
"cgjncqykgutfjhvb",
"nkwvpswppeffmwad",
"hqbcmfhzkxmnrivg",
"mdskbvzguxvieilr",
"anjcvqpavhdloaqh",
"erksespdevjylenq",
"fadxwbmisazyegup",
"iyuiffjmcaahowhj",
"ygkdezmynmltodbv",
"fytneukxqkjattvh",
"woerxfadbfrvdcnz",
"iwsljvkyfastccoa",
"movylhjranlorofe",
"drdmicdaiwukemep",
"knfgtsmuhfcvvshg",
"ibstpbevqmdlhajn",
"tstwsswswrxlzrqs",
"estyydmzothggudf",
"jezogwvymvikszwa",
"izmqcwdyggibliet",
"nzpxbegurwnwrnca",
"kzkojelnvkwfublh",
"xqcssgozuxfqtiwi",
"tcdoigumjrgvczfv",
"ikcjyubjmylkwlwq",
"kqfivwystpqzvhan",
"bzukgvyoqewniivj",
"iduapzclhhyfladn",
"fbpyzxdfmkrtfaeg",
"yzsmlbnftftgwadz"
]
def part1():
def contains_three_vowels(x):
n = 0
for c in x:
if c in "aeiou":
n += 1
return n >= 3
def contains_dubble(x):
for i in range(len(x) - 1):
if x[i] == x[i + 1]:
return True
return False
def contains_forbidden(x):
forbidden = ["ab", "cd", "pq", "xy"]
for i in range(len(x) - 1):
if x[i] + x[i + 1] in forbidden:
return True
return False
n = 0
for x in strings:
if contains_three_vowels(x) and contains_dubble(x) and not contains_forbidden(x):
n += 1
print("Number of nice strings: {}".format(n))
def part2():
def contains_pairs(x):
for i in range(len(x) - 3):
if x.find(x[i] + x[i + 1], i + 2) >= 0:
return True
return False
def contains_dubble(x):
for i in range(len(x) - 2):
if x[i] == x[i + 2]:
return True
return False
n = 0
for x in strings:
if contains_pairs(x) and contains_dubble(x):
n += 1
print("Number of nice strings: {}".format(n))
part1()
part2()
| 23.877956 | 89 | 0.657435 | 1,179 | 25,239 | 14.063613 | 0.884648 | 0.000965 | 0.003619 | 0.002654 | 0.022556 | 0.019661 | 0.016465 | 0.0155 | 0.0155 | 0.0155 | 0 | 0.001114 | 0.217521 | 25,239 | 1,056 | 90 | 23.900568 | 0.838473 | 0.000832 | 0 | 0.021093 | 0 | 0 | 0.63707 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.006711 | false | 0 | 0 | 0 | 0.01534 | 0.001918 | 0 | 0 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d8d6931ac65cc6a255b6512843a2e8987070ceab | 1,991 | py | Python | diapers3ok.py | txt/evil | a08188d16cb983f329b8a0d03565cc108f435eff | [
"Unlicense"
] | 1 | 2016-08-03T03:45:18.000Z | 2016-08-03T03:45:18.000Z | diapers3ok.py | txt/evil | a08188d16cb983f329b8a0d03565cc108f435eff | [
"Unlicense"
] | null | null | null | diapers3ok.py | txt/evil | a08188d16cb983f329b8a0d03565cc108f435eff | [
"Unlicense"
] | 1 | 2018-06-22T15:21:57.000Z | 2018-06-22T15:21:57.000Z | from __future__ import print_function,division
from diapers3 import *
#@ok
def _o():
x=o(a=1,b=2)
#print(x)
x.has().update(dict(c=3,b=5))
#print(x)
y = x.copy()
y.a=10
assert y.a == 10 and x.a==1
y["a"] = y["a"] + 100
assert y.a == 110
#@ok
def _thing():
z = Thing("zz",init=91.34233,prec=0,step=3)
a = Thing("aa",init=91.34233,prec=0,step=3)
assert z.restrain(-10) == 0
t = Time(hi=32)
ts = Things(z=z,A=a,T=t)
assert sorted(ts.init().has().values()) == [0,91.34233,91.34233]
return ts
def _log():
ts = _thing()
log = Log(ts,steps=5)
for dt,t,u,v in sim(ts,spy=8):
True
#ok
def _diapers():
print(222)
Diapers().run()
# ts 5.73933090614 5.73933090614
# ep 22.4757767473 22.4757767473
# early 67.2864581745 67.2864581745
# late 72.9962277924 72.9962277924
# inc 7.0 11.0
# done! 2015-06-29 08:47:45.962529
"""
ts 1.18736297658 1.18736297658
ep 11.6078068745 11.6078068745
early 69.5446699078 69.5446699078
late 73.2893699124 73.2893699124
inc 3.0 4.0
"""
@ok
def brooks0():
b = BrooksLaw()
b.run(10,verbose=True,whatif=dict(ts=6,ep=2,early=67,late=73,inc=20))
#@ok
def _brooks1():
seed(1)
y = 0
out = None
max = -1
for x in xrange(104):
b = BrooksLaw()
d1 = b.things().any()
d1.inc = round(d1.inc)
d2 = d1.copy()
while d2.inc <= d1.inc:
d2.inc = round(d1.inc*3*r())
v1 = b.run(20,verbose=False ,whatif=d1)
v2 = b.run(20,verbose=False ,whatif=d2)
t1 = v1.T
t2 = v2.T
if 0.99*t1 <= t2 <= 1.01*t1:
if d2.inc - d1.inc > max:
max = t2 - t1
out = (d1,d2)
y += 1
say(" ",int(100*y/(x+1)))
elif t2 > t1:
print("\n>>",t1,t2,t2/t1)
for k,v in b.things().things.items():
if v.touch:
print(k,d1[k],d2[k])
else:
print("!!",t2/t1)
d1,d2 = out
print("")
for k,v in b.things().things.items():
if v.touch:
print(k,d1[k],d2[k])
print("done!",now())
| 20.739583 | 71 | 0.56002 | 359 | 1,991 | 3.075209 | 0.350975 | 0.022645 | 0.007246 | 0.027174 | 0.163043 | 0.163043 | 0.119565 | 0.081522 | 0.081522 | 0.081522 | 0 | 0.235372 | 0.244601 | 1,991 | 95 | 72 | 20.957895 | 0.49867 | 0.102963 | 0 | 0.123077 | 0 | 0 | 0.01107 | 0 | 0 | 0 | 0 | 0 | 0.061538 | 1 | 0.092308 | false | 0 | 0.030769 | 0 | 0.138462 | 0.123077 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d8d83bcade61f8cc9866d368b192e1b85e86d4f4 | 495 | py | Python | LeetCode/LeetCode_Python-master/LeetCode_Python-master/Algorithm-Medium/template.py | Sycamore-City-passerby/ML | 605cfc70bdda2c99e5f1c16b25812b59c98a72ad | [
"MIT"
] | null | null | null | LeetCode/LeetCode_Python-master/LeetCode_Python-master/Algorithm-Medium/template.py | Sycamore-City-passerby/ML | 605cfc70bdda2c99e5f1c16b25812b59c98a72ad | [
"MIT"
] | null | null | null | LeetCode/LeetCode_Python-master/LeetCode_Python-master/Algorithm-Medium/template.py | Sycamore-City-passerby/ML | 605cfc70bdda2c99e5f1c16b25812b59c98a72ad | [
"MIT"
] | null | null | null | """
Time Complexity = O(log(N))
Space Complexity = O(1)
Implement int sqrt(int x).
Compute and return the square root of x, where x is guaranteed to be a non-negative integer.
Since the return type is an integer, the decimal digits are truncated and only the integer part
of the result is returned.
Example:
Input: 8
Output: 2
Explanation: The square root of 8 is 2.82842..., and since
the decimal part is truncated, 2 is returned.
"""
| 30.9375 | 99 | 0.660606 | 78 | 495 | 4.192308 | 0.576923 | 0.067278 | 0.079511 | 0.091743 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.030556 | 0.272727 | 495 | 15 | 100 | 33 | 0.877778 | 0.892929 | 0 | null | 0 | null | 0 | 0 | null | 0 | 0 | 0 | null | 1 | null | true | 0 | 0 | null | null | null | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d8dcc1a8543ac67aa55c99a59bd7458034752d1e | 359 | py | Python | python_toy_package/python_toy_package.py | marvinmin/python_toy_package | 120d1863cbfd9b0e677da286f5ebae5d7bc2b45d | [
"MIT"
] | null | null | null | python_toy_package/python_toy_package.py | marvinmin/python_toy_package | 120d1863cbfd9b0e677da286f5ebae5d7bc2b45d | [
"MIT"
] | null | null | null | python_toy_package/python_toy_package.py | marvinmin/python_toy_package | 120d1863cbfd9b0e677da286f5ebae5d7bc2b45d | [
"MIT"
] | null | null | null | import numpy as np
def sqsum(a):
"""
Calculate the squared sum of a list
Parameters
----------
a: list
the list of numbers to be calculated
Return
------
float
the squared sum
Examples
--------
>>> a = [1, 2, 3]
>>> sqsum(a)
14
"""
a = np.array(a)
return np.sum(a**2)
| 14.958333 | 44 | 0.456825 | 46 | 359 | 3.565217 | 0.565217 | 0.073171 | 0.158537 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.027273 | 0.387187 | 359 | 23 | 45 | 15.608696 | 0.718182 | 0.559889 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | false | 0 | 0.25 | 0 | 0.75 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
d8dd7ab9f8022a1d5d19b99b9dcacfc83e2b21d8 | 5,254 | py | Python | src/somewhat_homomorphic_keygen.py | UMComp4140ATeam/Raymond | 2ccff4d15835ab386d3e25b2bb3a7ed03feffe81 | [
"MIT"
] | 1 | 2015-10-04T16:19:16.000Z | 2015-10-04T16:19:16.000Z | src/somewhat_homomorphic_keygen.py | UMComp4140ATeam/Raymond | 2ccff4d15835ab386d3e25b2bb3a7ed03feffe81 | [
"MIT"
] | null | null | null | src/somewhat_homomorphic_keygen.py | UMComp4140ATeam/Raymond | 2ccff4d15835ab386d3e25b2bb3a7ed03feffe81 | [
"MIT"
] | null | null | null | #!/bin/python
import logging
import math
import numpy
import simple_error_distribution
import rvg
'''
Generates the secret keys, the evaluation key, and the public key that will be used in the homomorphic encryption scheme.
'''
class SomewhatHomomorphicKeygen(object):
def __init__(self, dimension, multiplicative_depth, odd_modulus, matrix_rows, seed=1, log=logging.getLogger(__name__)):
self.__dimension = dimension
self.__multiplicative_depth = multiplicative_depth
self.__odd_modulus = odd_modulus
self.__matrix_rows = matrix_rows
self.__error_distribution = simple_error_distribution.SimpleErrorDistribution(odd_modulus, seed)
self.__random_vector_generator = rvg.RVG(dimension, odd_modulus, seed)
self.__log = log
def set_error_distribution(self, new_error_distribution):
self.__error_distribution = new_error_distribution
def set_random_vector_generator(self, new_random_vector_generator):
self.__random_vector_generator = new_random_vector_generator
def generate_keys(self):
secret_keys = self.__generate_secret_key()
evaluation_key = self.__generate_evaluation_key(secret_keys)
public_key = self.__generate_public_key(secret_keys)
return secret_keys[-1], evaluation_key, public_key
def __generate_secret_key(self):
self.__log.info("Generating Secret Keys")
keys = [key for key in self.__random_vector_generator.generate(self.__multiplicative_depth + 1)]
self.__log.debug("Generated secrect keys: {keys}".format(keys=keys))
return keys
def __generate_evaluation_key(self, secret_keys):
self.__log.info("Generating Evaluation Key")
evaluation_key = {}
# Assume that 0 is not included because the b component of the tuple is calculated using curr_depth - 1
for curr_depth in range(1, self.__multiplicative_depth+1):
for j in range(self.__dimension+1):
for i in range(j + 1):
tau = 0
for coefficient_vector in self.__random_vector_generator.generate(int(math.log(self.__odd_modulus, 2)) + 1):
self.__log.debug("Generating Evaluation Key for level={level} i={i} j={j} tau={tau}".format(level=curr_depth, i=i, j=j, tau=tau))
self.__log.debug("Vector Generated = {vector}".format(vector=coefficient_vector))
error = self.__error_distribution.sample_distribution()
self.__log.debug("Error Generated = {error}".format(error=error))
# Artifacts of the notations used, see start of section 2 of the paper right near the top of page 9. Don't ask me why this is used
# it is incredibly confusing.
# Note: These 1 values are also not used in the inner product
si = 1
if i != 0:
si = secret_keys[curr_depth-1][i-1]
sj = 1
if j != 0:
sj = secret_keys[curr_depth-1][j-1]
self.__log.debug("Calculating b. Inputs: cvector={cvector}, skey={skey}, error={error}, tau={tau}, si={si}, sj={sj}".format(cvector=coefficient_vector, skey=secret_keys[curr_depth], error=error, tau=tau, si=si, sj=sj))
b = (coefficient_vector.dot(secret_keys[curr_depth]) + 2 * error + 2**tau * si * sj) % self.__odd_modulus
# For now I will leave this as a list of tuples, may need to exchange for a dictionary indexed by the tuple (curr_depth, i, j, tau). Also
# because numpy is stupid and doesn't properly implement == we have to covert the coefficient_vector to a list
evaluation_key[(curr_depth, i, j, tau)] = (coefficient_vector, b)
self.__log.debug("Evaluation Key Entry={entry}".format(entry=(coefficient_vector, b)))
tau += 1
return evaluation_key
def __generate_public_key(self, secret_keys):
self.__log.info("Generating Public Key")
coefficient_vectors = []
for vector in self.__random_vector_generator.generate(self.__matrix_rows):
coefficient_vectors.append(vector)
coefficient_matrix = numpy.matrix(coefficient_vectors)
self.__log.debug("Coefficient Matrix={matrix}".format(matrix=coefficient_matrix))
errors = []
for i in range(self.__matrix_rows):
errors.append(self.__error_distribution.sample_distribution())
errors_matrix = numpy.matrix(errors).transpose()
self.__log.debug("Errors={errors}".format(errors=errors_matrix))
secret_key_vector = numpy.matrix(secret_keys[0]).transpose()
b = numpy.mod(coefficient_matrix.dot(secret_key_vector) + 2 * errors_matrix, self.__odd_modulus)
self.__log.debug("B={b}".format(b=b))
return coefficient_matrix, b
if __name__=="__main__":
print "SomewhatHomomorphicKeygen Class" | 55.305263 | 242 | 0.633422 | 637 | 5,254 | 4.894819 | 0.22606 | 0.041693 | 0.034638 | 0.04009 | 0.133098 | 0.086273 | 0.079859 | 0.039769 | 0 | 0 | 0 | 0.007376 | 0.277503 | 5,254 | 95 | 243 | 55.305263 | 0.814015 | 0.109821 | 0 | 0 | 1 | 0.014286 | 0.093791 | 0.005504 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0 | 0.071429 | null | null | 0.014286 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
d8e13d9c5c95870299301b3d6907a824b8905ba2 | 782 | py | Python | tests/ibmi/blackrock/test_remote_recording_control.py | sgowda/brain-python-interface | 708e2a5229d0496a8ce9de32bda66f0925d366d9 | [
"Apache-2.0"
] | 7 | 2015-08-25T00:28:49.000Z | 2020-04-14T22:58:51.000Z | tests/ibmi/blackrock/test_remote_recording_control.py | sgowda/brain-python-interface | 708e2a5229d0496a8ce9de32bda66f0925d366d9 | [
"Apache-2.0"
] | 89 | 2020-08-03T16:54:08.000Z | 2022-03-09T19:56:19.000Z | tests/ibmi/blackrock/test_remote_recording_control.py | sgowda/brain-python-interface | 708e2a5229d0496a8ce9de32bda66f0925d366d9 | [
"Apache-2.0"
] | 4 | 2020-03-06T15:39:00.000Z | 2021-05-26T17:03:21.000Z | import comedi
import time
com = comedi.comedi_open("/dev/comedi0")
# start (or resume) recording
print('starting recording')
# set strobe pin low
comedi.comedi_dio_bitfield2(com, 0, 1, 0, 16)
# set last data pin ("D15"; 16th pin) high
comedi.comedi_dio_bitfield2(com, 0, 1, 1, 15)
# set strobe pin high
comedi.comedi_dio_bitfield2(com, 0, 1, 1, 16)
# set strobe pin low
comedi.comedi_dio_bitfield2(com, 0, 1, 0, 16)
print('waiting for 5 seconds...')
time.sleep(5)
# stop recording
print('stopping recording')
# strobe pin should already be low
# set last data pin ("D15"; 16th pin) low
comedi.comedi_dio_bitfield2(com, 0, 1, 0, 15)
# set strobe pin high
comedi.comedi_dio_bitfield2(com, 0, 1, 1, 16)
# set strobe pin low
comedi.comedi_dio_bitfield2(com, 0, 1, 0, 16)
| 19.55 | 45 | 0.717391 | 135 | 782 | 4.044444 | 0.281481 | 0.175824 | 0.192308 | 0.307692 | 0.652015 | 0.652015 | 0.652015 | 0.575092 | 0.575092 | 0.575092 | 0 | 0.080547 | 0.158568 | 782 | 39 | 46 | 20.051282 | 0.74924 | 0.323529 | 0 | 0.357143 | 0 | 0 | 0.139535 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.142857 | 0 | 0.142857 | 0.214286 | 0 | 0 | 0 | null | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2b05d2bf6c81bbfb7364b65661bcc20fefe0058d | 414 | py | Python | ipython-7.29.0/docs/sphinxext/configtraits.py | JohnLauFoo/clc_packages_Yu | 259f01d9b5c02154ce258734d519ae8995cd0991 | [
"MIT"
] | 1 | 2021-11-13T17:21:44.000Z | 2021-11-13T17:21:44.000Z | ipython-7.29.0/docs/sphinxext/configtraits.py | JohnLauFoo/clc_packages_Yu | 259f01d9b5c02154ce258734d519ae8995cd0991 | [
"MIT"
] | null | null | null | ipython-7.29.0/docs/sphinxext/configtraits.py | JohnLauFoo/clc_packages_Yu | 259f01d9b5c02154ce258734d519ae8995cd0991 | [
"MIT"
] | null | null | null | """Directives and roles for documenting traitlets config options.
::
.. configtrait:: Application.log_datefmt
Description goes here.
Cross reference like this: :configtrait:`Application.log_datefmt`.
"""
def setup(app):
app.add_object_type('configtrait', 'configtrait', objname='Config option')
metadata = {'parallel_read_safe': True, 'parallel_write_safe': True}
return metadata
| 24.352941 | 78 | 0.719807 | 46 | 414 | 6.304348 | 0.73913 | 0.151724 | 0.172414 | 0.22069 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.166667 | 414 | 16 | 79 | 25.875 | 0.84058 | 0.521739 | 0 | 0 | 0 | 0 | 0.376963 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | false | 0 | 0 | 0 | 0.5 | 0 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2b1b328dfd77ce2fb3d05b965893466405aba2fe | 17,460 | py | Python | bundle/wsgi/pgwu_sgwu.py | MobileCloudNetworking/epcaas | aa1c4c032790a52617c50a40c22699b7de94edd3 | [
"Apache-2.0"
] | null | null | null | bundle/wsgi/pgwu_sgwu.py | MobileCloudNetworking/epcaas | aa1c4c032790a52617c50a40c22699b7de94edd3 | [
"Apache-2.0"
] | null | null | null | bundle/wsgi/pgwu_sgwu.py | MobileCloudNetworking/epcaas | aa1c4c032790a52617c50a40c22699b7de94edd3 | [
"Apache-2.0"
] | null | null | null | # Copyright (c) 2014, Telecom Italia SpA
"""
Service Orchestrator for OpenEPC.
MCN 2014
"""
__author__ = 'sruffino'
import json
import os
import requests
from interfaces.ServiceAdapter import ServiceAdapter as ABCServiceAdapter
class PgwuSgwuAdapter(ABCServiceAdapter):
def __init__(self, conf_proxy):
"""
Initializes a new ServiceAdapter.
:return:
"""
# -------------------------------------------------------#
# Parameters for preinit/install
# -------------------------------------------------------#
self.PGWU_SGWU_ID="3812090105" # (e.g.: 3812090105 ) The unit id generated by orchestrator (or whatever ID generated by you )
self.OFP_DATAPATH_ID="3812090105000000" # (e.g.: $PGWU_SGWU_ID000000) unit id with appended zeros to match length for datapath_id
self.UPLOAD_FLOATING_NETWORK_CIDR="193.55.112.80" # (e.g.: 192.168.95.0/24 ) Example from the wall
self.PGWU_SGWU_NET_A_IP="4.4.4.10"
self.PGWU_SGWU_NET_B_IP=""
self.PGWU_SGWU_NET_MGMT_IP="3.3.3.10"
self.PGWU_SGWU_NET_D_IP="5.5.5.10"
self.ZABBIX_IP="9.9.9.9"
self.PGW_U_Upload_Interface_IP=self.PGWU_SGWU_NET_B_IP
self.PGW_U_Download_Interface_IP=self.PGWU_SGWU_NET_A_IP
# -------------------------------------------------------#
# Paramters for gw relation
# -------------------------------------------------------#
self.GW_NET_A_IP="4.4.4.3"
self.PGWU_NET_A_IP_ENDING_NUMBER="10" # The last number from the net_a IP of the pgwu-sgwu
self.GW_NET_A_IP_ENDING_NUMBER="3" # The last number from the net_a IP of the gw
self.VIRT_NET_A_IP="192.168.77." + self.PGWU_NET_A_IP_ENDING_NUMBER # e.g. 192.168.77.210 when pgwu-sgwu got 172.30.5.210
self.VIRT_NET_A_GW_IP="192.168.77" + self.GW_NET_A_IP_ENDING_NUMBER # e.g. 192.168.77.204 when gw got 172.20.5.204
# -------------------------------------------------------#
# Paramters for pgw_c relation
# -------------------------------------------------------#
self.PGW_C_Openflow_Transport_Protocol="tcp"
self.PGW_C_Openflow_IP="3.3.3.30" # The MGMT_IP of pgw_c
self.PGW_C_OpenFlow_Port="6634"
# -------------------------------------------------------#
# Configuration proxy
self.proxies = {
"http": "http://" + conf_proxy + ":3128",
"https": "http://" + conf_proxy + ":3128"
}
def preinit(self, config):
"""
sends the preinit method based on the received config parameters
curl -X POST -H "Content-Type:application/json" -d \
"{\"parameters\":[\"net_d=$PGWU_SGWU_NET_D_IP,mgmt=$PGWU_SGWU_NET_MGMT_IP,\
net_a=$PGWU_SGWU_NET_A_IP\",\
\"$ZABBIX_IP\"]}" http://$NAT_PUBLIC_IP:8390/pgw_u-sgw_u-5G/preinit
:param config:
:return:
"""
parameters = []
networks = ""
for net_name, net_ip in config['ips'].items():
networks = networks + ("%s=%s;"%(net_name,net_ip))
parameters.append(networks)
parameters.append(config['zabbix_ip'])
request = {"parameters":parameters}
print "I'm the pgwu-sgwu adapter, preinit pgwu-sgwu service, \
parameters %s, request %s" %(parameters,str(json.dumps(request)))
url = 'http://' + config['floating_ips'].get('mgmt') + \
':8390/pgw_u-sgw_u-5G/preinit'
headers = {'content-type': 'application/json'}
response = requests.post(url, data=json.dumps(request),
headers=headers, proxies=self.proxies)
print response.content
print "I'm the pgwu-sgwu adapter, preinit pgwu-sgwu services, \
received resp %s" %response
return True
def install(self, config):
"""
Creates a new Service based on the config file.
curl -X POST -H "Content-Type:application/json" -d \
"{\"parameters\":[\"PGW-U-$PGWU_SGWU_ID\",\"$PGWU_SGWU_NET_MGMT_IP\",\
\"$PGW_U_Upload_Interface_IP\",\"$PGW_U_Download_Interface_IP\",\
\"$OFP_DATAPATH_ID\",\"true\",\"$UPLOAD_FLOATING_NETWORK_CIDR\"]}" \
http://127.0.0.1:8390/pgw_u-sgw_u-5G/install
:params config:
:return:
"""
exp_params = ['PGWU_SGWU_ID', 'PGWU_SGWU_NET_MGMT_IP', 'PGW_U_Upload_Interface_IP',
'PGW_U_Download_Interface_IP', 'OFP_DATAPATH_ID',
'UPLOAD_FLOATING_NETWORK_CIDR']
# pgwu-sgwu
for v in exp_params:
if v not in config:
print "PGWU-SGWU adapter - install _ missing parameter: " + v
return False
parameters = []
parameters.append('PGW-U-' + config['PGWU_SGWU_ID'])
parameters.append(config['PGWU_SGWU_NET_MGMT_IP'])
parameters.append(config['PGW_U_Upload_Interface_IP'])
parameters.append(config['PGW_U_Download_Interface_IP'])
parameters.append(config['OFP_DATAPATH_ID'])
parameters.append('true')
parameters.append(config['UPLOAD_FLOATING_NETWORK_CIDR'])
# create request nat
request = {"parameters":parameters}
print "I'm the pgwu-sgwu adapter, install pgwu-sgwu service, parameters %s" %(parameters)
url = 'http://' + config['floating_ips'].get('mgmt') + \
':8390/pgw_u-sgw_u-5G/install'
headers = {'content-type': 'application/json'}
response = requests.post(url, data=json.dumps(request),
headers=headers, proxies=self.proxies)
print response.content
print "I'm the pgwu-sgwu adapter, installing pgwu-sgwu service, received resp %s" %response
return True
def pre_start(self, config):
"""
Pre-start method
curl -X POST -H "Content-Type:application/json" -d \
"{\"parameters\":[\"PGW-U-$PGWU_SGWU_ID\",\"$PGWU_SGWU_NET_MGMT_IP\",\
\"$PGW_U_Upload_Interface_IP\",\"$PGW_U_Download_Interface_IP\",\
\"$OFP_DATAPATH_ID\",\"$PGW_C_Openflow_IP\",\"$PGW_C_OpenFlow_Port\"]}" \
http://127.0.0.1:8390/pgw_u-sgw_u-5G/preStart
:param config:
:return:
"""
exp_params = ['PGWU_SGWU_ID', 'PGWU_SGWU_NET_MGMT_IP', 'PGW_U_Upload_Interface_IP',
'PGW_U_Download_Interface_IP', 'OFP_DATAPATH_ID', 'PGW_C_Openflow_IP',
'PGW_C_OpenFlow_Port']
# pgwu-sgwu
for v in exp_params:
if v not in config:
print "PGWU-SGWU adapter - preStart _ missing parameter: " + v
return False
parameters = []
parameters.append('PGW-U-' + config['PGWU_SGWU_ID'])
parameters.append(config['PGWU_SGWU_NET_MGMT_IP'])
parameters.append(config['PGW_U_Upload_Interface_IP'])
parameters.append(config['PGW_U_Download_Interface_IP'])
parameters.append(config['OFP_DATAPATH_ID'])
parameters.append(config['PGW_C_Openflow_IP'])
parameters.append(config['PGW_C_OpenFlow_Port'])
# create request nat
request = {"parameters":parameters}
print "I'm the pgwu-sgwu adapter, preStart pgwu-sgwu service, parameters %s" %(parameters)
url = 'http://' + config['floating_ips'].get('mgmt') + \
':8390/pgw_u-sgw_u-5G/preStart'
headers = {'content-type': 'application/json'}
response = requests.post(url, data=json.dumps(request),
headers=headers, proxies=self.proxies)
print response.content
print "I'm the pgwu-sgwu adapter, preStarting pgwu-sgwu service, received resp %s" %response
return True
def add_dependency(self, config, ext_service):
"""
Add the dependency between this service and the external one
curl -X POST -H "Content-Type:application/json" -d \
"{\"parameters\":[\"$PGWU_SGWU_NET_A_IP\",\"$GW_NET_A_IP\", \
\"$VIRT_NET_A_IP\",\"$VIRT_NET_A_GW_IP\"]}" \
http://127.0.0.1:8390/pgw_u-sgw_u-5G/addRelation/gw
curl -X POST -H "Content-Type:application/json" -d \
"{\"parameters\":[\"$PGW_C_Openflow_Transport_Protocol\",\
\"$PGW_C_Openflow_IP\",\"$PGW_C_OpenFlow_Port\"]}" \
http://127.0.0.1:8390/pgw_u-sgw_u-5G/addRelation/pgw_c
:return:
"""
exp_params_gw = ['PGWU_SGWU_NET_A_IP', 'GW_NET_A_IP', 'VIRT_NET_A_IP',
'VIRT_NET_A_GW_IP']
exp_params_pgw_c = ['PGW_C_Openflow_Transport_Protocol', 'PGW_C_Openflow_IP',
'PGW_C_OpenFlow_Port']
parameters = []
if ext_service == 'gw':
for v in exp_params_gw:
if v not in config:
print "PGWU-SGWU adapter - add_relation _ missing parameter: " + v
return False
# parameters require a specific order
parameters.append(config['PGWU_SGWU_NET_A_IP'])
parameters.append(config['GW_NET_A_IP'])
parameters.append(config['VIRT_NET_A_IP'])
parameters.append(config['VIRT_NET_A_GW_IP'])
elif ext_service == 'pgw_c':
for v in exp_params_pgw_c:
if v not in config:
print "PGWU-SGWU adapter - add_relation _ missing parameter: " + v
return False
# parameters require a specific order
parameters.append(config['PGW_C_Openflow_Transport_Protocol'])
parameters.append(config['PGW_C_Openflow_IP'])
parameters.append(config['PGW_C_OpenFlow_Port'])
else:
print ("PGWU-SGWU adapter - wrong ext_service")
request = {"parameters":parameters}
print "I'm the pgwu-sgwu adapter, adding " + ext_service + " relation to pgwu-sgwu service, parameters %s" %(parameters)
url = 'http://' + config['floating_ips'].get('mgmt')+ \
':8390/pgw_u-sgw_u-5G/addRelation/' + ext_service
headers = {'content-type': 'application/json'}
response = requests.post(url, data=json.dumps(request),
headers=headers, proxies=self.proxies)
print response.content
print "I'm the pgwu-sgwu adapter, adding " + ext_service + " relation to pgwu-sgwu service, received resp %s" %response
return True
def remove_dependency(self, config, ext_service=None):
"""
Remove the dependency between this service and the external one
1) For the switch you need to call the relation departed script to the nat :
curl -X POST -H "Content-Type:application/json" -d
"{\"parameters\":[\"$PGWU_SGWU_NET_A_IP\"]}"
http://127.0.0.1:8390/pgw_u-sgw_u-5G/removeRelation/gw
:return:
"""
exp_params = ['PGWU_SGWU_NET_A_IP']
for v in exp_params:
if v not in config:
print "PGWU-SGWU adapter - " \
"remove_dependency _ missing parameter: " + v
return False
parameters = []
parameters.append(config['PGWU_SGWU_NET_A_IP'])
request = {"parameters": parameters}
print "I'm the pgwu-sgwu adapter, " \
"remove_dependency pgwu-sgwu service, parameters %s" % parameters
url = 'http://' + config['floating_ips'].get('mgmt') + \
':8390/pgw_u-sgw_u-5G/removeRelation/gw'
headers = {'content-type': 'application/json'}
response = requests.post(url, data=json.dumps(request),
headers=headers, proxies=self.proxies)
print response.content
print "I'm the pgwu-sgwu adapter, " \
"remove_dependency pgwu-sgwu service, received resp %s" % response
return True
def start(self, config):
"""
Sending start requests to the different components
curl -X POST -H "Content-Type:application/json" \
-d "{\"parameters\":[]}" http://$NAT_PUBLIC_IP:8390/gw/start
:return:
"""
parameters = []
request = {"parameters":parameters}
print "I'm the pgwu-sgwu adapter, adding pgwu relation to pgwu-sgwu service, parameters %s" %(parameters)
url = 'http://' + config['floating_ips'].get('mgmt') + ':8390/pgw_u-sgw_u-5G/start'
headers = {'content-type': 'application/json'}
response = requests.post(url, data=json.dumps(request),
headers=headers, proxies=self.proxies)
print response.content
print "I'm the pgwu-sgwu adapter, adding pgwu relation to pgwu-sgwu service, received resp %s" %response
return True
def terminate(self):
"""
Terminate the service
:return:
"""
pass
if __name__ == '__main__':
from utils import *
from globals import *
# set http_proxy to epc-proxy VM
# since we use the proxy, no floating_ip needed
conf_proxy = 'FILLME FOR TESTING'
#os.environ['http_proxy']='http://130.92.70.187:3128'
c = PgwuSgwuAdapter(conf_proxy)
# NOTE NOTE: out must be filled with heat output string
out = 'FILL ME FOR TESTING'
nat_ip = get_ips(out, 'mcn.endpoint.nat')
nat_ip_net_a = get_ips(out, 'nat.net_a.ip')
pgwu1_ip = get_ips(out, 'mcn.endpoint.pgwu-sgwu-1')
pgwu1_ip_net_a = get_ips(out, 'pgwu-sgwu-1.net_a.ip')
mme_ip = get_ips(out, 'mcn.endpoint.mme-pgwc-sgwc')
mme_ip_net_d = get_ips(out, 'mme-pgwc-sgwc.net_d.ip')
pgwu1_ip_net_d = get_ips(out, 'pgwu-sgwu-1.net_d.ip')
#pgwu1_ip = '192.168.85.95'
# preinit
config = {}
config['hostname'] = PGW1_VM_NAME
# config['ips'] = {'mgmt': '192.168.85.95', 'net_a': '172.19.5.95',
# 'net_d': '172.19.8.95'}
config['ips'] = {'mgmt': pgwu1_ip, 'net_a': pgwu1_ip_net_a,
'net_d': pgwu1_ip_net_d}
config['zabbix_ip'] = '192.168.85.145'
config['floating_ips'] = {'mgmt': pgwu1_ip}
c.preinit(config)
# install
config = {}
# config = {'OFP_DATAPATH_ID': '3812090105000000',
# 'PGWU_SGWU_ID': '3812090105',
# 'PGWU_SGWU_NET_MGMT_IP': '192.168.85.95',
# 'PGW_U_Download_Interface_IP': '172.19.5.95', #net_a
# 'PGW_U_Upload_Interface_IP': '172.19.8.95', # net_d
# 'UPLOAD_FLOATING_NETWORK_CIDR': '130.92.70.128/25'} #floating ip subnet cidr
config = {'OFP_DATAPATH_ID': '3812090105000000',
'PGWU_SGWU_ID': '3812090105',
'PGWU_SGWU_NET_MGMT_IP': pgwu1_ip,
'PGW_U_Download_Interface_IP': pgwu1_ip_net_a, #net_a
'PGW_U_Upload_Interface_IP': pgwu1_ip_net_d, # net_d
'UPLOAD_FLOATING_NETWORK_CIDR': '130.92.70.128/25'} #floating ip subnet cidr
config['floating_ips'] = {'mgmt': pgwu1_ip}
c.install(config)
# add dependency to gw(nat)
config = {}
config = {
'PGWU_SGWU_NET_A_IP': pgwu1_ip_net_a,
'GW_NET_A_IP': nat_ip_net_a,
# The last number from the net_a IP of the pgwu-sgwu
'PGWU_NET_A_IP_ENDING_NUMBER': pgwu1_ip.split('.')[3],
# The last number from the net_a IP of the gw
'GW_NET_A_IP_ENDING_NUMBER': nat_ip_net_a.split('.')[3]
}
# config = {
# 'PGWU_SGWU_NET_A_IP': '172.19.5.95',
# 'GW_NET_A_IP':'172.19.5.96',
# 'PGWU_NET_A_IP_ENDING_NUMBER':'95',
# 'GW_NET_A_IP_ENDING_NUMBER':'96'
# }
config['VIRT_NET_A_IP'] = '192.168.77.' + config['PGWU_NET_A_IP_ENDING_NUMBER'] # e.g. 192.168.77.210 when pgwu-sgwu got 172.30.5.210
config['VIRT_NET_A_GW_IP'] = '192.168.77.' + config['GW_NET_A_IP_ENDING_NUMBER'] # e.g. 192.168.77.204 when gw got 172.20.5.204
config['floating_ips'] = {'mgmt': pgwu1_ip}
c.add_dependency(config, 'gw')
# add dependency to pgw_c
config = {}
config = {
'PGW_C_Openflow_Transport_Protocol':'tcp',
#'PGW_C_Openflow_IP': '192.168.85.97', # The MGMT_IP of mme
'PGW_C_Openflow_IP': mme_ip, # The MGMT_IP of mme
'PGW_C_OpenFlow_Port':'6634'
}
config['floating_ips'] = {'mgmt': pgwu1_ip}
c.add_dependency(config, 'pgw_c')
# prestart
config = {}
# config = {
# 'PGWU_SGWU_ID': '3812090105',
# 'PGWU_SGWU_NET_MGMT_IP': '192.168.85.95',
# 'PGW_U_Download_Interface_IP': '172.19.5.95', #net_a
# 'PGW_U_Upload_Interface_IP': '172.19.8.95', # net_d
# 'OFP_DATAPATH_ID': '3812090105000000',
# 'PGW_C_Openflow_IP':'192.168.85.97', # The MGMT_IP of mme
# 'PGW_C_OpenFlow_Port':'6634'
# }
config = {
'PGWU_SGWU_ID': '3812090105',
'PGWU_SGWU_NET_MGMT_IP': pgwu1_ip,
'PGW_U_Download_Interface_IP': pgwu1_ip_net_a, #net_a
'PGW_U_Upload_Interface_IP': pgwu1_ip_net_d, # net_d
'OFP_DATAPATH_ID': '3812090105000000',
'PGW_C_Openflow_IP': mme_ip, # The MGMT_IP of mme
'PGW_C_OpenFlow_Port':'6634'
}
config['floating_ips'] = {'mgmt': pgwu1_ip}
c.pre_start(config)
config = {}
config['floating_ips'] = {'mgmt': pgwu1_ip}
c.start(config)
| 41.374408 | 138 | 0.585223 | 2,266 | 17,460 | 4.219771 | 0.109885 | 0.065258 | 0.023844 | 0.035348 | 0.761556 | 0.717319 | 0.670153 | 0.632085 | 0.615562 | 0.59841 | 0 | 0.050133 | 0.267698 | 17,460 | 421 | 139 | 41.472684 | 0.697716 | 0.150115 | 0 | 0.478448 | 0 | 0.008621 | 0.305677 | 0.083826 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0.00431 | 0.025862 | null | null | 0.103448 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2b1d8d896f28182ee81f486f437c6eeed50e60d4 | 635 | py | Python | design-patterns/structural/interpreter.py | verthais/exercise-python | d989647e8fbfe8a79b9b5f2c3ab003715d238851 | [
"MIT"
] | null | null | null | design-patterns/structural/interpreter.py | verthais/exercise-python | d989647e8fbfe8a79b9b5f2c3ab003715d238851 | [
"MIT"
] | null | null | null | design-patterns/structural/interpreter.py | verthais/exercise-python | d989647e8fbfe8a79b9b5f2c3ab003715d238851 | [
"MIT"
] | null | null | null | from abc import abstractmethod
class AbstractExpression():
@abstractmethod
def interpret(self):
pass
class NonterminalExpression(AbstractExpression):
def __init__(self, expression):
self._expression = expression
def interpret(self):
print("Non-terminal expression being interpreted ...")
self._expression.interpret()
class TerminalExpression(AbstractExpression):
def interpret(self):
print("Terminal expression being interpreted ...")
def main():
ast = NonterminalExpression(NonterminalExpression(TerminalExpression()))
ast.interpret()
if __name__ == "__main__":
main()
| 18.676471 | 74 | 0.724409 | 56 | 635 | 7.964286 | 0.410714 | 0.080717 | 0.107623 | 0.09417 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.174803 | 635 | 33 | 75 | 19.242424 | 0.851145 | 0 | 0 | 0.157895 | 0 | 0 | 0.156146 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.263158 | false | 0.052632 | 0.052632 | 0 | 0.473684 | 0.105263 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
2b2f4de3511c7585c7d5f1527811e554f700b9b7 | 406 | py | Python | assets/tuned/daemon/tuned/profiles/functions/function_strip.py | sjug/cluster-node-tuning-operator | 8654d1c9558d0d5ef03d14373c877ebc737f9736 | [
"Apache-2.0"
] | 53 | 2018-11-13T07:02:03.000Z | 2022-03-25T00:00:04.000Z | assets/tuned/daemon/tuned/profiles/functions/function_strip.py | sjug/cluster-node-tuning-operator | 8654d1c9558d0d5ef03d14373c877ebc737f9736 | [
"Apache-2.0"
] | 324 | 2018-10-02T14:18:54.000Z | 2022-03-31T23:47:33.000Z | assets/tuned/daemon/tuned/profiles/functions/function_strip.py | sjug/cluster-node-tuning-operator | 8654d1c9558d0d5ef03d14373c877ebc737f9736 | [
"Apache-2.0"
] | 54 | 2018-10-01T16:55:09.000Z | 2022-03-28T13:56:53.000Z | import os
import tuned.logs
from . import base
from tuned.utils.commands import commands
class strip(base.Function):
"""
Makes string from all arguments and strip it
"""
def __init__(self):
# unlimited number of arguments, min 1 argument
super(strip, self).__init__("strip", 0, 1)
def execute(self, args):
if not super(strip, self).execute(args):
return None
return "".join(args).strip()
| 22.555556 | 49 | 0.716749 | 60 | 406 | 4.716667 | 0.583333 | 0.070671 | 0.09894 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.00885 | 0.165025 | 406 | 17 | 50 | 23.882353 | 0.825959 | 0.224138 | 0 | 0 | 0 | 0 | 0.016393 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.181818 | false | 0 | 0.363636 | 0 | 0.818182 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 2 |
2b6022c13c162252331410ea5e544abccc9ad01f | 667 | py | Python | python-questions-for-pratices/Question-38.py | siddharth-143/Python | 293f4643a3a13e3b82d23fd8922db54dbb0f12bc | [
"MIT"
] | null | null | null | python-questions-for-pratices/Question-38.py | siddharth-143/Python | 293f4643a3a13e3b82d23fd8922db54dbb0f12bc | [
"MIT"
] | null | null | null | python-questions-for-pratices/Question-38.py | siddharth-143/Python | 293f4643a3a13e3b82d23fd8922db54dbb0f12bc | [
"MIT"
] | null | null | null | """
Question 38 :
Define a function which can generated a list where the values
are square of numbers between 1 and 20 (both included). Then the
function need to print the last 5 elements in the list.
Hints : Use ** operator to get power of a number. Use range()
for loop. Use list.append() to add values into a list. Use
[n1:n2] to slice a list.
"""
# Solution :
num = int(input("Enter a number : "))
def print_value():
l = list()
for i in range(1, num + 1):
l.append(i**2)
print(l[-5:])
print_value()
"""
Output :
Enter a number : 20
[256, 289, 324, 361, 400]
Process finished with exit code 0
""" | 22.233333 | 68 | 0.61919 | 109 | 667 | 3.770642 | 0.614679 | 0.036496 | 0.058394 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.061602 | 0.269865 | 667 | 30 | 69 | 22.233333 | 0.782341 | 0.568216 | 0 | 0 | 1 | 0 | 0.10241 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.142857 | false | 0 | 0 | 0 | 0.142857 | 0.428571 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 2 |
2b648cb256dde1fafc7ef4a4dd375245fc375688 | 2,272 | py | Python | utils/labels.py | Saaaber/urban-segmentation | fc893feb9208d3206d7c5329b1ccf4cfab97ed31 | [
"MIT"
] | 3 | 2020-11-16T20:21:25.000Z | 2021-06-11T13:09:30.000Z | utils/labels.py | Saaaber/urban-segmentation | fc893feb9208d3206d7c5329b1ccf4cfab97ed31 | [
"MIT"
] | null | null | null | utils/labels.py | Saaaber/urban-segmentation | fc893feb9208d3206d7c5329b1ccf4cfab97ed31 | [
"MIT"
] | 3 | 2020-11-11T23:43:15.000Z | 2022-03-17T09:03:42.000Z | # Copyright (c) Ville de Montreal. All rights reserved.
# Licensed under the MIT license.
# See LICENSE file in the project root for full license information.
CITYSCAPE_LABELS = [
('unlabeled', 0, 0, 0, 0),
('ego vehicle', 1, 0, 0, 0),
('rectification border', 2, 0, 0, 0),
('out of roi', 3, 0, 0, 0),
('static', 4, 0, 0, 0),
('dynamic', 5, 111, 74, 0),
('ground', 6, 81, 0, 81),
('road', 7, 128, 64, 128),
('sidewalk', 8, 244, 35, 232),
('parking', 9, 250, 170, 160),
('rail track', 10, 230, 150, 140),
('building', 11, 70, 70, 70),
('wall', 12, 102, 102, 156),
('fence', 13, 190, 153, 153),
('guard rail', 14, 180, 165, 180),
('bridge', 15, 150, 100, 100),
('tunnel', 16, 150, 120, 90),
('pole', 17, 153, 153, 153),
('polegroup', 18, 153, 153, 153),
('traffic light', 19, 250, 170, 30),
('traffic sign', 20, 220, 220, 0),
('vegetation', 21, 107, 142, 35),
('terrain', 22, 152, 251, 152),
('sky', 23, 70, 130, 180),
('person', 24, 220, 20, 60),
('rider', 25, 255, 0, 0),
('car', 26, 0, 0, 142),
('truck', 27, 0, 0, 70),
('bus', 28, 0, 60, 100),
('caravan', 29, 0, 0, 90),
('trailer', 30, 0, 0, 110),
('train', 31, 0, 80, 100),
('motorcycle', 32, 0, 0, 230),
('bicycle', 33, 119, 11, 32),
('license plate', 34, 0, 0, 142)]
CARLA_LABELS = [
('void', 0, 0, 0, 0),
('building', 1, 70, 70, 70),
('fence', 2, 190, 153, 153),
('other', 3, 250, 170, 160),
('pedestrian', 4, 220, 20, 60),
('pole', 5, 153, 153, 153),
('road line', 6, 157, 234, 50),
('road', 7, 128, 64, 128),
('sidewalk', 8, 244, 35, 232),
('vegetation', 9, 107, 142, 35),
('car', 10, 0, 0, 142),
('wall', 11, 102, 102, 156),
('traffic sign', 12, 220, 220, 0)]
CGMU_LABELS = [
('void', 0, 0, 0, 0),
('pole', 1, 255, 189, 176),
('traffic sign', 2, 255, 181, 0),
('vehicle', 3, 247, 93, 195),
('vegetation', 4, 83, 145, 11),
('median strip', 5, 255, 236, 0),
('building', 6, 123, 0, 255),
('private', 7, 255, 0, 0),
('sidewalk', 8, 0, 205, 255),
('road', 9, 14, 0, 255),
('pedestrian', 10, 0, 255, 4),
('structure', 11, 134, 69, 15),
('construction', 12, 255, 99, 0)]
| 32 | 68 | 0.487236 | 348 | 2,272 | 3.172414 | 0.465517 | 0.047101 | 0.027174 | 0.01087 | 0.07971 | 0.07971 | 0.054348 | 0.054348 | 0.054348 | 0.054348 | 0 | 0.298624 | 0.264525 | 2,272 | 70 | 69 | 32.457143 | 0.362059 | 0.066901 | 0 | 0.09375 | 0 | 0 | 0.216919 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2b6b4c5cd7977ffb6f16236c51493108bc46a1c8 | 285 | py | Python | create_db.py | danuluma/andela-project | 4357948a9c9d3d1328f77dfb1bd9d6c79e458074 | [
"MIT"
] | null | null | null | create_db.py | danuluma/andela-project | 4357948a9c9d3d1328f77dfb1bd9d6c79e458074 | [
"MIT"
] | 19 | 2018-09-25T05:15:46.000Z | 2021-09-08T00:28:03.000Z | create_db.py | danuluma/andela-project | 4357948a9c9d3d1328f77dfb1bd9d6c79e458074 | [
"MIT"
] | 3 | 2018-09-26T20:35:08.000Z | 2018-10-05T07:13:19.000Z | import psycopg2
conn = psycopg2.connect(user='postgres', host='localhost', password='postgres')
cur = conn.cursor()
cur.execute("""CREATE DATABASE mafast1;""")
cur.execute("""CREATE DATABASE tfast;""")
conn.commit()
conn.close()
cur.close()
print("Congrats!! Danns database created")
| 25.909091 | 79 | 0.726316 | 35 | 285 | 5.914286 | 0.628571 | 0.096618 | 0.154589 | 0.231884 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.011494 | 0.084211 | 285 | 10 | 80 | 28.5 | 0.781609 | 0 | 0 | 0 | 0 | 0 | 0.364912 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0.111111 | 0.111111 | 0 | 0.111111 | 0.111111 | 0 | 0 | 0 | null | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 2 |
2b776210057b794534834e3bd49950d8f173cd5d | 90 | py | Python | mysticweb/__data.py | bentheiii/mystic | 04df023a07fc411367a3a8984f9da143596085f0 | [
"MIT"
] | null | null | null | mysticweb/__data.py | bentheiii/mystic | 04df023a07fc411367a3a8984f9da143596085f0 | [
"MIT"
] | null | null | null | mysticweb/__data.py | bentheiii/mystic | 04df023a07fc411367a3a8984f9da143596085f0 | [
"MIT"
] | null | null | null | __author__ = 'Ben Avrahami'
__version__ = '0.6.1'
__all__ = ['__author__', '__version__']
| 22.5 | 39 | 0.7 | 10 | 90 | 4.3 | 0.8 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.037975 | 0.122222 | 90 | 3 | 40 | 30 | 0.506329 | 0 | 0 | 0 | 0 | 0 | 0.422222 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
2b77bf1f5c09561afefa836926a3f170a220cec7 | 888 | py | Python | split.py | robertbyers1111/python | e87558f2432f0a4a86f17c47c6b19e1345625b83 | [
"MIT"
] | null | null | null | split.py | robertbyers1111/python | e87558f2432f0a4a86f17c47c6b19e1345625b83 | [
"MIT"
] | null | null | null | split.py | robertbyers1111/python | e87558f2432f0a4a86f17c47c6b19e1345625b83 | [
"MIT"
] | null | null | null | #msg1 = "0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdef"
msg = """ \r abcd \n efgh wxyz \n\n 0123abcd \naabcdd \r \n \r \n \r \n \r \n 4567\r\r\n"""
#------------------------------------------------------------------------------
# NOTES:
#
# 1. No args means split on whitespace (but it trims whitespace too)
#
# 2. The arg is one delimiter as a string, not a list of delimiter chars
#
# 3. To split and retain leading/trailing whitespace use re.split()
#
#------------------------------------------------------------------------------
print
print '--------- (see note 1)'
for line in msg.split('abcd'):
print 'line:',line
print
print '--------- (see note 2)'
for line in msg.split():
print 'line:',line
print
print '--------- (see note 3)'
import re
for line in re.split('\r|\n', msg):
print 'line:', line
| 20.181818 | 106 | 0.531532 | 108 | 888 | 4.37037 | 0.472222 | 0.025424 | 0.019068 | 0.025424 | 0.216102 | 0.144068 | 0.127119 | 0 | 0 | 0 | 0 | 0.100402 | 0.158784 | 888 | 43 | 107 | 20.651163 | 0.531459 | 0.531532 | 0 | 0.428571 | 0 | 0.071429 | 0.435644 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0 | 0.071429 | null | null | 0.642857 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 2 |
991657324e1bb0254e28fe202143c5292de16e44 | 646 | py | Python | basics/8_abstract_decorators.py | pavlovprojects/python_qa_oop | 587156bf14499e5e836904ebef37aa3db1933b45 | [
"MIT"
] | null | null | null | basics/8_abstract_decorators.py | pavlovprojects/python_qa_oop | 587156bf14499e5e836904ebef37aa3db1933b45 | [
"MIT"
] | null | null | null | basics/8_abstract_decorators.py | pavlovprojects/python_qa_oop | 587156bf14499e5e836904ebef37aa3db1933b45 | [
"MIT"
] | null | null | null | from abc import ABC, abstractmethod, abstractproperty
class Opener(ABC):
@property
@abstractmethod
def material(self):
pass
@abstractmethod
def open(self):
return NotImplemented
class Closer(ABC):
@abstractmethod
def close(self):
return NotImplemented
class Door(Opener, Closer):
material = None
def __init__(self, material):
self.material = material
def close(self):
print(f"{self.material} door is opened!")
def open(self):
print(f"{self.material} door is closed!")
glass_door = Door(material="Glass")
glass_door.open()
glass_door.close() | 17 | 53 | 0.651703 | 74 | 646 | 5.594595 | 0.351351 | 0.115942 | 0.05314 | 0.140097 | 0.135266 | 0.135266 | 0.135266 | 0 | 0 | 0 | 0 | 0 | 0.24613 | 646 | 38 | 54 | 17 | 0.850103 | 0 | 0 | 0.375 | 0 | 0 | 0.103555 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | false | 0.041667 | 0.041667 | 0.083333 | 0.541667 | 0.083333 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 2 |
9916ce285dd636646b8ff2817f3127e28bb6af97 | 217 | py | Python | saas/aiops/api/aiops-server/services/base_service.py | iuskye/SREWorks | a2a7446767d97ec5f6d15bd00189c42150d6c894 | [
"Apache-2.0"
] | 407 | 2022-03-16T08:09:38.000Z | 2022-03-31T12:27:10.000Z | saas/aiops/api/aiops-server/services/base_service.py | Kwafoor/SREWorks | 37a64a0a84b29c65cf6b77424bd2acd0c7b42e2b | [
"Apache-2.0"
] | 25 | 2022-03-22T04:27:31.000Z | 2022-03-30T08:47:28.000Z | saas/aiops/api/aiops-server/services/base_service.py | Kwafoor/SREWorks | 37a64a0a84b29c65cf6b77424bd2acd0c7b42e2b | [
"Apache-2.0"
] | 109 | 2022-03-21T17:30:44.000Z | 2022-03-31T09:36:28.000Z | #!/usr/bin/env python
# encoding: utf-8
""" """
__author__ = 'sreworks'
from models.db_session import db
class BaseService(object):
def __init__(self):
self.db = db
self.db_session = db.session
| 16.692308 | 36 | 0.64977 | 29 | 217 | 4.517241 | 0.689655 | 0.206107 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.005882 | 0.21659 | 217 | 12 | 37 | 18.083333 | 0.764706 | 0.165899 | 0 | 0 | 0 | 0 | 0.046512 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.166667 | false | 0 | 0.166667 | 0 | 0.5 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 2 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.