hexsha string | size int64 | ext string | lang string | max_stars_repo_path string | max_stars_repo_name string | max_stars_repo_head_hexsha string | max_stars_repo_licenses list | max_stars_count int64 | max_stars_repo_stars_event_min_datetime string | max_stars_repo_stars_event_max_datetime string | max_issues_repo_path string | max_issues_repo_name string | max_issues_repo_head_hexsha string | max_issues_repo_licenses list | max_issues_count int64 | max_issues_repo_issues_event_min_datetime string | max_issues_repo_issues_event_max_datetime string | max_forks_repo_path string | max_forks_repo_name string | max_forks_repo_head_hexsha string | max_forks_repo_licenses list | max_forks_count int64 | max_forks_repo_forks_event_min_datetime string | max_forks_repo_forks_event_max_datetime string | content string | avg_line_length float64 | max_line_length int64 | alphanum_fraction float64 | qsc_code_num_words_quality_signal int64 | qsc_code_num_chars_quality_signal float64 | qsc_code_mean_word_length_quality_signal float64 | qsc_code_frac_words_unique_quality_signal float64 | qsc_code_frac_chars_top_2grams_quality_signal float64 | qsc_code_frac_chars_top_3grams_quality_signal float64 | qsc_code_frac_chars_top_4grams_quality_signal float64 | qsc_code_frac_chars_dupe_5grams_quality_signal float64 | qsc_code_frac_chars_dupe_6grams_quality_signal float64 | qsc_code_frac_chars_dupe_7grams_quality_signal float64 | qsc_code_frac_chars_dupe_8grams_quality_signal float64 | qsc_code_frac_chars_dupe_9grams_quality_signal float64 | qsc_code_frac_chars_dupe_10grams_quality_signal float64 | qsc_code_frac_chars_replacement_symbols_quality_signal float64 | qsc_code_frac_chars_digital_quality_signal float64 | qsc_code_frac_chars_whitespace_quality_signal float64 | qsc_code_size_file_byte_quality_signal float64 | qsc_code_num_lines_quality_signal float64 | qsc_code_num_chars_line_max_quality_signal float64 | qsc_code_num_chars_line_mean_quality_signal float64 | qsc_code_frac_chars_alphabet_quality_signal float64 | qsc_code_frac_chars_comments_quality_signal float64 | qsc_code_cate_xml_start_quality_signal float64 | qsc_code_frac_lines_dupe_lines_quality_signal float64 | qsc_code_cate_autogen_quality_signal float64 | qsc_code_frac_lines_long_string_quality_signal float64 | qsc_code_frac_chars_string_length_quality_signal float64 | qsc_code_frac_chars_long_word_length_quality_signal float64 | qsc_code_frac_lines_string_concat_quality_signal float64 | qsc_code_cate_encoded_data_quality_signal float64 | qsc_code_frac_chars_hex_words_quality_signal float64 | qsc_code_frac_lines_prompt_comments_quality_signal float64 | qsc_code_frac_lines_assert_quality_signal float64 | qsc_codepython_cate_ast_quality_signal float64 | qsc_codepython_frac_lines_func_ratio_quality_signal float64 | qsc_codepython_cate_var_zero_quality_signal bool | qsc_codepython_frac_lines_pass_quality_signal float64 | qsc_codepython_frac_lines_import_quality_signal float64 | qsc_codepython_frac_lines_simplefunc_quality_signal float64 | qsc_codepython_score_lines_no_logic_quality_signal float64 | qsc_codepython_frac_lines_print_quality_signal float64 | qsc_code_num_words int64 | qsc_code_num_chars int64 | qsc_code_mean_word_length int64 | qsc_code_frac_words_unique null | qsc_code_frac_chars_top_2grams int64 | qsc_code_frac_chars_top_3grams int64 | qsc_code_frac_chars_top_4grams int64 | qsc_code_frac_chars_dupe_5grams int64 | qsc_code_frac_chars_dupe_6grams int64 | qsc_code_frac_chars_dupe_7grams int64 | qsc_code_frac_chars_dupe_8grams int64 | qsc_code_frac_chars_dupe_9grams int64 | qsc_code_frac_chars_dupe_10grams int64 | qsc_code_frac_chars_replacement_symbols int64 | qsc_code_frac_chars_digital int64 | qsc_code_frac_chars_whitespace int64 | qsc_code_size_file_byte int64 | qsc_code_num_lines int64 | qsc_code_num_chars_line_max int64 | qsc_code_num_chars_line_mean int64 | qsc_code_frac_chars_alphabet int64 | qsc_code_frac_chars_comments int64 | qsc_code_cate_xml_start int64 | qsc_code_frac_lines_dupe_lines int64 | qsc_code_cate_autogen int64 | qsc_code_frac_lines_long_string int64 | qsc_code_frac_chars_string_length int64 | qsc_code_frac_chars_long_word_length int64 | qsc_code_frac_lines_string_concat null | qsc_code_cate_encoded_data int64 | qsc_code_frac_chars_hex_words int64 | qsc_code_frac_lines_prompt_comments int64 | qsc_code_frac_lines_assert int64 | qsc_codepython_cate_ast int64 | qsc_codepython_frac_lines_func_ratio int64 | qsc_codepython_cate_var_zero int64 | qsc_codepython_frac_lines_pass int64 | qsc_codepython_frac_lines_import int64 | qsc_codepython_frac_lines_simplefunc int64 | qsc_codepython_score_lines_no_logic int64 | qsc_codepython_frac_lines_print int64 | effective string | hits int64 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
594197865dcd78f5c865efa627fa40ed2203473e | 281 | py | Python | Intro/1_The_Journey_Begins/01_add.py | RylandGomez/CS-Arcade | 086afa37fdba5bb2ca21fd93ed616bb5aca09d5d | [
"MIT"
] | null | null | null | Intro/1_The_Journey_Begins/01_add.py | RylandGomez/CS-Arcade | 086afa37fdba5bb2ca21fd93ed616bb5aca09d5d | [
"MIT"
] | null | null | null | Intro/1_The_Journey_Begins/01_add.py | RylandGomez/CS-Arcade | 086afa37fdba5bb2ca21fd93ed616bb5aca09d5d | [
"MIT"
] | null | null | null | def solution(param1, param2):
'''
EXPLANATION
-------------------------------------------------------------------
Use the + operator for basic addition.
-------------------------------------------------------------------
'''
return param1 + param2
| 28.1 | 71 | 0.291815 | 14 | 281 | 5.857143 | 0.857143 | 0.292683 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.017467 | 0.185053 | 281 | 9 | 72 | 31.222222 | 0.340611 | 0.661922 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.5 | false | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 6 |
a7218a64f6fe7a25bec0c926275feac961c87caf | 183 | py | Python | app/utils/utils.py | amommendes/wikimedia_stream | 53ed27793a665a29addbc16da307b2408f313847 | [
"Apache-2.0"
] | null | null | null | app/utils/utils.py | amommendes/wikimedia_stream | 53ed27793a665a29addbc16da307b2408f313847 | [
"Apache-2.0"
] | 2 | 2021-06-01T23:48:18.000Z | 2021-06-02T03:30:43.000Z | app/utils/utils.py | amommendes/wikimedia_stream | 53ed27793a665a29addbc16da307b2408f313847 | [
"Apache-2.0"
] | null | null | null | from datetime import datetime, timedelta
import time
def get_mseconds():
"""
This method returns actual time in milliseconds
"""
return int(round(time.time()*1000))
| 18.3 | 51 | 0.693989 | 23 | 183 | 5.478261 | 0.782609 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.027586 | 0.20765 | 183 | 9 | 52 | 20.333333 | 0.841379 | 0.256831 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | true | 0 | 0.5 | 0 | 1 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
596c8e2de7a075d978acdd2eadba419575b344e8 | 28 | py | Python | balance/ERC20/balance.py | picaproject/wallet | 56966caca715aa2d541e81f3064d00fdb6adc192 | [
"Apache-2.0"
] | null | null | null | balance/ERC20/balance.py | picaproject/wallet | 56966caca715aa2d541e81f3064d00fdb6adc192 | [
"Apache-2.0"
] | null | null | null | balance/ERC20/balance.py | picaproject/wallet | 56966caca715aa2d541e81f3064d00fdb6adc192 | [
"Apache-2.0"
] | null | null | null | def get_balance():
pass | 14 | 19 | 0.642857 | 4 | 28 | 4.25 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.25 | 28 | 2 | 20 | 14 | 0.809524 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.5 | true | 0.5 | 0 | 0 | 0.5 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 6 |
59d031350fa9afa627e873095bb28c6579a5bcf2 | 39 | py | Python | common/__init__.py | huestisk/NHL | b0e528589c4ae523dea19f406daebc1c5edcc738 | [
"MIT"
] | null | null | null | common/__init__.py | huestisk/NHL | b0e528589c4ae523dea19f406daebc1c5edcc738 | [
"MIT"
] | null | null | null | common/__init__.py | huestisk/NHL | b0e528589c4ae523dea19f406daebc1c5edcc738 | [
"MIT"
] | null | null | null | from common.convert_to_matches import * | 39 | 39 | 0.871795 | 6 | 39 | 5.333333 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.076923 | 39 | 1 | 39 | 39 | 0.888889 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
ab9876674ddda6dfe946df0d13af725dcb911598 | 174 | py | Python | apps/drl/chpZ01/loss_mse.py | yt7589/iching | 6673da38f4c80e7fd297c86fedc5616aee8ac09b | [
"Apache-2.0"
] | 32 | 2020-04-14T08:32:18.000Z | 2022-02-09T07:05:08.000Z | apps/drl/chpZ01/loss_mse.py | trinh-hoang-hiep/iching | e1feae5741c3cbde535d7a275b01d4f0cf9e21ed | [
"Apache-2.0"
] | 1 | 2020-04-08T10:42:15.000Z | 2020-04-15T01:38:03.000Z | apps/drl/chpZ01/loss_mse.py | trinh-hoang-hiep/iching | e1feae5741c3cbde535d7a275b01d4f0cf9e21ed | [
"Apache-2.0"
] | 4 | 2020-08-25T03:56:46.000Z | 2021-05-11T05:55:51.000Z | #
class LossMse(object):
def __init__(self):
super().__init__()
def forward(self, pred, target):
return ((pred - target)*(pred - target)).sum(0) | 21.75 | 55 | 0.574713 | 20 | 174 | 4.6 | 0.65 | 0.326087 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.007752 | 0.258621 | 174 | 8 | 55 | 21.75 | 0.705426 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.4 | false | 0 | 0 | 0.2 | 0.8 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 6 |
aba6e0e7a8969f43451a326dbea005515c4db233 | 32 | py | Python | spa/test_use_from_colab.py | cavestruz/spa | 4f147694601e0b88f97794c8851ccdd615c73ea4 | [
"BSD-3-Clause"
] | null | null | null | spa/test_use_from_colab.py | cavestruz/spa | 4f147694601e0b88f97794c8851ccdd615c73ea4 | [
"BSD-3-Clause"
] | null | null | null | spa/test_use_from_colab.py | cavestruz/spa | 4f147694601e0b88f97794c8851ccdd615c73ea4 | [
"BSD-3-Clause"
] | null | null | null | print('Hello from github repo')
| 16 | 31 | 0.75 | 5 | 32 | 4.8 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.125 | 32 | 1 | 32 | 32 | 0.857143 | 0 | 0 | 0 | 0 | 0 | 0.6875 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 6 |
abc64d68abcfbbb016a54c808b2ee0b15709325e | 79 | py | Python | tests/bundles/sqlalchemy/_bundles/app/__init__.py | achiang/flask-unchained | 12788a6e618904a25ff2b571eb05ff1dc8f1840f | [
"MIT"
] | 69 | 2018-10-10T01:59:11.000Z | 2022-03-29T17:29:30.000Z | tests/bundles/sqlalchemy/_bundles/app/__init__.py | achiang/flask-unchained | 12788a6e618904a25ff2b571eb05ff1dc8f1840f | [
"MIT"
] | 18 | 2018-11-17T12:42:02.000Z | 2021-05-22T18:45:27.000Z | tests/bundles/sqlalchemy/_bundles/app/__init__.py | achiang/flask-unchained | 12788a6e618904a25ff2b571eb05ff1dc8f1840f | [
"MIT"
] | 7 | 2018-10-12T16:20:25.000Z | 2021-10-06T12:18:21.000Z | from flask_unchained import AppBundle
class MyAppBundle(AppBundle):
pass
| 13.166667 | 37 | 0.797468 | 9 | 79 | 6.888889 | 0.888889 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.164557 | 79 | 5 | 38 | 15.8 | 0.939394 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.333333 | 0.333333 | 0 | 0.666667 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
abd18f088d6b708912b617f04fbc40ae9ef1987d | 85 | py | Python | src/lib/compute.py | dineshkh/test_git | 80caa6b5f009fa1d1c844ea8d57e54c3beea30b2 | [
"MIT"
] | null | null | null | src/lib/compute.py | dineshkh/test_git | 80caa6b5f009fa1d1c844ea8d57e54c3beea30b2 | [
"MIT"
] | null | null | null | src/lib/compute.py | dineshkh/test_git | 80caa6b5f009fa1d1c844ea8d57e54c3beea30b2 | [
"MIT"
] | null | null | null | import json
import numpy
def main():
print ("again modieied in master branch") | 12.142857 | 45 | 0.705882 | 12 | 85 | 5 | 0.916667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.211765 | 85 | 7 | 45 | 12.142857 | 0.895522 | 0 | 0 | 0 | 0 | 0 | 0.360465 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | true | 0 | 0.5 | 0 | 0.75 | 0.25 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
abe83614d54fc5b7951f5d3f7470cd238e9aaeae | 94 | py | Python | Desktop/packages/rmnetwork/__init__.py | peter9teufel/raspmedia | 037eb9ef4bd700ec3bce00987db5f9355b52346a | [
"Apache-2.0"
] | 29 | 2015-01-03T01:05:04.000Z | 2021-10-04T22:42:37.000Z | Desktop/packages/rmnetwork/__init__.py | peter9teufel/raspmedia | 037eb9ef4bd700ec3bce00987db5f9355b52346a | [
"Apache-2.0"
] | 6 | 2015-01-03T01:12:18.000Z | 2016-08-09T04:35:52.000Z | Desktop/packages/rmnetwork/__init__.py | peter9teufel/raspmedia | 037eb9ef4bd700ec3bce00987db5f9355b52346a | [
"Apache-2.0"
] | 12 | 2015-01-03T03:48:18.000Z | 2019-08-20T09:23:09.000Z | import interpreter, messages, udpresponselistener, udpconnector, tcpfileclient, tcpfilesocket
| 47 | 93 | 0.87234 | 7 | 94 | 11.714286 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.074468 | 94 | 1 | 94 | 94 | 0.942529 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
050c74677551846c575f66a93f9e40fd014796ed | 5,001 | py | Python | app/tests/crud/test_binary_ml_model.py | qtdemo1/ibm-ops | 29f3d4ba406a1c39a007468977784d6c39f056bb | [
"Apache-2.0"
] | 1 | 2021-09-14T18:40:33.000Z | 2021-09-14T18:40:33.000Z | app/tests/crud/test_binary_ml_model.py | qtdemo1/ibm-ops | 29f3d4ba406a1c39a007468977784d6c39f056bb | [
"Apache-2.0"
] | 7 | 2021-04-23T13:41:39.000Z | 2021-08-12T09:33:10.000Z | app/tests/crud/test_binary_ml_model.py | qtdemo1/ibm-ops | 29f3d4ba406a1c39a007468977784d6c39f056bb | [
"Apache-2.0"
] | 5 | 2020-12-10T14:27:23.000Z | 2022-03-29T08:44:22.000Z | #!/usr/bin/env python3
#
# Copyright 2020 IBM
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.IBM Confidential
#
import pickle
import typing
import sqlalchemy.orm as orm
import app.crud as crud
import app.models as models
import app.schemas as schemas
import app.schemas.binary_config as mapping
import app.tests.predictors.scikit_learn.model
def test_create_binary_ml_model(
db: orm.Session,
endpoint_in_db: models.Endpoint
) -> typing.NoReturn:
predictor = app.tests.predictors.scikit_learn.model.get_classification_predictor()
binary_create = schemas.BinaryMlModelCreate(
model_b64=pickle.dumps(predictor),
input_data_structure=mapping.ModelInput.DATAFRAME,
output_data_structure=mapping.ModelOutput.NUMPY_ARRAY,
format=mapping.ModelWrapper.JOBLIB
)
binary = crud.binary_ml_model.create_with_endpoint(db, obj_in=binary_create, endpoint_id=endpoint_in_db.id)
assert binary.id == endpoint_in_db.id
assert isinstance(pickle.loads(binary.model_b64), type(pickle.loads(binary_create.model_b64)))
assert binary.input_data_structure == binary_create.input_data_structure
assert binary.output_data_structure == binary_create.output_data_structure
assert binary.format == binary_create.format
def test_get_binary_ml_model(
db: orm.Session,
endpoint_in_db: models.Endpoint
) -> typing.NoReturn:
predictor = app.tests.predictors.scikit_learn.model.get_classification_predictor()
binary_create = schemas.BinaryMlModelCreate(
model_b64=pickle.dumps(predictor),
input_data_structure=mapping.ModelInput.DATAFRAME,
output_data_structure=mapping.ModelOutput.NUMPY_ARRAY,
format=mapping.ModelWrapper.JOBLIB
)
binary = crud.binary_ml_model.create_with_endpoint(db, obj_in=binary_create, endpoint_id=endpoint_in_db.id)
binary_1 = crud.binary_ml_model.get(db, id=binary.id)
assert binary_1.id == binary.id
assert binary_1.id == endpoint_in_db.id
assert isinstance(pickle.loads(binary_1.model_b64), type(pickle.loads(binary_create.model_b64)))
assert binary_1.input_data_structure == binary_create.input_data_structure
assert binary_1.output_data_structure == binary_create.output_data_structure
assert binary_1.format == binary_create.format
def test_get_binary_ml_model_by_endpoint(
db: orm.Session,
endpoint_in_db: models.Endpoint
) -> typing.NoReturn:
predictor = app.tests.predictors.scikit_learn.model.get_classification_predictor()
binary_create = schemas.BinaryMlModelCreate(
model_b64=pickle.dumps(predictor),
input_data_structure=mapping.ModelInput.DATAFRAME,
output_data_structure=mapping.ModelOutput.NUMPY_ARRAY,
format=mapping.ModelWrapper.JOBLIB
)
binary = crud.binary_ml_model.create_with_endpoint(db, obj_in=binary_create, endpoint_id=endpoint_in_db.id)
binary_1 = crud.binary_ml_model.get_by_endpoint(db, endpoint_id=endpoint_in_db.id)
assert binary_1.id == binary.id
assert binary_1.id == endpoint_in_db.id
assert isinstance(pickle.loads(binary_1.model_b64), type(pickle.loads(binary_create.model_b64)))
assert binary_1.input_data_structure == binary_create.input_data_structure
assert binary_1.output_data_structure == binary_create.output_data_structure
assert binary_1.format == binary_create.format
def test_delete_binary_ml_model(
db: orm.Session,
endpoint_in_db: models.Endpoint
) -> typing.NoReturn:
predictor = app.tests.predictors.scikit_learn.model.get_classification_predictor()
binary_create = schemas.BinaryMlModelCreate(
model_b64=pickle.dumps(predictor),
input_data_structure=mapping.ModelInput.DATAFRAME,
output_data_structure=mapping.ModelOutput.NUMPY_ARRAY,
format=mapping.ModelWrapper.JOBLIB
)
binary = crud.binary_ml_model.create_with_endpoint(db, obj_in=binary_create, endpoint_id=endpoint_in_db.id)
binary_1 = crud.binary_ml_model.delete(db, id=binary.id)
binary_2 = crud.binary_ml_model.get(db, id=binary.id)
assert binary_2 is None
assert binary_1.id == binary.id
assert binary_1.id == endpoint_in_db.id
assert isinstance(pickle.loads(binary_1.model_b64), type(pickle.loads(binary_create.model_b64)))
assert binary_1.input_data_structure == binary_create.input_data_structure
assert binary_1.output_data_structure == binary_create.output_data_structure
assert binary_1.format == binary_create.format
| 43.112069 | 111 | 0.774445 | 694 | 5,001 | 5.286744 | 0.17147 | 0.078496 | 0.053148 | 0.034342 | 0.810848 | 0.810848 | 0.801581 | 0.801581 | 0.792314 | 0.792314 | 0 | 0.013078 | 0.143771 | 5,001 | 115 | 112 | 43.486957 | 0.843765 | 0.115377 | 0 | 0.690476 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.285714 | 1 | 0.047619 | false | 0 | 0.095238 | 0 | 0.142857 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
052c6f2aa46b3d12f07d84d5fbda88043dfe6928 | 75 | py | Python | tests/test.py | dan-casabuena/CovarianceToolbox | 6c65191d8947288520cba7266f46042e45be177a | [
"MIT"
] | null | null | null | tests/test.py | dan-casabuena/CovarianceToolbox | 6c65191d8947288520cba7266f46042e45be177a | [
"MIT"
] | null | null | null | tests/test.py | dan-casabuena/CovarianceToolbox | 6c65191d8947288520cba7266f46042e45be177a | [
"MIT"
] | null | null | null | import pandas as pd
import numpy as np
def test(bruh, classic=0):
pass | 15 | 26 | 0.72 | 14 | 75 | 3.857143 | 0.857143 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.016949 | 0.213333 | 75 | 5 | 27 | 15 | 0.898305 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | false | 0.25 | 0.5 | 0 | 0.75 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
55328872022fe9ae47e29e666ffbc3fa1b67dcc1 | 145 | py | Python | docs/manual/gears/examples/fmap_union_cfg.py | bogdanvuk/pygears | a0b21d445e1d5c89ad66751447b8253536b835ee | [
"MIT"
] | 120 | 2018-04-23T08:29:04.000Z | 2022-03-30T14:41:52.000Z | docs/manual/gears/examples/fmap_union_cfg.py | FZP1607152286/pygears | a0b21d445e1d5c89ad66751447b8253536b835ee | [
"MIT"
] | 12 | 2019-07-09T17:12:58.000Z | 2022-03-18T09:05:10.000Z | docs/manual/gears/examples/fmap_union_cfg.py | FZP1607152286/pygears | a0b21d445e1d5c89ad66751447b8253536b835ee | [
"MIT"
] | 12 | 2019-05-10T19:42:08.000Z | 2022-03-28T18:26:44.000Z | from pygears import reg
reg['debug/trace'].append('/fmap/sub.*')
reg['debug/trace'].append('/fmap.din')
reg['debug/trace'].append('/fmap.dout')
| 24.166667 | 40 | 0.682759 | 22 | 145 | 4.5 | 0.5 | 0.242424 | 0.393939 | 0.575758 | 0.69697 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.055172 | 145 | 5 | 41 | 29 | 0.722628 | 0 | 0 | 0 | 0 | 0 | 0.434483 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.25 | 0 | 0.25 | 0 | 1 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
e9d47c3b443eef25ad18128610057dd99f2ff92d | 96 | py | Python | venv/lib/python3.8/site-packages/numpy/core/tests/test_casting_unittests.py | GiulianaPola/select_repeats | 17a0d053d4f874e42cf654dd142168c2ec8fbd11 | [
"MIT"
] | 2 | 2022-03-13T01:58:52.000Z | 2022-03-31T06:07:54.000Z | venv/lib/python3.8/site-packages/numpy/core/tests/test_casting_unittests.py | DesmoSearch/Desmobot | b70b45df3485351f471080deb5c785c4bc5c4beb | [
"MIT"
] | 19 | 2021-11-20T04:09:18.000Z | 2022-03-23T15:05:55.000Z | venv/lib/python3.8/site-packages/numpy/core/tests/test_casting_unittests.py | DesmoSearch/Desmobot | b70b45df3485351f471080deb5c785c4bc5c4beb | [
"MIT"
] | null | null | null | /home/runner/.cache/pip/pool/7c/3f/3e/d6cc48561c9aa4b542cf9e7844318e6e779ac122e904018fac69e905eb | 96 | 96 | 0.895833 | 9 | 96 | 9.555556 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.416667 | 0 | 96 | 1 | 96 | 96 | 0.479167 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | null | null | 0 | 0 | null | null | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
75bae58223cbee2d43015a2164cb3bc3b38ed5c0 | 107,177 | py | Python | cfdm/mixin/netcdf.py | tsjackson-noaa/cfdm | a669677905badaced2eba87413288ac0bc2697fc | [
"MIT"
] | null | null | null | cfdm/mixin/netcdf.py | tsjackson-noaa/cfdm | a669677905badaced2eba87413288ac0bc2697fc | [
"MIT"
] | null | null | null | cfdm/mixin/netcdf.py | tsjackson-noaa/cfdm | a669677905badaced2eba87413288ac0bc2697fc | [
"MIT"
] | null | null | null | from ..core.functions import deepcopy
class DeprecationError(Exception):
"""An error indicating a method is no longer available."""
pass
class NetCDF:
"""Mixin class for storing simple netCDF elements.
.. versionadded:: (cfdm) 1.7.0
"""
def _initialise_netcdf(self, source=None):
"""Helps to initialise netCDF components.
Call this from inside the __init__ method of a class that
inherits from this mixin class.
:Parameters:
source: optional
Initialise the netCDF components from those of
*source*.
:Returns:
`None`
**Examples:**
>>> f._initialise_netcdf(source)
"""
if source is None:
netcdf = {}
else:
try:
netcdf = source._get_component("netcdf", {})
except AttributeError:
netcdf = {}
else:
if netcdf:
netcdf = deepcopy(netcdf)
else:
netcdf = {}
self._set_component("netcdf", netcdf, copy=False)
class _NetCDFGroupsMixin:
"""Mixin class for accessing netCDF(4) hierarchical groups.
.. versionadded:: (cfdm) 1.8.6
"""
@classmethod
def _nc_groups(cls, nc_get):
"""Return the netCDF group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `_nc_clear_groups`, `_nc_set_groups`
:Parameters:
nc_get: function
The method which gets the netCDF name.
:Returns:
`tuple` of `str`
The group structure.
**Examples:**
See the examples in classes which inherit this method.
"""
name = nc_get(default="")
return tuple(name.split("/")[1:-1])
@classmethod
def _nc_set_groups(cls, groups, nc_get, nc_set, nc_groups):
"""Set the netCDF group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `_nc_clear_groups`, `_nc_groups`
:Parameters:
groups: sequence of `str`
The new group structure.
nc_get: function
The method which gets the netCDF name.
nc_set: function
The method which sets the netCDF name.
nc_groups: function
The method which returns existing group structure.
:Returns:
`tuple` of `str`
The group structure prior to being reset.
**Examples:**
See the examples in classes which inherit this method.
"""
old = nc_groups()
name = nc_get(default="")
name = name.split("/")[-1]
if not name:
raise ValueError("Can't set groups when there is no netCDF name")
if groups:
for group in groups:
if "/" in group:
raise ValueError(
f"Can't have '/' character in group name: {group!r}"
)
name = "/".join(("",) + tuple(groups) + (name,))
if name:
nc_set(name)
return old
@classmethod
def _nc_clear_groups(cls, nc_get, nc_set, nc_groups):
"""Remove the netCDF group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `_nc_groups`, `_nc_set_groups`
:Parameters:
nc_get: function
The method which gets the netCDF name.
nc_set: function
The method which sets the netCDF name.
nc_groups: function
The method which returns existing group structure.
:Returns:
`tuple` of `str`
The removed group structure.
**Examples:**
See the examples in classes which inherit this method.
"""
old = nc_groups()
name = nc_get(default="")
name = name.split("/")[-1]
if name:
nc_set(name)
return old
class NetCDFDimension(NetCDF, _NetCDFGroupsMixin):
"""Mixin class for accessing the netCDF dimension name.
.. versionadded:: (cfdm) 1.7.0
"""
def nc_del_dimension(self, default=ValueError()):
"""Remove the netCDF dimension name.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_get_dimension`, `nc_has_dimension`,
`nc_set_dimension`
:Parameters:
default: optional
Return the value of the *default* parameter if the
netCDF dimension name has not been set. If set to an
`Exception` instance then it will be raised instead.
:Returns:
`str`
The removed netCDF dimension name.
**Examples:**
>>> f.nc_set_dimension('time')
>>> f.nc_has_dimension()
True
>>> f.nc_get_dimension()
'time'
>>> f.nc_del_dimension()
'time'
>>> f.nc_has_dimension()
False
>>> print(f.nc_get_dimension(None))
None
>>> print(f.nc_del_dimension(None))
None
"""
try:
return self._get_component("netcdf").pop("dimension")
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF dimension name",
)
def nc_get_dimension(self, default=ValueError()):
"""Return the netCDF dimension name.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_dimension`, `nc_has_dimension`,
`nc_set_dimension`
:Parameters:
default: optional
Return the value of the *default* parameter if the
netCDF dimension name has not been set. If set to an
`Exception` instance then it will be raised instead.
:Returns:
`str`
The netCDF dimension name.
**Examples:**
>>> f.nc_set_dimension('time')
>>> f.nc_has_dimension()
True
>>> f.nc_get_dimension()
'time'
>>> f.nc_del_dimension()
'time'
>>> f.nc_has_dimension()
False
>>> print(f.nc_get_dimension(None))
None
>>> print(f.nc_del_dimension(None))
None
"""
try:
return self._get_component("netcdf")["dimension"]
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF dimension name",
)
def nc_has_dimension(self):
"""Whether the netCDF dimension name has been set.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_dimension`, `nc_get_dimension`,
`nc_set_dimension`
:Returns:
`bool`
`True` if the netCDF dimension name has been set,
otherwise `False`.
**Examples:**
>>> f.nc_set_dimension('time')
>>> f.nc_has_dimension()
True
>>> f.nc_get_dimension()
'time'
>>> f.nc_del_dimension()
'time'
>>> f.nc_has_dimension()
False
>>> print(f.nc_get_dimension(None))
None
>>> print(f.nc_del_dimension(None))
None
"""
return "dimension" in self._get_component("netcdf")
def nc_set_dimension(self, value):
"""Set the netCDF dimension name.
If there are any ``/`` (slash) characters in the netCDF name
then these act as delimiters for a group hierarchy. By
default, or if the name starts with a ``/`` character and
contains no others, the name is assumed to be in the root
group.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_dimension`, `nc_get_dimension`,
`nc_has_dimension`
:Parameters:
value: `str`
The value for the netCDF dimension name.
:Returns:
`None`
**Examples:**
>>> f.nc_set_dimension('time')
>>> f.nc_has_dimension()
True
>>> f.nc_get_dimension()
'time'
>>> f.nc_del_dimension()
'time'
>>> f.nc_has_dimension()
False
>>> print(f.nc_get_dimension(None))
None
>>> print(f.nc_del_dimension(None))
None
"""
if not value or value == "/":
raise ValueError(f"Invalid netCDF dimension name: {value!r}")
if "/" in value:
if not value.startswith("/"):
raise ValueError(
"A netCDF dimension name with a group structure "
f"must start with a '/'. Got {value!r}"
)
if value.count("/") == 1:
value = value[1:]
elif value.endswith("/"):
raise ValueError(
"A netCDF dimension name with a group structure "
f"can't end with a '/'. Got {value!r}"
)
self._get_component("netcdf")["dimension"] = value
def nc_dimension_groups(self):
"""Return the netCDF dimension group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_dimension_groups`,
`nc_set_dimension_groups`
:Returns:
`tuple` of `str`
The group structure.
**Examples:**
>>> f.nc_set_dimension('time')
>>> f.nc_dimension_groups()
()
>>> f.nc_set_dimension_groups(['forecast', 'model'])
>>> f.nc_dimension_groups()
('forecast', 'model')
>>> f.nc_get_dimension()
'/forecast/model/time'
>>> f.nc_clear_dimension_groups()
('forecast', 'model')
>>> f.nc_get_dimension()
'time'
>>> f.nc_set_dimension('/forecast/model/time')
>>> f.nc_dimension_groups()
('forecast', 'model')
>>> f.nc_del_dimension('/forecast/model/time')
'/forecast/model/time'
>>> f.nc_dimension_groups()
()
"""
return self._nc_groups(nc_get=self.nc_get_dimension)
def nc_set_dimension_groups(self, groups):
"""Set the netCDF dimension group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
An alternative technique for setting the group structure is to
set the netCDF dimension name, with `nc_set_dimension`, with
the group structure delimited by ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_dimension_groups`, `nc_dimension_groups`
:Parameters:
groups: sequence of `str`
The new group structure.
:Returns:
`tuple` of `str`
The group structure prior to being reset.
**Examples:**
>>> f.nc_set_dimension('time')
>>> f.nc_dimension_groups()
()
>>> f.nc_set_dimension_groups(['forecast', 'model'])
>>> f.nc_dimension_groups()
('forecast', 'model')
>>> f.nc_get_dimension()
'/forecast/model/time'
>>> f.nc_clear_dimension_groups()
('forecast', 'model')
>>> f.nc_get_dimension()
'time'
>>> f.nc_set_dimension('/forecast/model/time')
>>> f.nc_dimension_groups()
('forecast', 'model')
>>> f.nc_del_dimension('/forecast/model/time')
'/forecast/model/time'
>>> f.nc_dimension_groups()
()
"""
return self._nc_set_groups(
groups,
nc_get=self.nc_get_dimension,
nc_set=self.nc_set_dimension,
nc_groups=self.nc_dimension_groups,
)
def nc_clear_dimension_groups(self):
"""Remove the netCDF dimension group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
An alternative technique for removing the group structure is
to set the netCDF dimension name, with `nc_set_dimension`,
with no ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_dimension_groups`, `nc_set_dimension_groups`
:Returns:
`tuple` of `str`
The removed group structure.
**Examples:**
>>> f.nc_set_dimension('time')
>>> f.nc_dimension_groups()
()
>>> f.nc_set_dimension_groups(['forecast', 'model'])
>>> f.nc_dimension_groups()
('forecast', 'model')
>>> f.nc_get_dimension()
'/forecast/model/time'
>>> f.nc_clear_dimension_groups()
('forecast', 'model')
>>> f.nc_get_dimension()
'time'
>>> f.nc_set_dimension('/forecast/model/time')
>>> f.nc_dimension_groups()
('forecast', 'model')
>>> f.nc_del_dimension('/forecast/model/time')
'/forecast/model/time'
>>> f.nc_dimension_groups()
()
"""
return self._nc_clear_groups(
nc_get=self.nc_get_dimension,
nc_set=self.nc_set_dimension,
nc_groups=self.nc_dimension_groups,
)
class NetCDFVariable(NetCDF, _NetCDFGroupsMixin):
"""Mixin class for accessing the netCDF variable name.
.. versionadded:: (cfdm) 1.7.0
"""
def nc_del_variable(self, default=ValueError()):
"""Remove the netCDF variable name.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_get_variable`, `nc_has_variable`,
`nc_set_variable`
:Parameters:
default: optional
Return the value of the *default* parameter if the
netCDF variable name has not been set. If set to an
`Exception` instance then it will be raised instead.
:Returns:
`str`
The removed netCDF variable name.
**Examples:**
>>> f.nc_set_variable('tas')
>>> f.nc_has_variable()
True
>>> f.nc_get_variable()
'tas'
>>> f.nc_del_variable()
'tas'
>>> f.nc_has_variable()
False
>>> print(f.nc_get_variable(None))
None
>>> print(f.nc_del_variable(None))
None
"""
try:
return self._get_component("netcdf").pop("variable")
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF variable name",
)
def nc_get_variable(self, default=ValueError()):
"""Return the netCDF variable name.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_variable`, `nc_has_variable`,
`nc_set_variable`
:Parameters:
default: optional
Return the value of the *default* parameter if the
netCDF variable name has not been set. If set to an
`Exception` instance then it will be raised instead.
:Returns:
`str`
The netCDF variable name. If unset then *default* is
returned, if provided.
**Examples:**
>>> f.nc_set_variable('tas')
>>> f.nc_has_variable()
True
>>> f.nc_get_variable()
'tas'
>>> f.nc_del_variable()
'tas'
>>> f.nc_has_variable()
False
>>> print(f.nc_get_variable(None))
None
>>> print(f.nc_del_variable(None))
None
"""
try:
return self._get_component("netcdf")["variable"]
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF variable name",
)
def nc_has_variable(self):
"""Whether the netCDF variable name has been set.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_variable`, `nc_get_variable`,
`nc_set_variable`
:Returns:
`bool`
`True` if the netCDF variable name has been set, otherwise
`False`.
**Examples:**
>>> f.nc_set_variable('tas')
>>> f.nc_has_variable()
True
>>> f.nc_get_variable()
'tas'
>>> f.nc_del_variable()
'tas'
>>> f.nc_has_variable()
False
>>> print(f.nc_get_variable(None))
None
>>> print(f.nc_del_variable(None))
None
"""
return "variable" in self._get_component("netcdf")
def nc_set_variable(self, value):
"""Set the netCDF variable name.
If there are any ``/`` (slash) characters in the netCDF name
then these act as delimiters for a group hierarchy. By
default, or if the name starts with a ``/`` character and
contains no others, the name is assumed to be in the root
group.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_variable`, `nc_get_variable`,
`nc_has_variable`
:Parameters:
value: `str`
The value for the netCDF variable name.
:Returns:
`None`
**Examples:**
>>> f.nc_set_variable('tas')
>>> f.nc_has_variable()
True
>>> f.nc_get_variable()
'tas'
>>> f.nc_del_variable()
'tas'
>>> f.nc_has_variable()
False
>>> print(f.nc_get_variable(None))
None
>>> print(f.nc_del_variable(None))
None
"""
if not value or value == "/":
raise ValueError(f"Invalid netCDF variable name: {value!r}")
if "/" in value:
if not value.startswith("/"):
raise ValueError(
"A netCDF variable name with a group structure "
f"must start with a '/'. Got {value!r}"
)
if value.count("/") == 1:
value = value[1:]
elif value.endswith("/"):
raise ValueError(
"A netCDF variable name with a group structure "
f"can't end with a '/'. Got {value!r}"
)
self._get_component("netcdf")["variable"] = value
def nc_variable_groups(self):
"""Return the netCDF variable group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_variable_groups`,
`nc_set_variable_groups`
:Returns:
`tuple` of `str`
The group structure.
**Examples:**
>>> f.nc_set_variable('time')
>>> f.nc_variable_groups()
()
>>> f.nc_set_variable_groups(['forecast', 'model'])
>>> f.nc_variable_groups()
('forecast', 'model')
>>> f.nc_get_variable()
'/forecast/model/time'
>>> f.nc_clear_variable_groups()
('forecast', 'model')
>>> f.nc_get_variable()
'time'
>>> f.nc_set_variable('/forecast/model/time')
>>> f.nc_variable_groups()
('forecast', 'model')
>>> f.nc_del_variable('/forecast/model/time')
'/forecast/model/time'
>>> f.nc_variable_groups()
()
"""
return self._nc_groups(nc_get=self.nc_get_variable)
def nc_set_variable_groups(self, groups):
"""Set the netCDF variable group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
An alternative technique for setting the group structure is to
set the netCDF variable name, with `nc_set_variable`, with the
group structure delimited by ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_variable_groups`, `nc_variable_groups`
:Parameters:
groups: sequence of `str`
The new group structure.
:Returns:
`tuple` of `str`
The group structure prior to being reset.
**Examples:**
>>> f.nc_set_variable('time')
>>> f.nc_variable_groups()
()
>>> f.nc_set_variable_groups(['forecast', 'model'])
>>> f.nc_variable_groups()
('forecast', 'model')
>>> f.nc_get_variable()
'/forecast/model/time'
>>> f.nc_clear_variable_groups()
('forecast', 'model')
>>> f.nc_get_variable()
'time'
>>> f.nc_set_variable('/forecast/model/time')
>>> f.nc_variable_groups()
('forecast', 'model')
>>> f.nc_del_variable('/forecast/model/time')
'/forecast/model/time'
>>> f.nc_variable_groups()
()
"""
return self._nc_set_groups(
groups,
nc_get=self.nc_get_variable,
nc_set=self.nc_set_variable,
nc_groups=self.nc_variable_groups,
)
def nc_clear_variable_groups(self):
"""Remove the netCDF variable group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
An alternative technique for removing the group structure is
to set the netCDF variable name, with `nc_set_variable`, with
no ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_variable_groups`, `nc_set_variable_groups`
:Returns:
`tuple` of `str`
The removed group structure.
**Examples:**
>>> f.nc_set_variable('time')
>>> f.nc_variable_groups()
()
>>> f.nc_set_variable_groups(['forecast', 'model'])
>>> f.nc_variable_groups()
('forecast', 'model')
>>> f.nc_get_variable()
'/forecast/model/time'
>>> f.nc_clear_variable_groups()
('forecast', 'model')
>>> f.nc_get_variable()
'time'
>>> f.nc_set_variable('/forecast/model/time')
>>> f.nc_variable_groups()
('forecast', 'model')
>>> f.nc_del_variable('/forecast/model/time')
'/forecast/model/time'
>>> f.nc_variable_groups()
()
"""
return self._nc_clear_groups(
nc_get=self.nc_get_variable,
nc_set=self.nc_set_variable,
nc_groups=self.nc_variable_groups,
)
class NetCDFSampleDimension(NetCDF, _NetCDFGroupsMixin):
"""Mixin class for accessing the netCDF sample dimension name.
.. versionadded:: (cfdm) 1.7.0
"""
def nc_del_sample_dimension(self, default=ValueError()):
"""Remove the netCDF sample dimension name.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_get_sample_dimension`,
`nc_has_sample_dimension`,
`nc_set_sample_dimension`
:Parameters:
default: optional
Return the value of the *default* parameter if the
netCDF sample dimension name has not been set. If set
to an `Exception` instance then it will be raised
instead.
:Returns:
`str`
The removed netCDF sample dimension name.
**Examples:**
>>> f.nc_set_sample_dimension('time')
>>> f.nc_has_sample_dimension()
True
>>> f.nc_get_sample_dimension()
'time'
>>> f.nc_del_sample_dimension()
'time'
>>> f.nc_has_sample_dimension()
False
>>> print(f.nc_get_sample_dimension(None))
None
>>> print(f.nc_del_sample_dimension(None))
None
"""
try:
return self._get_component("netcdf").pop("sample_dimension")
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF sample dimension name",
)
def nc_get_sample_dimension(self, default=ValueError()):
"""Return the netCDF sample dimension name.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_sample_dimension`, `nc_has_sample_dimension`,
`nc_set_sample_dimension`
:Parameters:
default: optional
Return the value of the *default* parameter if the
netCDF sample dimension name has not been set. If set
to an `Exception` instance then it will be raised
instead.
:Returns:
`str`
The netCDF sample dimension name.
**Examples:**
>>> f.nc_set_sample_dimension('time')
>>> f.nc_has_sample_dimension()
True
>>> f.nc_get_sample_dimension()
'time'
>>> f.nc_del_sample_dimension()
'time'
>>> f.nc_has_sample_dimension()
False
>>> print(f.nc_get_sample_dimension(None))
None
>>> print(f.nc_del_sample_dimension(None))
None
"""
try:
return self._get_component("netcdf")["sample_dimension"]
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF sample dimension name",
)
def nc_has_sample_dimension(self):
"""Whether the netCDF sample dimension name has been set.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_sample_dimension`, `nc_get_sample_dimension`,
`nc_set_sample_dimension`
:Returns:
`bool`
`True` if the netCDF sample dimension name has been set,
otherwise `False`.
**Examples:**
>>> f.nc_set_sample_dimension('time')
>>> f.nc_has_sample_dimension()
True
>>> f.nc_get_sample_dimension()
'time'
>>> f.nc_del_sample_dimension()
'time'
>>> f.nc_has_sample_dimension()
False
>>> print(f.nc_get_sample_dimension(None))
None
>>> print(f.nc_del_sample_dimension(None))
None
"""
return "sample_dimension" in self._get_component("netcdf")
def nc_set_sample_dimension(self, value):
"""Set the netCDF sample dimension name.
If there are any ``/`` (slash) characters in the netCDF name
then these act as delimiters for a group hierarchy. By
default, or if the name starts with a ``/`` character and
contains no others, the name is assumed to be in the root
group.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_del_sample_dimension`, `nc_get_sample_dimension`,
`nc_has_sample_dimension`
:Parameters:
value: `str`
The value for the netCDF sample dimension name.
:Returns:
`None`
**Examples:**
>>> f.nc_set_sample_dimension('time')
>>> f.nc_has_sample_dimension()
True
>>> f.nc_get_sample_dimension()
'time'
>>> f.nc_del_sample_dimension()
'time'
>>> f.nc_has_sample_dimension()
False
>>> print(f.nc_get_sample_dimension(None))
None
>>> print(f.nc_del_sample_dimension(None))
None
"""
if not value or value == "/":
raise ValueError(
f"Invalid netCDF sample dimension name: {value!r}"
)
if "/" in value:
if not value.startswith("/"):
raise ValueError(
"A netCDF sample dimension name with a group structure "
f"must start with a '/'. Got {value!r}"
)
if value.count("/") == 1:
value = value[1:]
elif value.endswith("/"):
raise ValueError(
"A netCDF sample dimension name with a group structure "
f"can't end with a '/'. Got {value!r}"
)
self._get_component("netcdf")["sample_dimension"] = value
def nc_sample_dimension_groups(self):
"""Return the netCDF dimension group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_sample_dimension_groups`,
`nc_set_sample_dimension_groups`
:Returns:
`tuple` of `str`
The group structure.
**Examples:**
>>> f.nc_set_sample_dimension('element')
>>> f.nc_sample_dimension_groups()
()
>>> f.nc_set_sample_dimension_groups(['forecast', 'model'])
>>> f.nc_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_get_sample_dimension()
'/forecast/model/element'
>>> f.nc_clear_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_get_sample_dimension()
'element'
>>> f.nc_set_sample_dimension('/forecast/model/element')
>>> f.nc_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_del_sample_dimension('/forecast/model/element')
'/forecast/model/element'
>>> f.nc_sample_dimension_groups()
()
"""
return self._nc_groups(nc_get=self.nc_get_sample_dimension)
def nc_set_sample_dimension_groups(self, groups):
"""Set the netCDF dimension group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/`` characters
then an empty sequence is returned, signifying the root group.
An alternative technique for setting the group structure is to set
the netCDF dimension name, with `nc_set_sample_dimension`, with
the group structure delimited by ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_sample_dimension_groups`,
`nc_sample_dimension_groups`
:Parameters:
groups: sequence of `str`
The new group structure.
:Returns:
`tuple` of `str`
The group structure prior to being reset.
**Examples:**
>>> f.nc_set_sample_dimension('element')
>>> f.nc_sample_dimension_groups()
()
>>> f.nc_set_sample_dimension_groups(['forecast', 'model'])
>>> f.nc_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_get_sample_dimension()
'/forecast/model/element'
>>> f.nc_clear_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_get_sample_dimension()
'element'
>>> f.nc_set_sample_dimension('/forecast/model/element')
>>> f.nc_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_del_sample_dimension('/forecast/model/element')
'/forecast/model/element'
>>> f.nc_sample_dimension_groups()
()
"""
return self._nc_set_groups(
groups,
nc_get=self.nc_get_sample_dimension,
nc_set=self.nc_set_sample_dimension,
nc_groups=self.nc_sample_dimension_groups,
)
def nc_clear_sample_dimension_groups(self):
"""Remove the netCDF dimension group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/`` characters
then an empty sequence is returned, signifying the root group.
An alternative technique for removing the group structure is to
set the netCDF dimension name, with `nc_set_sample_dimension`,
with no ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_sample_dimension_groups`,
`nc_set_sample_dimension_groups`
:Returns:
`tuple` of `str`
The removed group structure.
**Examples:**
>>> f.nc_set_sample_dimension('element')
>>> f.nc_sample_dimension_groups()
()
>>> f.nc_set_sample_dimension_groups(['forecast', 'model'])
>>> f.nc_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_get_sample_dimension()
'/forecast/model/element'
>>> f.nc_clear_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_get_sample_dimension()
'element'
>>> f.nc_set_sample_dimension('/forecast/model/element')
>>> f.nc_sample_dimension_groups()
('forecast', 'model')
>>> f.nc_del_sample_dimension('/forecast/model/element')
'/forecast/model/element'
>>> f.nc_sample_dimension_groups()
()
"""
return self._nc_clear_groups(
nc_get=self.nc_get_sample_dimension,
nc_set=self.nc_set_sample_dimension,
nc_groups=self.nc_sample_dimension_groups,
)
class NetCDFGlobalAttributes(NetCDF):
"""Mixin class for accessing netCDF global attributes.
.. versionadded:: (cfdm) 1.7.0
"""
def nc_global_attributes(self, values=False):
"""Returns properties to write as netCDF global attributes.
When multiple field constructs are being written to the same file,
it is only possible to create a netCDF global attribute from a
property that has identical values for each field construct. If
any field construct's property has a different value then the
property will not be written as a netCDF global attribute, even if
it has been selected as such, but will appear instead as
attributes on the netCDF data variables corresponding to each
field construct.
The standard description-of-file-contents properties are always
written as netCDF global attributes, if possible, so selecting
them is optional.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `write`, `nc_clear_global_attributes`,
`nc_set_global_attribute`, `nc_set_global_attributes`
:Parameters:
values: `bool`, optional
Return the value (rather than `None`) for any global
attribute that has, by definition, the same value as a
construct property.
.. versionadded:: (cfdm) 1.8.2
:Returns:
`dict`
The selection of properties requested for writing to
netCDF global attributes.
**Examples:**
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None}
>>> f.nc_set_global_attribute('foo')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None, 'foo': None}
>>> f.nc_set_global_attribute('comment', 'global comment')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': None}
>>> f.nc_global_attributes(values=True)
{'Conventions': 'CF-1.8', 'comment': 'global_comment', 'foo': 'bar'}
>>> f.nc_clear_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': None}
>>> f.nc_global_attributes()
{}
"""
out = self._get_component("netcdf").get("global_attributes")
if out is None:
return {}
out = out.copy()
if values:
# Replace a None value with the value from the variable
# properties
properties = self.properties()
if properties:
for prop, value in out.items():
if value is None and prop in properties:
out[prop] = properties[prop]
return out
def nc_clear_global_attributes(self):
"""Removes properties to write as netCDF global attributes.
When multiple field constructs are being written to the same
file, it is only possible to create a netCDF global attribute
from a property that has identical values for each field
construct. If any field construct's property has a different
value then the property will not be written as a netCDF global
attribute, even if it has been selected as such, but will
appear instead as attributes on the netCDF data variables
corresponding to each field construct.
The standard description-of-file-contents properties are
always written as netCDF global attributes, if possible, so
selecting them is optional.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `write`, `nc_global_attributes`,
`nc_set_global_attribute`, `nc_set_global_attributes`
:Returns:
`dict`
The removed selection of properties requested for
writing to netCDF global attributes.
**Examples:**
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None}
>>> f.nc_set_global_attribute('foo')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None, 'foo': None}
>>> f.nc_set_global_attribute('comment', 'global comment')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': None}
>>> f.nc_clear_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': None}
>>> f.nc_global_attributes()
{}
"""
out = self._get_component("netcdf").get("global_attributes")
if out is None:
out = {}
self._get_component("netcdf")["global_attributes"] = {}
return out
def nc_set_global_attribute(self, prop, value=None):
"""Select a property to be written as a netCDF global attribute.
When multiple field constructs are being written to the same file,
it is only possible to create a netCDF global attribute from a
property that has identical values for each field construct. If
any field construct's property has a different value then the
property will not be written as a netCDF global attribute, even if
it has been selected as such, but will appear instead as
attributes on the netCDF data variables corresponding to each
field construct.
The standard description-of-file-contents properties are always
written as netCDF global attributes, if possible, so selecting
them is optional.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `write`, `nc_global_attributes`,
`nc_clear_global_attributes`,
`nc_set_global_attributes`
:Parameters:
prop: `str`
Select the property to be written (if possible) as a
netCDF global attribute.
value: optional
The value of the netCDF global attribute, which will be
created (if possible) in addition to the property as
written to a netCDF data variable. If unset (or `None`)
then this acts as an instruction to write the property (if
possible) to a netCDF global attribute instead of to a
netCDF data variable.
:Returns:
`None`
**Examples:**
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None}
>>> f.nc_set_global_attribute('foo')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None, 'foo': None}
>>> f.nc_set_global_attribute('comment', 'global comment')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': None}
>>> f.nc_clear_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': None}
>>> f.nc_global_attributes()
{}
"""
out = self._get_component("netcdf").get("global_attributes")
if out is None:
out = {}
out[prop] = value
self._get_component("netcdf")["global_attributes"] = out
def nc_set_global_attributes(self, properties, copy=True):
"""Set properties to be written as netCDF global attributes.
When multiple field constructs are being written to the same
file, it is only possible to create a netCDF global attribute
from a property that has identical values for each field
construct. If any field construct's property has a different
value then the property will not be written as a netCDF global
attribute, even if it has been selected as such, but will
appear instead as attributes on the netCDF data variables
corresponding to each field construct.
The standard description-of-file-contents properties are
always written as netCDF global attributes, if possible, so
selecting them is optional.
.. versionadded:: (cfdm) 1.7.10
.. seealso:: `write`, `nc_clear_global_attributes`,
`nc_global_attributes`, `nc_set_global_attribute`
:Parameters:
properties: `dict`
Set the properties be written as a netCDF global
attribute from the dictionary supplied. The value of a
netCDF global attribute, which will be created (if
possible) in addition to the property as written to a
netCDF data variable. If a value of `None` is used
then this acts as an instruction to write the property
(if possible) to a netCDF global attribute instead of
to a netCDF data variable.
*Parameter example:*
``properties={'Conventions': None, 'project': 'research'}``
copy: `bool`, optional
If False then any property values provided by the
*properties* parameter are not copied before
insertion. By default they are deep copied.
:Returns:
`None`
**Examples:**
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None}
>>> f.nc_set_global_attributes({})
>>> f.nc_set_global_attributes({'foo': None})
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': None, 'foo': None}
>>> f.nc_set_global_attributes('comment', 'global comment')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': None}
>>> f.nc_set_global_attributes('foo', 'bar')
>>> f.nc_global_attributes()
{'Conventions': None, 'comment': 'global_comment', 'foo': 'bar'}
"""
if copy:
properties = deepcopy(properties)
else:
properties = properties.copy()
out = self._get_component("netcdf").get("global_attributes")
if out is None:
out = {}
out.update(properties)
self._get_component("netcdf")["global_attributes"] = out
class NetCDFGroupAttributes(NetCDF):
"""Mixin class for accessing netCDF group attributes.
.. versionadded:: (cfdm) 1.8.6
"""
def nc_group_attributes(self, values=False):
"""Returns properties to write as netCDF group attributes.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `write`, `nc_clear_group_attributes`,
`nc_set_group_attribute`, `nc_set_group_attributes`
:Parameters:
values: `bool`, optional
Return the value (rather than `None`) for any group
attribute that has, by definition, the same value as a
construct property.
:Returns:
`dict`
The selection of properties requested for writing to
netCDF group attributes.
**Examples:**
>>> f.nc_group_attributes()
{'comment': None}
>>> f.nc_set_group_attribute('foo')
>>> f.nc_group_attributes()
{'comment': None, 'foo': None}
>>> f.nc_set_group_attribute('foo', 'bar')
>>> f.nc_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes(values=True)
{'comment': 'forecast comment', 'foo': 'bar'}
>>> f.nc_clear_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes()
{}
"""
out = self._get_component("netcdf").get("group_attributes")
if out is None:
return {}
out = out.copy()
if values:
# Replace a None value with the value from the variable
# properties
properties = self.properties()
if properties:
for prop, value in out.items():
if value is None and prop in properties:
out[prop] = properties[prop]
return out
def nc_clear_group_attributes(self):
"""Removes properties to write as netCDF group attributes.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `write`, `nc_group_attributes`,
`nc_set_group_attribute`, `nc_set_group_attributes`
:Returns:
`dict`
The removed selection of properties requested for writing
to netCDF group attributes.
**Examples:**
>>> f.nc_group_attributes()
{'comment': None}
>>> f.nc_set_group_attribute('foo')
>>> f.nc_group_attributes()
{'comment': None, 'foo': None}
>>> f.nc_set_group_attribute('foo', 'bar')
>>> f.nc_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes(values=True)
{'comment': 'forecast comment', 'foo': 'bar'}
>>> f.nc_clear_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes()
{}
"""
out = self._get_component("netcdf").get("group_attributes")
if out is None:
out = {}
self._get_component("netcdf")["group_attributes"] = {}
return out
def nc_set_group_attribute(self, prop, value=None):
"""Select a property to be written as a netCDF group attribute.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `write`, `nc_group_attributes`,
`nc_clear_group_attributes`,
`nc_set_group_attributes`
:Parameters:
prop: `str`
Select the property to be written (if possible) as a
netCDF group attribute.
value: optional
The value of the netCDF group attribute, which will be
created (if possible) in addition to the property as
written to a netCDF data variable. If unset (or
`None`) then this acts as an instruction to write the
property (if possible) to a netCDF group attribute
instead of to a netCDF data variable.
:Returns:
`None`
**Examples:**
>>> f.nc_group_attributes()
{'comment': None}
>>> f.nc_set_group_attribute('foo')
>>> f.nc_group_attributes()
{'comment': None, 'foo': None}
>>> f.nc_set_group_attribute('foo', 'bar')
>>> f.nc_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes(values=True)
{'comment': 'forecast comment', 'foo': 'bar'}
>>> f.nc_clear_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes()
{}
"""
out = self._get_component("netcdf").get("group_attributes")
if out is None:
out = {}
out[prop] = value
self._get_component("netcdf")["group_attributes"] = out
def nc_set_group_attributes(self, properties, copy=True):
"""Set properties to be written as netCDF group attributes.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `write`, `nc_clear_group_attributes`,
`nc_group_attributes`, `nc_set_group_attribute`
:Parameters:
properties: `dict`
Set the properties be written as a netCDF group
attribute from the dictionary supplied. The value of a
netCDF group attribute, which will be created (if
possible) in addition to the property as written to a
netCDF data variable. If a value of `None` is used
then this acts as an instruction to write the property
(if possible) to a netCDF group attribute instead of
to a netCDF data variable.
*Parameter example:*
``properties={'Conventions': None, 'project': 'research'}``
copy: `bool`, optional
If False then any property values provided by the
*properties* parameter are not copied before
insertion. By default they are deep copied.
:Returns:
`None`
**Examples:**
>>> f.nc_group_attributes()
{'comment': None}
>>> f.nc_set_group_attribute('foo')
>>> f.nc_group_attributes()
{'comment': None, 'foo': None}
>>> f.nc_set_group_attribute('foo', 'bar')
>>> f.nc_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes(values=True)
{'comment': 'forecast comment', 'foo': 'bar'}
>>> f.nc_clear_group_attributes()
{'comment': None, 'foo': 'bar'}
>>> f.nc_group_attributes()
{}
"""
if copy:
properties = deepcopy(properties)
else:
properties = properties.copy()
out = self._get_component("netcdf").get("group_attributes")
if out is None:
out = {}
out.update(properties)
self._get_component("netcdf")["group_attributes"] = out
class NetCDFUnlimitedDimensions(NetCDF):
"""Mixin class for accessing netCDF unlimited dimensions.
.. versionadded:: (cfdm) 1.7.0
Deprecated at version 1.7.4
"""
def nc_unlimited_dimensions(self):
"""Returns domain axes to write as netCDF unlimited dimensions.
By default output netCDF dimensions are not unlimited.
.. versionadded:: (cfdm) 1.7.0
Deprecated at version 1.7.4
.. seealso:: `write`, `nc_clear_unlimited_dimensions`,
`nc_set_unlimited_dimensions`
:Returns:
`set`
The selection of domain axis constructs to be written as
netCDF unlimited dimensions.
**Examples:**
>>> f.nc_set_unlimited_dimensions(['domainaxis0'])
>>> f.nc_unlimited_dimensions()
{'domainaxis0'}
>>> f.nc_set_unlimited_dimensions(['domainaxis1'])
>>> f.nc_unlimited_dimensions()
{'domainaxis0', 'domainaxis1'}
>>> f.nc_clear_unlimited_dimensions()
{'domainaxis0', 'domainaxis1'}
>>> f.nc_unlimited_dimensions()
set()
"""
raise DeprecationError(
"Field.nc_unlimited_dimensions was deprecated at version 1.7.4 "
"and is no longer available. Use DomainAxis.nc_is_unlimited "
"instead."
)
def nc_set_unlimited_dimensions(self, axes):
"""Selects domain axes to write as netCDF unlimited dimensions.
By default output netCDF dimensions are not unlimited.
.. versionadded:: (cfdm) 1.7.0
Deprecated at version 1.7.4
.. seealso:: `write`, `nc_unlimited_dimensions`,
`nc_clear_unlimited_dimensions`
:Parameters:
axes: sequence of `str`, optional
Select the domain axis constructs from the sequence
provided. Domain axis constructs are identified by their
construct identifiers.
*Parameter example:*
``axes=['domainaxis0', 'domainaxis1']``
*Parameter example:*
``axes=()``
:Returns:
`None`
**Examples:**
>>> f.nc_set_unlimited_dimensions(['domainaxis0'])
>>> f.nc_unlimited_dimensions()
{'domainaxis0'}
>>> f.nc_set_unlimited_dimensions(['domainaxis1'])
>>> f.nc_unlimited_dimensions()
{'domainaxis0', 'domainaxis1'}
>>> f.nc_clear_unlimited_dimensions()
{'domainaxis0', 'domainaxis1'}
>>> f.nc_unlimited_dimensions()
set()
"""
raise DeprecationError(
"Field.nc_set_unlimited_dimensions was deprecated at version "
"1.7.4 and is no longer available."
"Use DomainAxis.nc_set_unlimited instead."
)
def nc_clear_unlimited_dimensions(self):
"""Removes domain axes to write as netCDF unlimited dimensions.
By default output netCDF dimensions are not unlimited.
.. versionadded:: (cfdm) 1.7.0
Deprecated at version 1.7.4
.. seealso:: `write`, `nc_unlimited_dimensions`,
`nc_set_unlimited_dimensions`
:Returns:
`set`
The selection of domain axis constructs that has been removed.
**Examples:**
>>> f.nc_set_unlimited_dimensions(['domainaxis0'])
>>> f.nc_unlimited_dimensions()
{'domainaxis0'}
>>> f.nc_set_unlimited_dimensions(['domainaxis1'])
>>> f.nc_unlimited_dimensions()
{'domainaxis0', 'domainaxis1'}
>>> f.nc_clear_unlimited_dimensions()
{'domainaxis0', 'domainaxis1'}
>>> f.nc_unlimited_dimensions()
set()
"""
raise DeprecationError(
"Field.nc_clear_unlimited_dimensions was deprecated at version "
"1.7.4 and is no longer available."
"Use DomainAxis.nc_set_unlimited instead."
)
class NetCDFExternal(NetCDF):
"""Mixin class for accessing the netCDF external variable status.
.. versionadded:: (cfdm) 1.7.0
"""
def nc_get_external(self):
"""Whether a construct matches an external netCDF variable.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_set_external`
:Returns:
`bool`
The external status.
**Examples:**
>>> c.nc_get_external()
False
>>> c.nc_set_external(True)
>>> c.nc_get_external()
True
"""
return self._get_component("netcdf").get("external", False)
def nc_set_external(self, external):
"""Set external status of a netCDF variable.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `nc_get_external`
:Parameters:
external: `bool`, optional
Set the external status.
*Parameter example:*
``external=True``
:Returns:
`None`
**Examples:**
>>> c.nc_get_external()
False
>>> c.nc_set_external(True)
>>> c.nc_get_external()
True
"""
self._get_component("netcdf")["external"] = bool(external)
class NetCDFGeometry(NetCDF, _NetCDFGroupsMixin):
"""Mixin to access the netCDF geometry container variable name.
.. versionadded:: (cfdm) 1.8.0
"""
def nc_del_geometry_variable(self, default=ValueError()):
"""Remove the netCDF geometry container variable name.
.. versionadded:: (cfdm) 1.8.0
.. seealso:: `nc_get_geometry_variable`,
`nc_has_geometry_variable`,
`nc_set_geometry_variable`
:Parameters:
default: optional
Return the value of the *default* parameter if the netCDF
dimension name has not been set. If set to an `Exception`
instance then it will be raised instead.
:Returns:
`str`
The removed netCDF geometry container variable name.
**Examples:**
>>> f.nc_set_geometry_variable('geometry')
>>> f.nc_has_geometry_variable()
True
>>> f.nc_get_geometry_variable()
'geometry'
>>> f.nc_del_geometry_variable()
'geometry'
>>> f.nc_has_geometry_variable()
False
>>> print(f.nc_get_geometry_variable(None))
None
>>> print(f.nc_del_geometry_variable(None))
None
"""
try:
return self._get_component("netcdf").pop("geometry_variable")
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF geometry variable name",
)
def nc_get_geometry_variable(self, default=ValueError()):
"""Return the netCDF geometry container variable name.
.. versionadded:: (cfdm) 1.8.0
.. seealso:: `nc_del_geometry_variable`,
`nc_has_geometry_variable`,
`nc_set_geometry_variable`
:Parameters:
default: optional
Return the value of the *default* parameter if the
netCDF dimension name has not been set. If set to an
`Exception` instance then it will be raised instead.
:Returns:
`str`
The netCDF geometry container variable name.
**Examples:**
>>> f.nc_set_geometry_variable('geometry')
>>> f.nc_has_geometry_variable()
True
>>> f.nc_get_geometry_variable()
'geometry'
>>> f.nc_del_geometry_variable()
'geometry'
>>> f.nc_has_geometry_variable()
False
>>> print(f.nc_get_geometry_variable(None))
None
>>> print(f.nc_del_geometry_variable(None))
None
"""
try:
return self._get_component("netcdf")["geometry_variable"]
except KeyError:
if default is None:
return default
return self._default(
default,
f"{self.__class__.__name__} has no netCDF geometry variable name",
)
def nc_has_geometry_variable(self):
"""Whether a netCDF geometry container variable has a name.
.. versionadded:: (cfdm) 1.8.0
.. seealso:: `nc_del_geometry_variable`,
`nc_get_geometry_variable`,
`nc_set_geometry_variable`
:Returns:
`bool`
`True` if the netCDF geometry container variable name has
been set, otherwise `False`.
**Examples:**
>>> f.nc_set_geometry_variable('geometry')
>>> f.nc_has_geometry_variable()
True
>>> f.nc_get_geometry_variable()
'geometry'
>>> f.nc_del_geometry_variable()
'geometry'
>>> f.nc_has_geometry_variable()
False
>>> print(f.nc_get_geometry_variable(None))
None
>>> print(f.nc_del_geometry_variable(None))
None
"""
return "geometry_variable" in self._get_component("netcdf")
def nc_set_geometry_variable(self, value):
"""Set the netCDF geometry container variable name.
If there are any ``/`` (slash) characters in the netCDF name
then these act as delimiters for a group hierarchy. By
default, or if the name starts with a ``/`` character and
contains no others, the name is assumed to be in the root
group.
.. versionadded:: (cfdm) 1.8.0
.. seealso:: `nc_del_geometry_variable`,
`nc_get_geometry_variable`,
`nc_has_geometry_variable`
:Parameters:
value: `str`
The value for the netCDF geometry container variable name.
:Returns:
`None`
**Examples:**
>>> f.nc_set_geometry_variable('geometry')
>>> f.nc_has_geometry_variable()
True
>>> f.nc_get_geometry_variable()
'geometry'
>>> f.nc_del_geometry_variable()
'geometry'
>>> f.nc_has_geometry_variable()
False
>>> print(f.nc_get_geometry_variable(None))
None
>>> print(f.nc_del_geometry_variable(None))
None
"""
if not value or value == "/":
raise ValueError(
f"Invalid netCDF geometry variable name: {value!r}"
)
if "/" in value:
if not value.startswith("/"):
raise ValueError(
"A netCDF geometry variable name with a group structure "
f"must start with a '/'. Got {value!r}"
)
if value.count("/") == 1:
value = value[1:]
elif value.endswith("/"):
raise ValueError(
"A netCDF geometry variable name with a group structure "
f"can't end with a '/'. Got {value!r}"
)
self._get_component("netcdf")["geometry_variable"] = value
def nc_geometry_variable_groups(self):
"""Return the netCDF geometry variable group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_geometry_variable_groups`,
`nc_set_geometry_variable_groups`
:Returns:
`tuple` of `str`
The group structure.
**Examples:**
>>> f.nc_set_geometry_variable('geometry1')
>>> f.nc_geometry_variable_groups()
()
>>> f.nc_set_geometry_variable_groups(['forecast', 'model'])
>>> f.nc_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_get_geometry_variable()
'/forecast/model/geometry1'
>>> f.nc_clear_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_get_geometry_variable()
'geometry1'
>>> f.nc_set_geometry_variable('/forecast/model/geometry1')
>>> f.nc_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_del_geometry_variable('/forecast/model/geometry1')
'/forecast/model/geometry1'
>>> f.nc_geometry_variable_groups()
()
"""
return self._nc_groups(nc_get=self.nc_get_geometry_variable)
def nc_set_geometry_variable_groups(self, groups):
"""Set the netCDF geometry variable group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
An alternative technique for setting the group structure is to
set the netCDF variable name, with `nc_set_geometry_variable`,
with the group structure delimited by ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_clear_geometry_variable_groups`,
`nc_geometry_variable_groups`
:Parameters:
groups: sequence of `str`
The new group structure.
:Returns:
`tuple` of `str`
The group structure prior to being reset.
**Examples:**
>>> f.nc_set_geometry_variable('geometry1')
>>> f.nc_geometry_variable_groups()
()
>>> f.nc_set_geometry_variable_groups(['forecast', 'model'])
>>> f.nc_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_get_geometry_variable()
'/forecast/model/geometry1'
>>> f.nc_clear_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_get_geometry_variable()
'geometry1'
>>> f.nc_set_geometry_variable('/forecast/model/geometry1')
>>> f.nc_geometry__variablegroups()
('forecast', 'model')
>>> f.nc_del_geometry_variable('/forecast/model/geometry1')
'/forecast/model/geometry1'
>>> f.nc_geometry_variable_groups()
()
"""
return self._nc_set_groups(
groups,
nc_get=self.nc_get_geometry_variable,
nc_set=self.nc_set_geometry_variable,
nc_groups=self.nc_geometry_variable_groups,
)
def nc_clear_geometry_variable_groups(self):
"""Remove the netCDF geometry variable group hierarchy.
The group hierarchy is defined by the netCDF name. Groups are
delimited by ``/`` (slash) characters in the netCDF name. The
groups are returned, in hierarchical order, as a sequence of
strings. If the name is not set, or contains no ``/``
characters then an empty sequence is returned, signifying the
root group.
An alternative technique for removing the group structure is
to set the netCDF variable name, with
`nc_set_geometry_variable`, with no ``/`` characters.
.. versionadded:: (cfdm) 1.8.6
.. seealso:: `nc_geometry_variable_groups`,
`nc_set_geometry_variable_groups`
:Returns:
`tuple` of `str`
The removed group structure.
**Examples:**
>>> f.nc_set_geometry_variable('geometry1')
>>> f.nc_geometry_variable_groups()
()
>>> f.nc_set_geometry_variable_groups(['forecast', 'model'])
>>> f.nc_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_get_geometry_variable()
'/forecast/model/geometry1'
>>> f.nc_clear_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_get_geometry_variable()
'geometry1'
>>> f.nc_set_geometry_variable('/forecast/model/geometry1')
>>> f.nc_geometry_variable_groups()
('forecast', 'model')
>>> f.nc_del_geometry_variable('/forecast/model/geometry1')
'/forecast/model/geometry1'
>>> f.nc_geometry_variable_groups()
()
"""
return self._nc_clear_groups(
nc_get=self.nc_get_geometry_variable,
nc_set=self.nc_set_geometry_variable,
nc_groups=self.nc_geometry_variable_groups,
)
class NetCDFHDF5(NetCDF):
"""Mixin class for accessing the netCDF HDF5 chunksizes.
.. versionadded:: (cfdm) 1.7.2
"""
def nc_hdf5_chunksizes(self):
"""Return the HDF5 chunksizes for the data.
.. note:: Chunksizes are cleared from the output of methods that
change the data shape.
.. note:: Chunksizes are ignored for netCDF3 files that do not use
HDF5.
.. versionadded:: (cfdm) 1.7.2
.. seealso:: `nc_clear_hdf5_chunksizes`, `nc_set_hdf5_chunksizes`
:Returns:
`tuple`
The current chunksizes.
**Examples:**
>>> d.shape
(1, 96, 73)
>>> d.nc_set_hdf5_chunksizes([1, 48, 73])
>>> d.nc_hdf5_chunksizes()
(1, 48, 73)
>>> d.nc_clear_hdf5_chunksizes()
(1, 48, 73)
>>> d.nc_hdf5_chunksizes()
()
"""
return self._get_component("netcdf").get("hdf5_chunksizes", ())
def nc_clear_hdf5_chunksizes(self):
"""Clear the HDF5 chunksizes for the data.
.. note:: Chunksizes are cleared from the output of methods that
change the data shape.
.. note:: Chunksizes are ignored for netCDF3 files that do not use
HDF5.
.. versionadded:: (cfdm) 1.7.2
.. seealso:: `nc_hdf5_chunksizes`, `nc_set_hdf5_chunksizes`
:Returns:
`tuple`
The chunksizes defined prior to being cleared.
**Examples:**
>>> d.shape
(1, 96, 73)
>>> d.nc_set_hdf5_chunksizes([1, 48, 73])
>>> d.nc_hdf5_chunksizes()
(1, 48, 73)
>>> d.nc_clear_hdf5_chunksizes()
(1, 48, 73)
>>> d.nc_hdf5_chunksizes()
()
"""
return self._get_component("netcdf").pop("hdf5_chunksizes", ())
def nc_set_hdf5_chunksizes(self, chunksizes):
"""Set the HDF5 chunksizes for the data.
.. note:: Chunksizes are cleared from the output of methods that
change the data shape.
.. note:: Chunksizes are ignored for netCDF3 files that do not use
HDF5.
.. versionadded:: (cfdm) 1.7.2
.. seealso:: `nc_hdf5_chunksizes`, `nc_clear_hdf5_chunksizes`
:Parameters:
chunksizes: sequence of `int`
The chunksizes for each dimension. Can be integers from 0
to the dimension size.
:Returns:
`None`
**Examples:**
>>> d.shape
(1, 96, 73)
>>> d.nc_set_hdf5_chunksizes([1, 48, 73])
>>> d.nc_hdf5_chunksizes()
(1, 48, 73)
>>> d.nc_clear_hdf5_chunksizes()
(1, 48, 73)
>>> d.nc_hdf5_chunksizes()
()
"""
try:
shape = self.shape
except AttributeError:
pass
else:
if len(chunksizes) != len(shape):
raise ValueError(
"chunksizes must be a sequence with the same length "
"as dimensions"
)
for i, j in zip(chunksizes, shape):
if i < 0:
raise ValueError("chunksize cannot be negative")
if i > j:
raise ValueError("chunksize cannot exceed dimension size")
self._get_component("netcdf")["hdf5_chunksizes"] = tuple(chunksizes)
class NetCDFUnlimitedDimension(NetCDF):
"""Mixin class for accessing a netCDF unlimited dimension.
.. versionadded:: (cfdm) 1.7.4
"""
def nc_is_unlimited(self):
"""Inspect the unlimited status of the a netCDF dimension.
By default output netCDF dimensions are not unlimited. The
status is used by the `write` function.
.. versionadded:: (cfdm) 1.7.4
.. seealso:: `nc_set_unlimited`
:Returns:
`bool`
The existing unlimited status. True and False signify
"unlimited" and "not unlimited" respectively.
**Examples:**
>>> da = f.domain_axis('domainaxis1')
>>> da.nc_is_unlimited()
False
>>> da.nc_set_unlimited(True)
>>> da.nc_is_unlimited()
True
>>> da.nc_set_unlimited(False)
False
>>> da.nc_is_unlimited()
True
"""
return self._get_component("netcdf").get("unlimited", False)
def nc_set_unlimited(self, value):
"""Set the unlimited status of the a netCDF dimension.
By default output netCDF dimensions are not unlimited. The
status is used by the `write` function.
.. versionadded:: (cfdm) 1.7.4
.. seealso:: `nc_is_unlimited`
:Parameters:
value: `bool`
The new unlimited status. True and False signify
"unlimited" and "not unlimited" respectively.
:Returns:
`None`
**Examples:**
>>> da = f.domain_axis('domainaxis1')
>>> da.nc_is_unlimited()
False
>>> da.nc_set_unlimited(True)
>>> da.nc_is_unlimited()
True
>>> da.nc_set_unlimited(False)
False
>>> da.nc_is_unlimited()
True
"""
self._get_component("netcdf")["unlimited"] = bool(value)
class NetCDFComponents(NetCDF):
"""Mixin class for netCDF fetaure common to many constructs.
Accesses netCDF names consistently across multiple metadata
constructs.
Assumes that the mixin classes `NetCDFDimension` and
`NetCDFVariable` have also been subclassed.
Assumes that the methods `_get_data_compression_variables` and
`_get_coordinate_geometry_variables` have been defined elsewhere.
.. versionadded:: (cfdm) 1.8.9.0
"""
def nc_set_component_variable(self, component, value):
"""Set the netCDF variable name for components.
Sets the netCDF variable name for all components of a given
type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_variable`,
`nc_set_component_variable_groups`,
`nc_clear_component_variable_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'node_count'`` Node count variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
``'list'`` List variables for compression
by gathering
===================== ===============================
value: `str`
The netCDF variable name to be set for each component.
:Returns:
`None`
**Examples:**
>>> f.nc_set_component_variable('interior_ring', 'interiorring_1')
"""
if component in ("count", "index", "list"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "node_count", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_set_variable(value)
def nc_del_component_variable(self, component):
"""Remove the netCDF variable name of components.
Removes the netCDF variable name for all components of a given
type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_set_component_variable`,
`nc_set_component_variable_groups`,
`nc_clear_component_variable_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'node_count'`` Node count variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
``'list'`` List variables for compression
by gathering
===================== ===============================
:Returns:
`None`
**Examples:**
>>> f.nc_del_component_variable('interior_ring')
"""
if component in ("count", "index", "list"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "node_count", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_del_variable(None)
def nc_set_component_variable_groups(self, component, groups):
"""Set the netCDF variable groups of components.
Sets the netCDF variable groups for all components of a given
type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_variable`,
`nc_set_component_variable`,
`nc_clear_component_variable_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'node_count'`` Node count variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
``'list'`` List variables for compression
by gathering
===================== ===============================
groups: sequence of `str`
The new group structure for each component.
:Returns:
`None`
**Examples:**
>>> f.nc_set_component_variable_groups('interior_ring', ['forecast'])
"""
if component in ("count", "index", "list"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "node_count", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_set_variable_groups(groups)
def nc_clear_component_variable_groups(self, component):
"""Remove the netCDF variable groups of components.
Removes the netCDF variable groups for all components of a
given type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_variable`,
`nc_set_component_variable`,
`nc_set_component_variable_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'node_count'`` Node count variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
``'list'`` List variables for compression
by gathering
===================== ===============================
:Returns:
`None`
**Examples:**
>>> f.nc_clear_component_variable_groups('interior_ring')
"""
if component in ("count", "index", "list"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "node_count", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_clear_variable_groups()
def nc_set_component_dimension(self, component, value):
"""Set the netCDF dimension name of components.
Sets the netCDF dimension name for all components of a given
type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_dimension`,
`nc_set_component_dimension_groups`,
`nc_clear_component_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
value: `str`
The netCDF dimension name to be set for each component.
:Returns:
`None`
**Examples:**
>>> f.nc_set_component_dimension('interior_ring', 'part')
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_set_dimension(value)
def nc_del_component_dimension(self, component):
"""Remove the netCDF dimension name of components.
Removes the netCDF dimension name for all components of a
given type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_set_component_dimension`,
`nc_set_component_dimension_groups`,
`nc_clear_component_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
:Returns:
`None`
**Examples:**
>>> f.nc_del_component_dimension('interior_ring')
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_del_dimension(None)
def nc_set_component_dimension_groups(self, component, groups):
"""Set the netCDF dimension groups of components.
Sets the netCDF dimension groups for all components of a given
type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_dimension`,
`nc_set_component_dimension`,
`nc_clear_component_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
groups: sequence of `str`
The new group structure for each component.
:Returns:
`None`
**Examples:**
>>> f.nc_set_component_dimension_groups('interior_ring', ['forecast'])
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_set_dimension_groups(groups)
def nc_clear_component_dimension_groups(self, component):
"""Remove the netCDF dimension groups of components.
Removes the netCDF dimension groups for all components of a
given type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_dimension`,
`nc_set_component_dimension`,
`nc_set_component_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'interior_ring'`` Interior ring variables for
geometry coordinates
``'part_node_count'`` Part node count variables for
geometry coordinates
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
:Returns:
`None`
**Examples:**
>>> f.nc_clear_component_dimension_groups('interior_ring')
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
elif component in ("interior_ring", "part_node_count"):
variables = self._get_coordinate_geometry_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_clear_dimension_groups()
def nc_set_component_sample_dimension(self, component, value):
"""Set the netCDF sample dimension name of components.
Sets the netCDF sample dimension name for all components of a
given type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_sample_dimension`,
`nc_set_component_sample_dimension_groups`,
`nc_clear_component_sample_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
value: `str`
The netCDF sample_dimension name to be set for each
component.
:Returns:
`None`
**Examples:**
>>> f.nc_set_component_sample_dimension('count', 'obs')
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_set_sample_dimension(value)
def nc_del_component_sample_dimension(self, component):
"""Remove the netCDF sample dimension name of components.
Removes the netCDF sample dimension name for all components of
a given type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_set_component_sample_dimension`,
`nc_set_component_sample_dimension_groups`,
`nc_clear_component_sample_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
:Returns:
`None`
**Examples:**
>>> f.nc_del_component_sample_dimension('count')
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_del_sample_dimension(None)
def nc_set_component_sample_dimension_groups(self, component, groups):
"""Set the netCDF sample dimension groups of components.
Sets the netCDF sample dimension groups for all components of
a given type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_sample_dimension`,
`nc_set_component_sample_dimension`,
`nc_clear_component_sample_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
groups: sequence of `str`
The new group structure for each component.
:Returns:
`None`
**Examples:**
>>> f.nc_set_component_sample_dimension_groups('count', ['forecast'])
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_set_sample_dimension_groups(groups)
def nc_clear_component_sample_dimension_groups(self, component):
"""Remove the netCDF sample dimension groups of components.
Removes the netCDF sample dimension groups for all components
of a given type.
Some components exist within multiple constructs, but when
written to a netCDF dataset the netCDF names associated with
such components will be arbitrarily taken from one of
them. The netCDF names can be set on all such occurrences
individually, or preferably by using this method to ensure
consistency across all such components.
.. versionadded:: (cfdm) 1.8.6.0
.. seealso:: `nc_del_component_sample_dimension`,
`nc_set_component_sample_dimension`,
`nc_set_component_sample_dimension_groups`
:Parameters:
component: `str`
Specify the component type. One of:
===================== ===============================
*component* Description
===================== ===============================
``'count'`` Count variables for contiguous
ragged arrays
``'index'`` Index variables for indexed
ragged arrays
===================== ===============================
:Returns:
`None`
**Examples:**
>>> f.nc_del_component_sample_dimension_groups('count')
"""
if component in ("count", "index"):
variables = self._get_data_compression_variables(component)
else:
raise ValueError(f"Invalid component: {component!r}")
for v in variables:
v.nc_clear_sample_dimension_groups()
class NetCDFUnreferenced:
"""Mixin class for constructs of unrefereced netCDF variables.
.. versionadded:: (cfdm) 1.8.9.0
"""
def _set_dataset_compliance(self, value, copy=True):
"""Set the dataset compliance report.
Set the report of problems encountered whilst reading the
construct from a dataset.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `dataset_compliance`
:Parameters:
value: `dict`
The value of the ``dataset_compliance`` component. This
will be deep copied.
copy: `bool`, optional
If False then the compliance report dictionary is not
copied prior to insertion.
:Returns:
`None`
**Examples:**
"""
self._set_component("dataset_compliance", value, copy=copy)
def dataset_compliance(self, display=False):
"""Return the dataset compliance report.
A report of problems encountered whilst reading the construct
from a dataset.
If the dataset is partially CF-compliant to the extent that it
is not possible to unambiguously map an element of the netCDF
dataset to an element of the CF data model, then a construct
is still returned by the `read` function, but may be
incomplete.
Such "structural" non-compliance would occur, for example, if
the ``coordinates`` attribute of a CF-netCDF data variable
refers to another variable that does not exist, or refers to a
variable that spans a netCDF dimension that does not apply to
the data variable.
Other types of non-compliance are not checked, such whether or
not controlled vocabularies have been adhered to.
When a dictionary is returned, the compliance report may be
updated by changing the dictionary in-place.
.. versionadded:: (cfdm) 1.7.0
.. seealso:: `{{package}}.read`, `_set_dataset_compliance`
:Parameters:
display: `bool`, optional
If True print the compliance report. By default the report
is returned as a dictionary.
:Returns:
`None` or `dict`
The report. If *display* is True then the report is
printed and `None` is returned. Otherwise the report is
returned as a dictionary.
**Examples:**
If no problems were encountered, an empty dictionary is returned:
>>> f = {{package}}.example_field(1)
>>> cfdm.write(f, 'example.nc')
>>> g = {{package}}.read('example.nc')[0]
>>> g.dataset_compliance()
{}
"""
d = self._get_component("dataset_compliance", {})
if not display:
return d
if not d:
print(d)
return
for key0, value0 in d.items():
print(f"{{{key0!r}:")
print(f" CF version: {value0['CF version']!r},")
print(f" dimensions: {value0['dimensions']!r},")
print(" non-compliance: {")
for key1, value1 in sorted(value0["non-compliance"].items()):
for x in value1:
print(f" {key1!r}: [")
print(
" {{{0}}},".format(
"\n ".join(
[
f"{key2!r}: {value2!r},"
for key2, value2 in sorted(x.items())
]
)
)
)
print(" ],")
print(" },")
| 31.69042 | 82 | 0.549484 | 11,316 | 107,177 | 5.013521 | 0.03685 | 0.017767 | 0.008672 | 0.013537 | 0.908572 | 0.895898 | 0.87628 | 0.844923 | 0.834488 | 0.823401 | 0 | 0.006266 | 0.340306 | 107,177 | 3,381 | 83 | 31.699793 | 0.796136 | 0.641145 | 0 | 0.599237 | 0 | 0 | 0.162988 | 0.017468 | 0 | 0 | 0 | 0 | 0 | 1 | 0.122137 | false | 0.003817 | 0.001908 | 0 | 0.257634 | 0.017176 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
75bb8d1fa809b63ca392da9d2c7936c56c688827 | 44 | py | Python | __init__.py | jhs7jhs/emilator | ebd7ba2601bf2077f6670365778a16d1e550db2f | [
"MIT"
] | null | null | null | __init__.py | jhs7jhs/emilator | ebd7ba2601bf2077f6670365778a16d1e550db2f | [
"MIT"
] | null | null | null | __init__.py | jhs7jhs/emilator | ebd7ba2601bf2077f6670365778a16d1e550db2f | [
"MIT"
] | null | null | null | from .emilator import *
from . import errors | 22 | 23 | 0.772727 | 6 | 44 | 5.666667 | 0.666667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.159091 | 44 | 2 | 24 | 22 | 0.918919 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
f9d6c2ebd00f9fe4f8bf1eb128813c309ad437c8 | 6,665 | py | Python | autodh/autodh.py | OsaroAI/AutoDH | 156ed4dea7408dcc981468dd5c2e0c2bd41a045f | [
"MIT"
] | 7 | 2018-11-27T21:57:49.000Z | 2021-12-20T07:32:51.000Z | autodh/autodh.py | EdsterG/AutoDH | 156ed4dea7408dcc981468dd5c2e0c2bd41a045f | [
"MIT"
] | 1 | 2021-09-03T00:17:03.000Z | 2021-09-10T22:13:42.000Z | autodh/autodh.py | OsaroAI/AutoDH | 156ed4dea7408dcc981468dd5c2e0c2bd41a045f | [
"MIT"
] | 3 | 2020-11-30T12:19:06.000Z | 2021-12-20T07:32:54.000Z | import numpy as np
from . import math_utils
from .dh_table import DHTable
from .joint import Joint
def _compute_row_in_standard_dh_table(z1, x1, o1, z2, x2, o2):
"""Given two frames, compute a row in the Denavit-Hartenberg table
using the standard convention
:param z1: z-axis of first frame, as numpy array with shape (3,)
:param x1: x-axis of first frame, as numpy array with shape (3,)
:param o1: origin of first frame, as numpy array with shape (3,)
:param z2: z-axis of second frame, as numpy array with shape (3,)
:param x2: x-axis of second frame, as numpy array with shape (3,)
:param o2: origin of second frame, as numpy array with shape (3,)
:returns: next row in dh table (a, alpha, d, theta)
"""
alpha = np.arctan2(np.cross(z1, z2).dot(x2), z1.dot(z2))
theta = np.arctan2(np.cross(x1, x2).dot(z1), x1.dot(x2))
a = (o2 - o1).dot(x2)
d = (o2 - o1).dot(z1)
return d, theta, a, alpha
def _compute_row_in_modified_dh_table(z1, x1, o1, z2, x2, o2):
"""Given two frames, compute a row in the Denavit-Hartenberg table
using the modified convention
:param z1: z-axis of first frame, as numpy array with shape (3,)
:param x1: x-axis of first frame, as numpy array with shape (3,)
:param o1: origin of first frame, as numpy array with shape (3,)
:param z2: z-axis of second frame, as numpy array with shape (3,)
:param x2: x-axis of second frame, as numpy array with shape (3,)
:param o2: origin of second frame, as numpy array with shape (3,)
:returns: next row in dh table (a, alpha, d, theta)
"""
alpha = np.arctan2(np.cross(z1, z2).dot(x1), z1.dot(z2))
theta = np.arctan2(np.cross(x1, x2).dot(z2), x1.dot(x2))
a = (o2 - o1).dot(x1)
d = (o2 - o1).dot(z2)
return d, theta, a, alpha
def _get_standard_dh_parameters(joints, base_frame, ee_frame):
"""Compute the standard Denavit-Hartenberg parameters
:param joints: list of Joints
:param base_frame: homogenous matrix representing the base frame, as numpy array with shape (4, 4)
:param ee_frame: homogenous matrix representing the end-effector frame, as numpy array with shape (4, 4)
:returns: (d, theta, a, alpha, joint_types), all as iterable objects
"""
# Create a list of partial frames
partial_frames = []
partial_frames.append([base_frame[:3, 3], base_frame[:3, 0], base_frame[:3, 2], Joint.Type.Fixed])
for j in joints:
partial_frames.append([j.anchor, None, j.axis, j.type])
partial_frames.append([ee_frame[:3, 3], None, ee_frame[:3, 2], Joint.Type.Fixed])
partial_frames.append([ee_frame[:3, 3], ee_frame[:3, 0], ee_frame[:3, 2], Joint.Type.Fixed])
# Determine x-axis for each partial frame
frames = [partial_frames[0]]
for i in range(1, len(partial_frames) - 1):
o0, x0, z0, _ = frames[i - 1]
o1, _, z1, jt = partial_frames[i]
x1, _, o1_p = math_utils.common_perpendicular_and_intersection_points(o0, z0, o1, z1, cp_hint=x0)
if np.allclose(x0.dot(x1), -1):
x1 = -x1
frames.append([o1_p, x1, z1, jt])
frames.append(partial_frames[-1])
# Create the DH table
dh_table, joint_types = [], []
for i in range(len(frames) - 1):
o1, x1, z1, joint_type = frames[i]
o2, x2, z2, _ = frames[i + 1]
d, theta, a, alpha = _compute_row_in_standard_dh_table(z1, x1, o1, z2, x2, o2)
if np.allclose([d, theta, a, alpha], 0) and joint_type == Joint.Type.Fixed:
continue
dh_table.append([d, theta, a, alpha])
joint_types.append(joint_type)
d, theta, a, alpha = np.transpose(dh_table)
return d, theta, a, alpha, joint_types
def _get_modified_dh_parameters(joints, base_frame, ee_frame):
"""Compute the modified Denavit-Hartenberg parameters
:param joints: list of Joints
:param base_frame: homogenous matrix representing the base frame, as numpy array with shape (4, 4)
:param ee_frame: homogenous matrix representing the end-effector frame, as numpy array with shape (4, 4)
:returns: (d, theta, a, alpha, joint_types) all as iterable objects
"""
# Create a list of partial frames
partial_frames = []
partial_frames.append([base_frame[:3, 3], base_frame[:3, 0], base_frame[:3, 2], Joint.Type.Fixed])
partial_frames.append([base_frame[:3, 3], None, base_frame[:3, 2], Joint.Type.Fixed])
for j in joints:
partial_frames.append([j.anchor, None, j.axis, j.type])
partial_frames.append([ee_frame[:3, 3], ee_frame[:3, 0], ee_frame[:3, 2], Joint.Type.Fixed])
# Determine x-axis for each partial frame
frames = [partial_frames[0]]
for i in range(1, len(partial_frames) - 1):
_, x0, _, _ = frames[i - 1]
o1, _, z1, jt = partial_frames[i]
o2, _, z2, _ = partial_frames[i + 1]
x1, o1_p, _ = math_utils.common_perpendicular_and_intersection_points(o1, z1, o2, z2, cp_hint=x0)
if np.allclose(x0.dot(x1), -1):
x1 = -x1
frames.append([o1_p, x1, z1, jt])
frames.append(partial_frames[-1])
# Create the DH table
dh_table, joint_types = [], []
for i in range(1, len(frames)):
o0, x0, z0, _ = frames[i - 1]
o1, x1, z1, joint_type = frames[i]
d, theta, a, alpha = _compute_row_in_modified_dh_table(z0, x0, o0, z1, x1, o1)
if np.allclose([d, theta, a, alpha], 0) and joint_type == Joint.Type.Fixed:
continue
dh_table.append([d, theta, a, alpha])
joint_types.append(joint_type)
d, theta, a, alpha = np.transpose(dh_table)
return d, theta, a, alpha, joint_types
def get_dh_parameters(joints, base_frame, ee_frame, convention=DHTable.Convention.Standard):
"""Compute the Denavit-Hartenberg parameters
:param joints: list of Joints
:param base_frame: homogenous matrix representing the base frame, as numpy array with shape (4, 4)
:param ee_frame: homogenous matrix representing the end-effector frame, as numpy array with shape (4, 4)
:param convention: convention used to compute parameters, defaults to DHTable.Convention.Standard
:returns: (d, theta, a, alpha, joint_types) all as iterable objects
"""
if convention is DHTable.Convention.Modified:
return _get_modified_dh_parameters(joints, base_frame, ee_frame)
else:
return _get_standard_dh_parameters(joints, base_frame, ee_frame)
def create_dh_table(joints, base_frame, ee_frame, convention=DHTable.Convention.Standard):
d, theta, a, alpha, joint_types = get_dh_parameters(joints, base_frame, ee_frame, convention)
return DHTable(d, theta, a, alpha, joint_types, convention)
| 45.340136 | 108 | 0.664216 | 1,058 | 6,665 | 4.038752 | 0.102079 | 0.044231 | 0.05055 | 0.071612 | 0.903347 | 0.903347 | 0.874093 | 0.851158 | 0.840393 | 0.730166 | 0 | 0.037595 | 0.213803 | 6,665 | 146 | 109 | 45.650685 | 0.777863 | 0.362491 | 0 | 0.556962 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.075949 | false | 0 | 0.050633 | 0 | 0.21519 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
fb22b7c7073d099b9891b7d4aea1f514e82b158b | 6,951 | py | Python | tests/commands/test_anno_command.py | artur-shaik/wallabag-client | 6c03a3beebcf27f51076e0eb11bb99f618f8daa3 | [
"MIT"
] | 16 | 2020-09-30T23:08:45.000Z | 2022-03-30T02:34:17.000Z | tests/commands/test_anno_command.py | artur-shaik/wallabag-client | 6c03a3beebcf27f51076e0eb11bb99f618f8daa3 | [
"MIT"
] | 15 | 2020-11-05T09:22:38.000Z | 2022-03-11T16:56:18.000Z | tests/commands/test_anno_command.py | artur-shaik/wallabag-client | 6c03a3beebcf27f51076e0eb11bb99f618f8daa3 | [
"MIT"
] | 1 | 2021-04-02T11:00:57.000Z | 2021-04-02T11:00:57.000Z | # -*- coding: utf-8 -*-
import delorean
import humanize
from wallabag.config import Configs
from wallabag.api.api import Response
from wallabag.api.get_entry import GetEntry
from wallabag.api.delete_annotation import DeleteAnnotation
from wallabag.commands.anno import (
AnnoCommand, AnnoCommandParams, AnnoSubcommand)
class TestAnno():
def setup_method(self, method):
self.config = Configs("/tmp/config")
self.config.config.read_string("""
[api]
serverurl = url
username = user
password = pass
[oauth2]
client = 100
secret = 100
""")
def test_list_entry_annotations(self, monkeypatch):
def getentry_request(self):
return Response(
200, (
'{"id": 1, "title": "title",'
'"content": "<h1>head</h1>content", "url": "url",'
'"is_archived": 0, "is_starred": 1,'
'"annotations": [{'
'"user": "User", "annotator_schema_version":'
' "v1.0", "id": 1, "text": "content", '
'"created_at": "2020-10-28T10:50:51+0000", '
'"updated_at": "2020-10-28T10:50:51+0000", '
'"quote": "quote", "ranges": '
'[{"start": "/div[1]/p[1]", "startOffset": "23", '
'"end": "/div[1]/p[1]", "endOffset": "49"}]}]}'))
monkeypatch.setattr(GetEntry, 'request', getentry_request)
params = AnnoCommandParams()
params.entry_id = 1
result = AnnoCommand(self.config, params).execute()
assert result[0]
past = delorean.utcnow() - delorean.parse('2020-10-28T10:50:51+0000')
assert result[1] == f'1. quote ({humanize.naturaltime(past)}) [7]'
def test_remove_annotation(self, monkeypatch):
def request_success(self):
return Response(200, None)
monkeypatch.setattr(DeleteAnnotation, 'request', request_success)
params = AnnoCommandParams()
params.anno_id = 1
params.command = AnnoSubcommand.REMOVE
result = AnnoCommand(self.config, params).execute()
assert result[0]
assert result[1] == 'Annotation successfully deleted'
def test_show_annotations(self, monkeypatch):
def getentry_request(self):
return Response(
200, (
'{"id": 1, "title": "title",'
'"content": "<h1>head</h1>content", "url": "url",'
'"is_archived": 0, "is_starred": 1,'
'"annotations": [{'
'"user": "User", "annotator_schema_version":'
' "v1.0", "id": 1, "text": "content", '
'"created_at": "2020-10-28T10:50:51+0000", '
'"updated_at": "2020-10-28T10:50:51+0000", '
'"quote": "quote", "ranges": '
'[{"start": "/div[1]/p[1]", "startOffset": "23", '
'"end": "/div[1]/p[1]", "endOffset": "49"}]},{'
'"user": "User", "annotator_schema_version":'
' "v1.0", "id": 2, "text": "another content", '
'"created_at": "2020-10-28T10:50:51+0000", '
'"updated_at": "2020-10-28T10:50:51+0000", '
'"quote": "another quote", "ranges": '
'[{"start": "/div[1]/p[2]", "startOffset": "23", '
'"end": "/div[1]/p[2]", "endOffset": "49"}]}]}'))
monkeypatch.setattr(GetEntry, 'request', getentry_request)
params = AnnoCommandParams()
params.entry_id = 1
params.command = AnnoSubcommand.SHOW
result = AnnoCommand(self.config, params).execute()
assert result[0]
past = delorean.utcnow() - delorean.parse('2020-10-28T10:50:51+0000')
assert result[1] == (
f'1. quote ({humanize.naturaltime(past)}):\n\n\tcontent\n\n'
f'2. another quote ({humanize.naturaltime(past)}):'
'\n\n\tanother content\n')
def test_show_annotations_by_id(self, monkeypatch):
def getentry_request(self):
return Response(
200, (
'{"id": 1, "title": "title",'
'"content": "<h1>head</h1>content", "url": "url",'
'"is_archived": 0, "is_starred": 1,'
'"annotations": [{'
'"user": "User", "annotator_schema_version":'
' "v1.0", "id": 1, "text": "content", '
'"created_at": "2020-10-28T10:50:51+0000", '
'"updated_at": "2020-10-28T10:50:51+0000", '
'"quote": "quote", "ranges": '
'[{"start": "/div[1]/p[1]", "startOffset": "23", '
'"end": "/div[1]/p[1]", "endOffset": "49"}]},{'
'"user": "User", "annotator_schema_version":'
' "v1.0", "id": 2, "text": "another content", '
'"created_at": "2020-10-28T10:50:51+0000", '
'"updated_at": "2020-10-28T10:50:51+0000", '
'"quote": "another quote", "ranges": '
'[{"start": "/div[1]/p[2]", "startOffset": "23", '
'"end": "/div[1]/p[2]", "endOffset": "49"}]}]}'))
monkeypatch.setattr(GetEntry, 'request', getentry_request)
params = AnnoCommandParams()
params.entry_id = 1
params.anno_id = 2
params.command = AnnoSubcommand.SHOW
result = AnnoCommand(self.config, params).execute()
assert result[0]
past = delorean.utcnow() - delorean.parse('2020-10-28T10:50:51+0000')
assert result[1] == (
f'2. another quote ({humanize.naturaltime(past)}):'
'\n\n\tanother content\n')
def test_show_empty_params(self):
params = AnnoCommandParams()
params.command = AnnoSubcommand.SHOW
result = AnnoCommand(self.config, params).execute()
assert not result[0]
assert result[1] == 'Entry ID not specified'
def test_list_empty_params(self):
params = AnnoCommandParams()
params.command = AnnoSubcommand.LIST
result = AnnoCommand(self.config, params).execute()
assert not result[0]
assert result[1] == 'Entry ID not specified'
def test_remove_empty_params(self):
params = AnnoCommandParams()
params.command = AnnoSubcommand.REMOVE
result = AnnoCommand(self.config, params).execute()
assert not result[0]
assert result[1] == 'Annotation ID not specified'
| 42.907407 | 77 | 0.496331 | 680 | 6,951 | 4.980882 | 0.161765 | 0.023029 | 0.04222 | 0.049897 | 0.79628 | 0.795394 | 0.785061 | 0.785061 | 0.743431 | 0.741364 | 0 | 0.076433 | 0.344986 | 6,951 | 161 | 78 | 43.173913 | 0.667472 | 0.003021 | 0 | 0.720588 | 0 | 0 | 0.362009 | 0.099018 | 0 | 0 | 0 | 0 | 0.102941 | 1 | 0.088235 | false | 0.007353 | 0.051471 | 0.029412 | 0.176471 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
fb3b1f24bb1ba9ebc580b1a088c5cc3d7f8ce461 | 121 | py | Python | users/resources/__init__.py | marianojabdala/microservices | 4a020cb9d703f20baa40446d525363d159d008ac | [
"Apache-2.0"
] | 1 | 2018-04-20T20:12:31.000Z | 2018-04-20T20:12:31.000Z | users/resources/__init__.py | marianojabdala/microservices | 4a020cb9d703f20baa40446d525363d159d008ac | [
"Apache-2.0"
] | 17 | 2021-03-19T22:51:22.000Z | 2021-08-30T20:22:33.000Z | users/resources/__init__.py | marianojabdala/microservices | 4a020cb9d703f20baa40446d525363d159d008ac | [
"Apache-2.0"
] | 2 | 2018-04-20T20:12:36.000Z | 2018-10-07T15:37:46.000Z | # -*- coding: utf-8 -*-
"""Export the base and user resource."""
import users.resources.base
import users.resources.user
| 24.2 | 40 | 0.710744 | 17 | 121 | 5.058824 | 0.705882 | 0.255814 | 0.465116 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.009434 | 0.123967 | 121 | 4 | 41 | 30.25 | 0.801887 | 0.471074 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
34ca7e34e4092242a2e1b2f9a28ea7dea085410f | 30 | py | Python | pytorchgui/__init__.py | CallumJHays/pytorch-gui | 6df3eefeff20176a811c3c12989aeac588fa2f9b | [
"MIT"
] | 4 | 2018-09-10T12:17:01.000Z | 2021-08-16T04:42:07.000Z | pytorchgui/__init__.py | CallumJHays/pytorch-gui | 6df3eefeff20176a811c3c12989aeac588fa2f9b | [
"MIT"
] | 1 | 2019-10-29T17:21:10.000Z | 2019-10-29T17:21:10.000Z | pytorchgui/__init__.py | CallumJHays/pytorch-gui | 6df3eefeff20176a811c3c12989aeac588fa2f9b | [
"MIT"
] | 1 | 2019-07-10T18:56:36.000Z | 2019-07-10T18:56:36.000Z | from .pytorchgui import Graph
| 15 | 29 | 0.833333 | 4 | 30 | 6.25 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.133333 | 30 | 1 | 30 | 30 | 0.961538 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
551664e9b2d39d3c8c9853ddab6dca1df9edda73 | 39 | py | Python | Warp_Module/direct_warp/__init__.py | ClementPinard/direct-warper | be46410202c8cd9efb982b5dc4c1eb954ab45b10 | [
"MIT"
] | 2 | 2021-05-24T06:27:40.000Z | 2021-06-11T02:39:59.000Z | Warp_Module/direct_warp/__init__.py | ClementPinard/direct-warper | be46410202c8cd9efb982b5dc4c1eb954ab45b10 | [
"MIT"
] | null | null | null | Warp_Module/direct_warp/__init__.py | ClementPinard/direct-warper | be46410202c8cd9efb982b5dc4c1eb954ab45b10 | [
"MIT"
] | null | null | null | from .direct_warper import DirectWarper | 39 | 39 | 0.897436 | 5 | 39 | 6.8 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.076923 | 39 | 1 | 39 | 39 | 0.944444 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
9b81910be79cb31685c2036c21dec29d983fac89 | 24 | py | Python | game/__init__.py | Onii-Chan-Discord/onii-cogs | ec0a22e9a1dcd8fd0617448ba21b4c39ee113bd5 | [
"Apache-2.0"
] | 1 | 2021-07-11T18:46:08.000Z | 2021-07-11T18:46:08.000Z | game/__init__.py | Onii-Chan-Discord/onii-cogs | ec0a22e9a1dcd8fd0617448ba21b4c39ee113bd5 | [
"Apache-2.0"
] | 35 | 2021-06-05T06:33:34.000Z | 2022-03-22T01:44:00.000Z | game/__init__.py | Onii-Chan-Discord/onii-cogs | ec0a22e9a1dcd8fd0617448ba21b4c39ee113bd5 | [
"Apache-2.0"
] | 4 | 2021-07-07T04:29:33.000Z | 2021-12-31T12:12:00.000Z | from .game import setup
| 12 | 23 | 0.791667 | 4 | 24 | 4.75 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.166667 | 24 | 1 | 24 | 24 | 0.95 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
9b9d576f3a6ef05181a8f15b56f6d0b0acc3370c | 119 | py | Python | setup_script.py | rperrin22/QCF_demag | 7d85e020b7e1d7f59ddf0427b67768db238a05b3 | [
"MIT"
] | null | null | null | setup_script.py | rperrin22/QCF_demag | 7d85e020b7e1d7f59ddf0427b67768db238a05b3 | [
"MIT"
] | null | null | null | setup_script.py | rperrin22/QCF_demag | 7d85e020b7e1d7f59ddf0427b67768db238a05b3 | [
"MIT"
] | null | null | null | from FEHM_supplementary.prep import *
setup_test_folders('param_file_new.csv')
build_run_script('param_file_new.csv')
| 23.8 | 40 | 0.840336 | 19 | 119 | 4.789474 | 0.789474 | 0.197802 | 0.263736 | 0.32967 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.058824 | 119 | 4 | 41 | 29.75 | 0.8125 | 0 | 0 | 0 | 0 | 0 | 0.302521 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.333333 | 0 | 0.333333 | 0 | 1 | 0 | 0 | null | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
fd3f1739d2a56a8a8b817bd73d6f0899ac4b2210 | 132 | py | Python | report/admin.py | noriHanda/study_matching | 55e9525c9502c45c799f8f3a4c9c2b54406ed9e1 | [
"MIT"
] | null | null | null | report/admin.py | noriHanda/study_matching | 55e9525c9502c45c799f8f3a4c9c2b54406ed9e1 | [
"MIT"
] | null | null | null | report/admin.py | noriHanda/study_matching | 55e9525c9502c45c799f8f3a4c9c2b54406ed9e1 | [
"MIT"
] | null | null | null | from django.contrib import admin
from .models import Report
@admin.register(Report)
class ReportAdmin(admin.ModelAdmin):
pass
| 16.5 | 36 | 0.787879 | 17 | 132 | 6.117647 | 0.705882 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.136364 | 132 | 7 | 37 | 18.857143 | 0.912281 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.2 | 0.4 | 0 | 0.6 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
fd5c3c9285f068d91b12d1b73f8c9e8a02ccf387 | 185 | py | Python | videoDetection/config.py | Rubik90/TFM_AG | 5e836245d0704122f2a0d47413e93bf53d966ca0 | [
"MIT"
] | 1 | 2021-02-16T18:32:38.000Z | 2021-02-16T18:32:38.000Z | videoDetection/config.py | Rubik90/TFM_AG | 5e836245d0704122f2a0d47413e93bf53d966ca0 | [
"MIT"
] | null | null | null | videoDetection/config.py | Rubik90/TFM_AG | 5e836245d0704122f2a0d47413e93bf53d966ca0 | [
"MIT"
] | 1 | 2021-02-16T18:32:39.000Z | 2021-02-16T18:32:39.000Z | import sys
import pathlib
working_dir_path = pathlib.Path().absolute()
SAVE_DIR_PATH = str(working_dir_path) + '/joblib_features/'
MODEL_DIR_PATH = str(working_dir_path) + '/model/'
| 20.555556 | 59 | 0.767568 | 27 | 185 | 4.851852 | 0.444444 | 0.267176 | 0.320611 | 0.259542 | 0.366412 | 0.366412 | 0 | 0 | 0 | 0 | 0 | 0 | 0.108108 | 185 | 8 | 60 | 23.125 | 0.793939 | 0 | 0 | 0 | 0 | 0 | 0.12973 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.4 | 0 | 0.4 | 0 | 1 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
b5ce6fee1723d9ddcdd913d7eac11654c8283aef | 34 | py | Python | src/model/__init__.py | lopezco/test | 2dd420bd8cecd91ad0a617e7fd019e10c8abce06 | [
"MIT"
] | 16 | 2019-08-20T08:42:23.000Z | 2022-02-16T16:12:22.000Z | src/model/__init__.py | lopezco/test | 2dd420bd8cecd91ad0a617e7fd019e10c8abce06 | [
"MIT"
] | 5 | 2019-08-19T11:24:46.000Z | 2020-06-02T16:49:21.000Z | src/model/__init__.py | lopezco/test | 2dd420bd8cecd91ad0a617e7fd019e10c8abce06 | [
"MIT"
] | 6 | 2020-01-09T12:25:40.000Z | 2021-12-29T01:43:34.000Z | from .sklearn import SklearnModel
| 17 | 33 | 0.852941 | 4 | 34 | 7.25 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.117647 | 34 | 1 | 34 | 34 | 0.966667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
b5db5029ee5dc53f71f7f678f8c7742adb6926ac | 88 | py | Python | tamcolors/tests/tests_tests/__init__.py | cmcmarrow/tamcolors | 65a5f2455bbe35a739b98d14af158c3df7feb786 | [
"Apache-2.0"
] | 29 | 2020-07-17T23:46:17.000Z | 2022-02-06T05:36:44.000Z | tamcolors/tests/tests_tests/__init__.py | sudo-nikhil/tamcolors | 65a5f2455bbe35a739b98d14af158c3df7feb786 | [
"Apache-2.0"
] | 42 | 2020-07-25T19:39:52.000Z | 2021-02-24T01:19:58.000Z | tamcolors/tests/tests_tests/__init__.py | sudo-nikhil/tamcolors | 65a5f2455bbe35a739b98d14af158c3df7feb786 | [
"Apache-2.0"
] | 8 | 2020-07-18T23:02:48.000Z | 2020-12-30T04:07:35.000Z | from . import test_multi_task_helper_tests
__all__ = ("test_multi_task_helper_tests",)
| 22 | 43 | 0.829545 | 13 | 88 | 4.692308 | 0.615385 | 0.295082 | 0.42623 | 0.622951 | 0.786885 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.090909 | 88 | 3 | 44 | 29.333333 | 0.7625 | 0 | 0 | 0 | 0 | 0 | 0.318182 | 0.318182 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0.5 | 0 | 0.5 | 0 | 1 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
b5e126179bb9e3d80057bc25f35acc30589036e4 | 30 | py | Python | MartinsCrap.py | BostonA/SpudnikPi | 011d95e95e86fbec3186db70416c7391190352b3 | [
"Apache-2.0"
] | null | null | null | MartinsCrap.py | BostonA/SpudnikPi | 011d95e95e86fbec3186db70416c7391190352b3 | [
"Apache-2.0"
] | 1 | 2017-06-01T13:07:31.000Z | 2017-06-01T13:07:45.000Z | MartinsCrap.py | BostonA/SpudnikPi | 011d95e95e86fbec3186db70416c7391190352b3 | [
"Apache-2.0"
] | null | null | null | def f(d):
# h=-4.9t +
| 5 | 12 | 0.3 | 6 | 30 | 1.5 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.117647 | 0.433333 | 30 | 5 | 13 | 6 | 0.411765 | 0.3 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0 | 0 | null | null | 0 | 1 | 1 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
bd167373edfb246b39a6249c80bc323af42e46c5 | 41 | py | Python | conditional_independence/suffstats/invariance_suffstats/__init__.py | uhlerlab/conditional_independence | aa4b5117b6f24bf39433d427d490312864e9bd69 | [
"BSD-3-Clause"
] | 4 | 2021-01-29T20:27:31.000Z | 2022-02-01T11:55:33.000Z | conditional_independence/suffstats/invariance_suffstats/__init__.py | uhlerlab/conditional_independence | aa4b5117b6f24bf39433d427d490312864e9bd69 | [
"BSD-3-Clause"
] | null | null | null | conditional_independence/suffstats/invariance_suffstats/__init__.py | uhlerlab/conditional_independence | aa4b5117b6f24bf39433d427d490312864e9bd69 | [
"BSD-3-Clause"
] | 1 | 2021-09-12T13:41:21.000Z | 2021-09-12T13:41:21.000Z | from .gauss_invariance_suffstat import *
| 20.5 | 40 | 0.853659 | 5 | 41 | 6.6 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.097561 | 41 | 1 | 41 | 41 | 0.891892 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
bd23fd42f3b66a612a96ad3d260a619eabdeb618 | 3,350 | py | Python | datasets/facescape_wrapper.py | mudimingquedeyinmoujia/liif | 6e0c1d46948e641addcb32a0c0b3a2fa810026d5 | [
"BSD-3-Clause"
] | null | null | null | datasets/facescape_wrapper.py | mudimingquedeyinmoujia/liif | 6e0c1d46948e641addcb32a0c0b3a2fa810026d5 | [
"BSD-3-Clause"
] | null | null | null | datasets/facescape_wrapper.py | mudimingquedeyinmoujia/liif | 6e0c1d46948e641addcb32a0c0b3a2fa810026d5 | [
"BSD-3-Clause"
] | null | null | null | import functools
import random
import math
from PIL import Image
import numpy as np
import torch
from torch.utils.data import Dataset
from torchvision import transforms
from datasets import register
from utils import to_pixel_samples
def resize_fn(img, size):
return transforms.ToTensor()(
transforms.Resize(size, Image.BICUBIC)(
transforms.ToPILImage()(img)))
@register('facescape-liif-wrapper')
class FacescapeWrapper(Dataset):
def __init__(self, dataset, inp_size=64, scale_min=1, scale_max=None, random_sample=None):
self.dataset = dataset
self.inp_size = inp_size
self.scale_min = scale_min
if scale_max is None:
scale_max = scale_min
self.scale_max = scale_max
self.random_sample = random_sample
def __len__(self):
return len(self.dataset)
def __getitem__(self, idx):
img_path, img_id, exp, index = self.dataset[idx]
img = transforms.ToTensor()(Image.open(img_path).convert('RGB'))
s = random.uniform(self.scale_min, self.scale_max)
gt_size = round(self.inp_size * s)
gt = resize_fn(img, gt_size)
inp= resize_fn(img,self.inp_size)
hr_coord, hr_rgb = to_pixel_samples(gt.contiguous())
if self.random_sample is not None:
sample_lst = np.random.choice(
len(hr_coord), self.random_sample, replace=False)
hr_coord = hr_coord[sample_lst]
hr_rgb = hr_rgb[sample_lst]
cell = torch.ones_like(hr_coord)
cell[:, 0] *= 2 / gt_size
cell[:, 1] *= 2 / gt_size
return {
'inp': inp, # 4096 scale to inp_size=64
'coord': hr_coord, # 4096 scale to inp_size*s
'cell': cell,
'gt': hr_rgb # 4096 scale to inp_size*s
}
@register('facescape-valid-wrapper')
class FacescapeValidWrapper(Dataset):
def __init__(self, dataset, inp_size=64, scale_min=1, scale_max=None, random_sample=None):
self.dataset = dataset
self.inp_size = inp_size
self.scale_min = scale_min
if scale_max is None:
scale_max = scale_min
self.scale_max = scale_max
self.random_sample = random_sample
def __len__(self):
return len(self.dataset)
def __getitem__(self, idx):
img_path, img_id, exp, index = self.dataset[idx]
img = transforms.ToTensor()(Image.open(img_path).convert('RGB'))
s = random.uniform(self.scale_min, self.scale_max)
gt_size = round(self.inp_size * s)
gt = resize_fn(img, gt_size)
inp= resize_fn(img,self.inp_size)
hr_coord, hr_rgb = to_pixel_samples(gt.contiguous())
if self.random_sample is not None:
sample_lst = np.random.choice(
len(hr_coord), self.random_sample, replace=False)
hr_coord = hr_coord[sample_lst]
hr_rgb = hr_rgb[sample_lst]
cell = torch.ones_like(hr_coord)
cell[:, 0] *= 2 / gt_size
cell[:, 1] *= 2 / gt_size
return {
'inp': inp, # 4096 scale to inp_size=64 [3,64,64]
'coord': hr_coord, # 4096 scale to inp_size*s [sample,2]
'cell': cell,
'gt': hr_rgb, # 4096 scale to inp_size*s [sample,3]
'gt512':resize_fn(img,512) # [3,512,512]
} | 31.308411 | 94 | 0.619701 | 465 | 3,350 | 4.193548 | 0.172043 | 0.057436 | 0.033846 | 0.043077 | 0.779487 | 0.779487 | 0.779487 | 0.773333 | 0.773333 | 0.773333 | 0 | 0.025546 | 0.275522 | 3,350 | 107 | 95 | 31.308411 | 0.777915 | 0.058209 | 0 | 0.722892 | 0 | 0 | 0.026684 | 0.014295 | 0 | 0 | 0 | 0 | 0 | 1 | 0.084337 | false | 0 | 0.120482 | 0.036145 | 0.289157 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
1ff50af0c469e9e4417f5c704ed3028b0db6e8db | 12 | py | Python | python/testData/mover/simple_afterDown.py | jnthn/intellij-community | 8fa7c8a3ace62400c838e0d5926a7be106aa8557 | [
"Apache-2.0"
] | 2 | 2019-04-28T07:48:50.000Z | 2020-12-11T14:18:08.000Z | python/testData/mover/simple_afterDown.py | Cyril-lamirand/intellij-community | 60ab6c61b82fc761dd68363eca7d9d69663cfa39 | [
"Apache-2.0"
] | 173 | 2018-07-05T13:59:39.000Z | 2018-08-09T01:12:03.000Z | python/testData/mover/simple_afterDown.py | Cyril-lamirand/intellij-community | 60ab6c61b82fc761dd68363eca7d9d69663cfa39 | [
"Apache-2.0"
] | 2 | 2020-03-15T08:57:37.000Z | 2020-04-07T04:48:14.000Z | b = 2
a = 1
| 4 | 5 | 0.333333 | 4 | 12 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.333333 | 0.5 | 12 | 2 | 6 | 6 | 0.333333 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
1f1639d7ea7dfb8a2d4fd2080e4bfaef7ba68ed0 | 5,937 | py | Python | Web/contestManager.py | cmd2001/Open-TesutoHime | 2c30aa35650383adfb99496aebd425dffd287eda | [
"MIT"
] | 11 | 2020-11-28T16:45:35.000Z | 2021-08-31T07:56:26.000Z | Web/contestManager.py | cmd2001/Open-TesutoHime | 2c30aa35650383adfb99496aebd425dffd287eda | [
"MIT"
] | null | null | null | Web/contestManager.py | cmd2001/Open-TesutoHime | 2c30aa35650383adfb99496aebd425dffd287eda | [
"MIT"
] | 2 | 2021-05-16T03:09:58.000Z | 2021-08-21T07:24:58.000Z | import sys
from utils import *
class ContestManager:
def create_contest(self, name: str, start_time: int, end_time: int, contest_type: int):
db = db_connect()
cursor = db.cursor()
try:
cursor.execute("INSERT INTO Contest (Name, Start_Time, End_Time, Type) VALUES (%s, %s, %s, %s)",
(name, start_time, end_time, contest_type))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Create_Contest\n")
db.close()
return
def modify_contest(self, contest_id: int, new_name: str, new_start_time: int, new_end_time: int,
new_contest_type: int):
db = db_connect()
cursor = db.cursor()
try:
cursor.execute("UPDATE Contest SET Name = %s, Start_Time = %s, End_Time = %s, Type = %s WHERE ID = %s",
(new_name, new_start_time, new_end_time, new_contest_type, contest_id))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Modify_Contest\n")
db.close()
return
def delete_contest(self, contest_id: int):
db = db_connect()
cursor = db.cursor()
try:
cursor.execute("DELETE FROM Contest WHERE ID = %s", (str(contest_id)))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Delete_Contest(1)\n")
try:
cursor.execute("DELETE FROM Contest_Player WHERE Belong = %s", (str(contest_id)))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Delete_Contest(2)\n")
try:
cursor.execute("DELETE FROM Contest_Problem WHERE Belong = %s", (str(contest_id)))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Delete_Contest(3)\n")
db.close()
return
def add_problem_to_contest(self, contest_id: int, problem_id: int):
db = db_connect()
cursor = db.cursor()
try:
cursor.execute("INSERT INTO Contest_Problem (Belong, Problem_ID) VALUES (%s, %s)",
(str(contest_id), str(problem_id)))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Add_Problem_To_Contest\n")
db.close()
return
def delete_problem_from_contest(self, contest_id: int, problem_id: int):
db = db_connect()
cursor = db.cursor()
try:
cursor.execute("DELETE FROM Contest_Problem WHERE Belong = %s AND Problem_ID = %s",
(str(contest_id), str(problem_id)))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Delete_Problem_From_Contest\n")
db.close()
return
def add_player_to_contest(self, contest_id: int, username: str):
db = db_connect()
cursor = db.cursor()
try:
cursor.execute("INSERT INTO Contest_Player (Belong, Username) VALUES (%s, %s)",
(str(contest_id), str(username)))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Add_Player_To_Contest\n")
db.close()
return
def check_player_in_contest(self, contest_id: int, username: str):
db = db_connect()
cursor = db.cursor()
cursor.execute("SELECT tempID FROM Contest_Player WHERE Belong = %s AND Username = %s", (contest_id, username))
ret = cursor.fetchall()
db.close()
return len(ret) != 0
def delete_player_from_contest(self, contest_id: int, username: str):
db = db_connect()
cursor = db.cursor()
try:
cursor.execute("DELETE FROM Contest_Player WHERE Belong = %s AND Username = %s",
(str(contest_id), str(username)))
db.commit()
except pymysql.Error:
db.rollback()
sys.stderr.write("SQL Error in ContestManager: Delete_Player_From_Contest\n")
db.close()
return
def list_contest(self, contest_type: int):
db = db_connect()
cursor = db.cursor()
cursor.execute("SELECT ID, Name, Start_Time, End_Time FROM Contest WHERE Type = %s ORDER BY ID DESC",
(contest_type))
ret = cursor.fetchall()
db.close()
return ret
def get_time(self, contest_id: int):
db = db_connect()
cursor = db.cursor()
cursor.execute("SELECT Start_Time, End_Time FROM Contest WHERE ID = %s", (str(contest_id)))
ret = cursor.fetchone()
db.close()
return int(ret[0]), int(ret[1])
def list_problem_for_contest(self, contest_id: int):
db = db_connect()
cursor = db.cursor()
cursor.execute("SELECT Problem_ID FROM Contest_Problem WHERE Belong = %s", (str(contest_id)))
ret = cursor.fetchall()
db.close()
return ret
def list_player_for_contest(self, contest_id: int):
db = db_connect()
cursor = db.cursor()
cursor.execute("SELECT Username FROM Contest_Player WHERE Belong = %s", (str(contest_id)))
ret = cursor.fetchall()
db.close()
return ret
def get_title(self, contest_id: int):
db = db_connect()
cursor = db.cursor()
cursor.execute("SELECT Name FROM Contest WHERE ID = %s", (str(contest_id)))
ret = cursor.fetchall()
db.close()
return ret
Contest_Manager = ContestManager()
| 36.423313 | 119 | 0.577396 | 720 | 5,937 | 4.583333 | 0.098611 | 0.065455 | 0.043333 | 0.06697 | 0.820303 | 0.799394 | 0.772424 | 0.709394 | 0.707273 | 0.659091 | 0 | 0.001469 | 0.311942 | 5,937 | 162 | 120 | 36.648148 | 0.806365 | 0 | 0 | 0.664336 | 0 | 0.013986 | 0.226377 | 0.017517 | 0 | 0 | 0 | 0 | 0 | 1 | 0.090909 | false | 0 | 0.013986 | 0 | 0.202797 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
2f160e0628f97a2b09541978379116c85108342f | 188 | py | Python | article.py | entrpn/stocksight | 36f51b69ebba77195e1bf76a96072e9b80a4af13 | [
"Apache-2.0"
] | 1 | 2019-08-02T00:18:24.000Z | 2019-08-02T00:18:24.000Z | article.py | entrpn/stocksight | 36f51b69ebba77195e1bf76a96072e9b80a4af13 | [
"Apache-2.0"
] | null | null | null | article.py | entrpn/stocksight | 36f51b69ebba77195e1bf76a96072e9b80a4af13 | [
"Apache-2.0"
] | null | null | null | class Article:
def __init__(self, headline, url):
self.headline = headline
self.url = url
def __eq__(self, other):
return self.headline == other.headline
| 20.888889 | 46 | 0.62234 | 22 | 188 | 4.954545 | 0.454545 | 0.330275 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.281915 | 188 | 8 | 47 | 23.5 | 0.807407 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.333333 | false | 0 | 0 | 0.166667 | 0.666667 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 6 |
85cb1bb4ae02b1a4342fa468007dd9491aca6415 | 37 | py | Python | comparer/__init__.py | eaingaran/TimeMachine | f6199827ffc358dd32f26edd8d68e2dbf7c63a90 | [
"MIT"
] | null | null | null | comparer/__init__.py | eaingaran/TimeMachine | f6199827ffc358dd32f26edd8d68e2dbf7c63a90 | [
"MIT"
] | null | null | null | comparer/__init__.py | eaingaran/TimeMachine | f6199827ffc358dd32f26edd8d68e2dbf7c63a90 | [
"MIT"
] | null | null | null | from comparer import FileComparision
| 18.5 | 36 | 0.891892 | 4 | 37 | 8.25 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.108108 | 37 | 1 | 37 | 37 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
c8041ed13662eb3d33f0ff7baa5964e9a4c11f90 | 11,341 | py | Python | gapid_tests/resource_creation_tests/FlushAndInvalidateMappedMemoryRanges_test/FlushInvalidateMappedMemoryRanges_test.py | AWoloszyn/vulkan_test_applications | 5e9f86cdbd4e2344f41db9e0a578fe9fba41106f | [
"Apache-2.0"
] | null | null | null | gapid_tests/resource_creation_tests/FlushAndInvalidateMappedMemoryRanges_test/FlushInvalidateMappedMemoryRanges_test.py | AWoloszyn/vulkan_test_applications | 5e9f86cdbd4e2344f41db9e0a578fe9fba41106f | [
"Apache-2.0"
] | null | null | null | gapid_tests/resource_creation_tests/FlushAndInvalidateMappedMemoryRanges_test/FlushInvalidateMappedMemoryRanges_test.py | AWoloszyn/vulkan_test_applications | 5e9f86cdbd4e2344f41db9e0a578fe9fba41106f | [
"Apache-2.0"
] | null | null | null | # Copyright 2017 Google Inc.
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
# http://www.apache.org/licenses/LICENSE-2.0
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
from gapit_test_framework import gapit_test, require, require_equal
from gapit_test_framework import require_not_equal, little_endian_bytes_to_int
from gapit_test_framework import GapitTest, get_read_offset_function
from gapit_test_framework import get_write_offset_function
from struct_offsets import VulkanStruct, ARRAY, UINT32_T, DEVICE_SIZE
from struct_offsets import CHAR, POINTER, HANDLE
from vulkan_constants import VK_STRUCTURE_TYPE_MAPPED_MEMORY_RANGE, VK_WHOLE_SIZE
NON_COHERENT_ATOM_SIZE = 256
BUFFER_SIZE = NON_COHERENT_ATOM_SIZE * 2
FLUSH_INVALIDATE_SIZE = NON_COHERENT_ATOM_SIZE
SRC_BUFFER_FLUSH_INVALIDATE_OFFSET = NON_COHERENT_ATOM_SIZE * 2
DST_BUFFER_FLUSH_INVALIDATE_OFFSET = NON_COHERENT_ATOM_SIZE * 5
MAPPED_MEMORY_RANGE = [
("sType", UINT32_T),
("pNext", POINTER),
("memory", HANDLE),
("offset", DEVICE_SIZE),
("size", DEVICE_SIZE),
]
@gapit_test("FlushAndInvalidateMappedMemoryRanges_test")
class FlushMappedMemoryRangesNonZeroOffsetNotWholeSize(GapitTest):
def expect(self):
"""Check the arguments and the VkMappedMemoryRange structs used in
vkFlushMappedMemoryRanges(). The flushed memory starts at offset 768 and
has size 256"""
MAP_OFFSET = 512
FLUSH_OFFSET = MAP_OFFSET + 256
FLUSH_SIZE = 256
MEMORY_DATA = [("data", ARRAY, FLUSH_SIZE, CHAR)]
EXPECTED_MEMORY_DATA = [i for i in range(FLUSH_SIZE)]
architecture = self.architecture
# The first and second vkMapMemory() result is managed in
# VulkanApplication and is not used here, the third is the one we need
# here.
map_memory = require(self.nth_call_of("vkMapMemory", 3))
require_not_equal(0, map_memory.hex_ppData)
# The flushed data starts at mapped offset + 256
flushed_data_ptr = little_endian_bytes_to_int(require(
map_memory.get_write_data(map_memory.hex_ppData,
architecture.int_integerSize))) + 256
# Check arguments
flush_mapped_memory_ranges = require(self.nth_call_of(
"vkFlushMappedMemoryRanges", 1))
require_equal(1, flush_mapped_memory_ranges.int_memoryRangeCount)
require_not_equal(0, flush_mapped_memory_ranges.hex_pMemoryRanges)
# Check the memory range struct content
mapped_memory_range = VulkanStruct(
architecture, MAPPED_MEMORY_RANGE, get_read_offset_function(
flush_mapped_memory_ranges,
flush_mapped_memory_ranges.hex_pMemoryRanges))
require_equal(VK_STRUCTURE_TYPE_MAPPED_MEMORY_RANGE,
mapped_memory_range.sType)
require_equal(0, mapped_memory_range.pNext)
require_not_equal(0, mapped_memory_range.memory)
require_equal(FLUSH_OFFSET, mapped_memory_range.offset)
require_equal(FLUSH_SIZE, mapped_memory_range.size)
# check the flushed memory data
memory_data = VulkanStruct(
architecture, MEMORY_DATA, get_read_offset_function(
flush_mapped_memory_ranges, flushed_data_ptr))
require_equal(EXPECTED_MEMORY_DATA, memory_data.data)
@gapit_test("FlushAndInvalidateMappedMemoryRanges_test")
class InvalidateMappedMemoryRangesZeroOffsetWholeSize(GapitTest):
def expect(self):
"""Check the arguments and the VkMappedMemoryRange structs used in
vkInvalidateMappedMemoryRanges(). The invalidate memory covers the whole
dst buffer which starts at offset 0 and has size VK_WHOLE_SIZE. Only the
second half of the buffer has the data copied from the previously
flushed memory"""
MAP_OFFSET = 0
INVALIDATE_OFFSET = MAP_OFFSET
INVALIDATE_SIZE = VK_WHOLE_SIZE
DATA_SIZE = 256
MEMORY_DATA = [("data", ARRAY, DATA_SIZE, CHAR)]
EXPECTED_MEMORY_DATA = [i for i in range(DATA_SIZE)]
architecture = self.architecture
# The first and second vkMapMemory() result is managed in
# VulkanApplication and is not used here, the fourth is the one we need
# here.
map_memory = require(self.nth_call_of("vkMapMemory", 4))
require_not_equal(0, map_memory.hex_ppData)
# The invalidated data offset is equal to the mapped offset, but the
# flushed data starts at mapped offset + 256
invalidate_data_ptr = little_endian_bytes_to_int(require(
map_memory.get_write_data(map_memory.hex_ppData,
architecture.int_integerSize))) + 256
# Check arguments
invalidate_mapped_memory_ranges = require(self.nth_call_of(
"vkInvalidateMappedMemoryRanges", 1))
require_equal(1, invalidate_mapped_memory_ranges.int_memoryRangeCount)
require_not_equal(0, invalidate_mapped_memory_ranges.hex_pMemoryRanges)
# Check the memory range struct contents
mapped_memory_range = VulkanStruct(
architecture, MAPPED_MEMORY_RANGE, get_read_offset_function(
invalidate_mapped_memory_ranges,
invalidate_mapped_memory_ranges.hex_pMemoryRanges))
require_equal(VK_STRUCTURE_TYPE_MAPPED_MEMORY_RANGE,
mapped_memory_range.sType)
require_equal(0, mapped_memory_range.pNext)
require_not_equal(0, mapped_memory_range.memory)
require_equal(INVALIDATE_OFFSET, mapped_memory_range.offset)
require_equal(INVALIDATE_SIZE, mapped_memory_range.size)
# Check data of the invalidated memory
memory_data = VulkanStruct(
architecture, MEMORY_DATA, get_write_offset_function(
invalidate_mapped_memory_ranges, invalidate_data_ptr))
require_equal(EXPECTED_MEMORY_DATA, memory_data.data)
@gapit_test("FlushAndInvalidateMappedMemoryRanges_test")
class FlushMappedMemoryRangesZeroOffsetWholeSize(GapitTest):
def expect(self):
"""Check the arguments and the VkMappedMemoryRange structs used in
vkFlushMappedMemoryRanges(). The flushed memory starts at offset 0 and
has size VK_WHOLE_SIZE"""
MAP_OFFSET = 0
FLUSH_OFFSET = MAP_OFFSET
FLUSH_SIZE = VK_WHOLE_SIZE
DATA_SIZE = 512
MEMORY_DATA = [("data", ARRAY, DATA_SIZE, CHAR)]
EXPECTED_MEMORY_DATA = [min(i, 512 - i) & 0xFF
for i in range(DATA_SIZE)]
architecture = self.architecture
# The first and second vkMapMemory() result is managed in
# VulkanApplication and is not used here, the fifth is the one we need
# here.
map_memory = require(self.nth_call_of("vkMapMemory", 5))
require_not_equal(0, map_memory.hex_ppData)
# The flushed data starts at mapped offset
flushed_data_ptr = little_endian_bytes_to_int(require(
map_memory.get_write_data(map_memory.hex_ppData,
architecture.int_integerSize)))
# Check arguments
flush_mapped_memory_ranges = require(self.nth_call_of(
"vkFlushMappedMemoryRanges", 1))
require_equal(1, flush_mapped_memory_ranges.int_memoryRangeCount)
require_not_equal(0, flush_mapped_memory_ranges.hex_pMemoryRanges)
# Check the memory range struct content
mapped_memory_range = VulkanStruct(
architecture, MAPPED_MEMORY_RANGE, get_read_offset_function(
flush_mapped_memory_ranges,
flush_mapped_memory_ranges.hex_pMemoryRanges))
require_equal(VK_STRUCTURE_TYPE_MAPPED_MEMORY_RANGE,
mapped_memory_range.sType)
require_equal(0, mapped_memory_range.pNext)
require_not_equal(0, mapped_memory_range.memory)
require_equal(FLUSH_OFFSET, mapped_memory_range.offset)
require_equal(FLUSH_SIZE, mapped_memory_range.size)
# check the flushed memory data
memory_data = VulkanStruct(
architecture, MEMORY_DATA, get_read_offset_function(
flush_mapped_memory_ranges, flushed_data_ptr))
require_equal(EXPECTED_MEMORY_DATA, memory_data.data)
@gapit_test("FlushAndInvalidateMappedMemoryRanges_test")
class InvalidateMappedMemoryRangesNonZeroOffsetNotWholeSize(GapitTest):
def expect(self):
"""Check the arguments and the VkMappedMemoryRange structs used in
vkInvalidateMappedMemoryRanges(). The invalidate memory covers the
second half of the dst buffer which starts at offset 1024 and has size
512. Only the second half of the buffer has the data is invalidated to
be host accessible."""
MAP_OFFSET = 1024
INVALIDATE_OFFSET = MAP_OFFSET + 256
INVALIDATE_SIZE = 256
MEMORY_DATA = [("data", ARRAY, INVALIDATE_SIZE, CHAR)]
EXPECTED_MEMORY_DATA = [(512 - i) & 0xFF
for i in range(INVALIDATE_SIZE, 512)]
architecture = self.architecture
# The first and second vkMapMemory() result is managed in
# VulkanApplication and is not used here, the sixth is the one we need
# here.
map_memory = require(self.nth_call_of("vkMapMemory", 6))
require_not_equal(0, map_memory.hex_ppData)
# The invalidated data offset is equal to the mapped offset, but the
# flushed data starts at mapped offset + 256
invalidate_data_ptr = little_endian_bytes_to_int(require(
map_memory.get_write_data(map_memory.hex_ppData,
architecture.int_integerSize))) + 256
# Check arguments
invalidate_mapped_memory_ranges = require(self.nth_call_of(
"vkInvalidateMappedMemoryRanges", 1))
require_equal(1, invalidate_mapped_memory_ranges.int_memoryRangeCount)
require_not_equal(0, invalidate_mapped_memory_ranges.hex_pMemoryRanges)
# Check the memory range struct contents
mapped_memory_range = VulkanStruct(
architecture, MAPPED_MEMORY_RANGE, get_read_offset_function(
invalidate_mapped_memory_ranges,
invalidate_mapped_memory_ranges.hex_pMemoryRanges))
require_equal(VK_STRUCTURE_TYPE_MAPPED_MEMORY_RANGE,
mapped_memory_range.sType)
require_equal(0, mapped_memory_range.pNext)
require_not_equal(0, mapped_memory_range.memory)
require_equal(INVALIDATE_OFFSET, mapped_memory_range.offset)
require_equal(INVALIDATE_SIZE, mapped_memory_range.size)
# Check data of the invalidated memory
memory_data = VulkanStruct(
architecture, MEMORY_DATA, get_write_offset_function(
invalidate_mapped_memory_ranges, invalidate_data_ptr))
require_equal(EXPECTED_MEMORY_DATA, memory_data.data)
| 47.451883 | 81 | 0.709549 | 1,365 | 11,341 | 5.556044 | 0.132601 | 0.091772 | 0.076213 | 0.025316 | 0.827136 | 0.787579 | 0.764504 | 0.760944 | 0.748418 | 0.748418 | 0 | 0.013461 | 0.233577 | 11,341 | 238 | 82 | 47.651261 | 0.859066 | 0.231549 | 0 | 0.682119 | 0 | 0 | 0.042061 | 0.032013 | 0 | 0 | 0.000935 | 0 | 0 | 1 | 0.02649 | false | 0 | 0.046358 | 0 | 0.099338 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
c83da4e2bd5e89fbcf4c04cc8979761dddc66092 | 142 | py | Python | users/models.py | tahasama/books | 9400183077e8708a5f9365ce2b4622a2086427a0 | [
"MIT"
] | null | null | null | users/models.py | tahasama/books | 9400183077e8708a5f9365ce2b4622a2086427a0 | [
"MIT"
] | null | null | null | users/models.py | tahasama/books | 9400183077e8708a5f9365ce2b4622a2086427a0 | [
"MIT"
] | null | null | null | from django.db import models
from django.contrib.auth.models import AbstractUser, PermissionsMixin
class CustomUser(AbstractUser):
pass
| 20.285714 | 69 | 0.816901 | 17 | 142 | 6.823529 | 0.705882 | 0.172414 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.126761 | 142 | 6 | 70 | 23.666667 | 0.935484 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.25 | 0.5 | 0 | 0.75 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
c073d01245bd5d08142e7c14d44cec1724304262 | 45 | py | Python | miniargs/__init__.py | moskomule/simpleargs | c329e96a37bb4939fbfbd3d5a3007d245811a39d | [
"MIT"
] | 4 | 2018-12-18T04:16:17.000Z | 2020-03-07T03:30:57.000Z | miniargs/__init__.py | 983632847/miniargs | c329e96a37bb4939fbfbd3d5a3007d245811a39d | [
"MIT"
] | null | null | null | miniargs/__init__.py | 983632847/miniargs | c329e96a37bb4939fbfbd3d5a3007d245811a39d | [
"MIT"
] | 4 | 2018-12-18T04:16:29.000Z | 2020-03-07T03:31:01.000Z | from miniargs.miniargs import ArgumentParser
| 22.5 | 44 | 0.888889 | 5 | 45 | 8 | 0.8 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.088889 | 45 | 1 | 45 | 45 | 0.97561 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
c076499e13baab8fd7e45edd63b168d79772e8c5 | 5,305 | py | Python | hill_cipher.py | pgandhi03/CiphersInPython | 0d417fec3b7e107a5648fe5399060b1c0921ef3e | [
"MIT"
] | 18 | 2019-02-03T16:53:00.000Z | 2021-05-23T17:52:24.000Z | hill_cipher.py | pgandhi03/CiphersInPython | 0d417fec3b7e107a5648fe5399060b1c0921ef3e | [
"MIT"
] | null | null | null | hill_cipher.py | pgandhi03/CiphersInPython | 0d417fec3b7e107a5648fe5399060b1c0921ef3e | [
"MIT"
] | 17 | 2019-02-05T05:44:35.000Z | 2022-03-28T16:15:53.000Z | # *********
# -*- Made by VoxelPixel
# -*- For YouTube Tutorial
# -*- https://github.com/VoxelPixel
# -*- Support me on Patreon: https://www.patreon.com/voxelpixel
# *********
import sys
import numpy as np
def cipher_encryption():
msg = input("Enter message: ").upper()
msg = msg.replace(" ", "")
# if message length is odd number, append 0 at the end
len_chk = 0
if len(msg) % 2 != 0:
msg += "0"
len_chk = 1
# msg to matrices
row = 2
col = int(len(msg)/2)
msg2d = np.zeros((row, col), dtype=int)
itr1 = 0
itr2 = 0
for i in range(len(msg)):
if i % 2 == 0:
msg2d[0][itr1] = int(ord(msg[i])-65)
itr1 += 1
else:
msg2d[1][itr2] = int(ord(msg[i])-65)
itr2 += 1
# for
key = input("Enter 4 letter Key String: ").upper()
key = key.replace(" ", "")
# key to 2x2
key2d = np.zeros((2, 2), dtype=int)
itr3 = 0
for i in range(2):
for j in range(2):
key2d[i][j] = ord(key[itr3])-65
itr3 += 1
# checking validity of the key
# finding determinant
deter = key2d[0][0] * key2d[1][1] - key2d[0][1] * key2d[1][0]
deter = deter % 26
# finding multiplicative inverse
mul_inv = -1
for i in range(26):
temp_inv = deter * i
if temp_inv % 26 == 1:
mul_inv = i
break
else:
continue
# for
if mul_inv == -1:
print("Invalid key")
sys.exit()
# if
encryp_text = ""
itr_count = int(len(msg)/2)
if len_chk == 0:
for i in range(itr_count):
temp1 = msg2d[0][i] * key2d[0][0] + msg2d[1][i] * key2d[0][1]
encryp_text += chr((temp1 % 26) + 65)
temp2 = msg2d[0][i] * key2d[1][0] + msg2d[1][i] * key2d[1][1]
encryp_text += chr((temp2 % 26) + 65)
# for
else:
for i in range(itr_count-1):
temp1 = msg2d[0][i] * key2d[0][0] + msg2d[1][i] * key2d[0][1]
encryp_text += chr((temp1 % 26) + 65)
temp2 = msg2d[0][i] * key2d[1][0] + msg2d[1][i] * key2d[1][1]
encryp_text += chr((temp2 % 26) + 65)
# for
# if else
print("Encrypted Text: {}".format(encryp_text))
def cipher_decryption():
msg = input("Enter message: ").upper()
msg = msg.replace(" ", "")
# if message length is odd number, append 0 at the end
len_chk = 0
if len(msg) % 2 != 0:
msg += "0"
len_chk = 1
# msg to matrices
row = 2
col = int(len(msg) / 2)
msg2d = np.zeros((row, col), dtype=int)
itr1 = 0
itr2 = 0
for i in range(len(msg)):
if i % 2 == 0:
msg2d[0][itr1] = int(ord(msg[i]) - 65)
itr1 += 1
else:
msg2d[1][itr2] = int(ord(msg[i]) - 65)
itr2 += 1
# for
key = input("Enter 4 letter Key String: ").upper()
key = key.replace(" ", "")
# key to 2x2
key2d = np.zeros((2, 2), dtype=int)
itr3 = 0
for i in range(2):
for j in range(2):
key2d[i][j] = ord(key[itr3]) - 65
itr3 += 1
# for
# finding determinant
deter = key2d[0][0] * key2d[1][1] - key2d[0][1] * key2d[1][0]
deter = deter % 26
# finding multiplicative inverse
mul_inv = -1
for i in range(26):
temp_inv = deter * i
if temp_inv % 26 == 1:
mul_inv = i
break
else:
continue
# for
# adjugate matrix
# swapping
key2d[0][0], key2d[1][1] = key2d[1][1], key2d[0][0]
# changing signs
key2d[0][1] *= -1
key2d[1][0] *= -1
key2d[0][1] = key2d[0][1] % 26
key2d[1][0] = key2d[1][0] % 26
# multiplying multiplicative inverse with adjugate matrix
for i in range(2):
for j in range(2):
key2d[i][j] *= mul_inv
# modulo
for i in range(2):
for j in range(2):
key2d[i][j] = key2d[i][j] % 26
# cipher to plain
decryp_text = ""
itr_count = int(len(msg) / 2)
if len_chk == 0:
for i in range(itr_count):
temp1 = msg2d[0][i] * key2d[0][0] + msg2d[1][i] * key2d[0][1]
decryp_text += chr((temp1 % 26) + 65)
temp2 = msg2d[0][i] * key2d[1][0] + msg2d[1][i] * key2d[1][1]
decryp_text += chr((temp2 % 26) + 65)
# for
else:
for i in range(itr_count - 1):
temp1 = msg2d[0][i] * key2d[0][0] + msg2d[1][i] * key2d[0][1]
decryp_text += chr((temp1 % 26) + 65)
temp2 = msg2d[0][i] * key2d[1][0] + msg2d[1][i] * key2d[1][1]
decryp_text += chr((temp2 % 26) + 65)
# for
# if else
print("Decrypted Text: {}".format(decryp_text))
def main():
choice = int(input("1. Encryption\n2. Decryption\nChoose(1,2): "))
if choice == 1:
print("---Encryption---")
cipher_encryption()
elif choice == 2:
print("---Decryption---")
cipher_decryption()
else:
print("Invalid Choice")
if __name__ == "__main__":
main()
| 26.525 | 74 | 0.469369 | 730 | 5,305 | 3.347945 | 0.150685 | 0.041735 | 0.02946 | 0.05401 | 0.746727 | 0.736907 | 0.736907 | 0.729133 | 0.729133 | 0.720131 | 0 | 0.094469 | 0.369463 | 5,305 | 199 | 75 | 26.658291 | 0.636173 | 0.118379 | 0 | 0.780303 | 0 | 0 | 0.052679 | 0.005403 | 0 | 0 | 0 | 0 | 0 | 1 | 0.022727 | false | 0 | 0.015152 | 0 | 0.037879 | 0.045455 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
c08c8f43a351ed5d1c864b5e5c8e2072a9d7b4bc | 187 | py | Python | backend/model/Associator.py | CiprianBodnar/DeftEval | 7afbaa9013873c91e4f209311ed499005080e131 | [
"MIT"
] | null | null | null | backend/model/Associator.py | CiprianBodnar/DeftEval | 7afbaa9013873c91e4f209311ed499005080e131 | [
"MIT"
] | null | null | null | backend/model/Associator.py | CiprianBodnar/DeftEval | 7afbaa9013873c91e4f209311ed499005080e131 | [
"MIT"
] | 1 | 2019-10-15T15:48:13.000Z | 2019-10-15T15:48:13.000Z | class Associator:
def __init__(self):
pass
def associate_definition(self, listOfDefinition):
pass
def type_association(self, listOfDefinition):
pass
| 18.7 | 53 | 0.663102 | 18 | 187 | 6.555556 | 0.611111 | 0.118644 | 0.40678 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.272727 | 187 | 9 | 54 | 20.777778 | 0.867647 | 0 | 0 | 0.428571 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.428571 | false | 0.428571 | 0 | 0 | 0.571429 | 0 | 1 | 0 | 0 | null | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 6 |
23d0660a7fb137e26002404851acf84d04c1e331 | 8,769 | py | Python | devilry/devilry_cradmin/tests/test_devilry_multiselect2/test_user.py | devilry/devilry-django | 9ae28e462dfa4cfee966ebacbca04ade9627e715 | [
"BSD-3-Clause"
] | 29 | 2015-01-18T22:56:23.000Z | 2020-11-10T21:28:27.000Z | devilry/devilry_cradmin/tests/test_devilry_multiselect2/test_user.py | devilry/devilry-django | 9ae28e462dfa4cfee966ebacbca04ade9627e715 | [
"BSD-3-Clause"
] | 786 | 2015-01-06T16:10:18.000Z | 2022-03-16T11:10:50.000Z | devilry/devilry_cradmin/tests/test_devilry_multiselect2/test_user.py | devilry/devilry-django | 9ae28e462dfa4cfee966ebacbca04ade9627e715 | [
"BSD-3-Clause"
] | 15 | 2015-04-06T06:18:43.000Z | 2021-02-24T12:28:30.000Z | import htmls
import mock
from django import test
from django import forms
from django.conf import settings
from cradmin_legacy import cradmin_testhelpers
from model_bakery import baker
from devilry.devilry_cradmin import devilry_multiselect2
class TestSelectedItem(test.TestCase):
def test_title_without_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
shortname='test@example.com',
fullname='')
selector = htmls.S(devilry_multiselect2.user.SelectedItem(value=user).render())
self.assertEqual(
'test@example.com',
selector.one('.cradmin-legacy-multiselect2-target-selected-item-title').alltext_normalized)
def test_title_with_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
fullname='Test User',
shortname='test@example.com')
selector = htmls.S(devilry_multiselect2.user.SelectedItem(value=user).render())
self.assertEqual(
'Test User',
selector.one('.cradmin-legacy-multiselect2-target-selected-item-title').alltext_normalized)
def test_description_without_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
shortname='test@example.com',
fullname='')
selector = htmls.S(devilry_multiselect2.user.SelectedItem(value=user).render())
self.assertFalse(
selector.exists('.cradmin-legacy-multiselect2-target-selected-item-description'))
def test_description_with_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
fullname='Test User',
shortname='test@example.com')
selector = htmls.S(devilry_multiselect2.user.SelectedItem(value=user).render())
self.assertEqual(
'test@example.com',
selector.one('.cradmin-legacy-multiselect2-target-selected-item-description').alltext_normalized)
class TestItemValue(test.TestCase):
def test_title_without_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
shortname='test@example.com',
fullname='')
selector = htmls.S(devilry_multiselect2.user.ItemValue(value=user).render())
self.assertEqual(
'test@example.com',
selector.one('.cradmin-legacy-listbuilder-itemvalue-titledescription-title').alltext_normalized)
def test_title_with_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
fullname='Test User',
shortname='test@example.com')
selector = htmls.S(devilry_multiselect2.user.ItemValue(value=user).render())
self.assertEqual(
'Test User',
selector.one('.cradmin-legacy-listbuilder-itemvalue-titledescription-title').alltext_normalized)
def test_description_without_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
shortname='test@example.com',
fullname='')
selector = htmls.S(devilry_multiselect2.user.ItemValue(value=user).render())
self.assertFalse(
selector.exists('.cradmin-legacy-listbuilder-itemvalue-titledescription-description'))
def test_description_with_fullname(self):
user = baker.make(settings.AUTH_USER_MODEL,
fullname='Test User',
shortname='test@example.com')
selector = htmls.S(devilry_multiselect2.user.ItemValue(value=user).render())
self.assertEqual(
'test@example.com',
selector.one('.cradmin-legacy-listbuilder-itemvalue-titledescription-description').alltext_normalized)
class TestTarget(test.TestCase):
def test_with_items_title(self):
selector = htmls.S(devilry_multiselect2.user.Target(form=forms.Form()).render(request=mock.MagicMock()))
self.assertEqual(
'Selected users',
selector.one('.cradmin-legacy-multiselect2-target-title').alltext_normalized)
def test_without_items_text(self):
selector = htmls.S(devilry_multiselect2.user.Target(form=forms.Form()).render(request=mock.MagicMock()))
self.assertEqual(
'No users selected',
selector.one('.cradmin-legacy-multiselect2-target-without-items-content').alltext_normalized)
class MockMultiselectUsersView(devilry_multiselect2.user.BaseMultiselectUsersView):
def get_filterlist_url(self, filters_string):
return '/{}'.format(filters_string)
class TestBaseMultiselectUsersView(test.TestCase, cradmin_testhelpers.TestCaseMixin):
viewclass = MockMultiselectUsersView
def test_render_sanity(self):
# Only a sanity test - we do not repeat all the tests from TestItemValue
baker.make(settings.AUTH_USER_MODEL,
fullname='Test User',
shortname='test@example.com')
mockresponse = self.mock_http200_getrequest_htmls(requestuser=mock.MagicMock())
self.assertEqual(
'Test User',
mockresponse.selector.one(
'.cradmin-legacy-listbuilder-itemvalue-titledescription-title').alltext_normalized)
self.assertEqual(
'test@example.com',
mockresponse.selector.one(
'.cradmin-legacy-listbuilder-itemvalue-titledescription-description').alltext_normalized)
def __get_titles(self, selector):
return [element.alltext_normalized
for element in selector.list('.cradmin-legacy-listbuilder-itemvalue-titledescription-title')]
def test_ordering(self):
baker.make(settings.AUTH_USER_MODEL,
shortname='userb')
baker.make(settings.AUTH_USER_MODEL,
shortname='usera')
baker.make(settings.AUTH_USER_MODEL,
shortname='userc')
mockresponse = self.mock_http200_getrequest_htmls(requestuser=mock.MagicMock())
self.assertEqual(
['usera', 'userb', 'userc'],
self.__get_titles(mockresponse.selector))
def test_selectall_not_available(self):
baker.make(settings.AUTH_USER_MODEL)
mockresponse = self.mock_http200_getrequest_htmls(requestuser=mock.MagicMock())
self.assertFalse(mockresponse.selector.exists('.cradmin-legacy-multiselect2-listcolumn-buttons .btn'))
def test_search_shortname(self):
baker.make(settings.AUTH_USER_MODEL,
shortname='userb')
baker.make(settings.AUTH_USER_MODEL,
shortname='usera')
mockresponse = self.mock_http200_getrequest_htmls(
requestuser=mock.MagicMock(),
viewkwargs={'filters_string': 'search-usera'})
self.assertEqual(
{'usera'},
set(self.__get_titles(mockresponse.selector)))
def test_search_fullname(self):
baker.make(settings.AUTH_USER_MODEL,
fullname='Userb')
baker.make(settings.AUTH_USER_MODEL,
fullname='Usera')
mockresponse = self.mock_http200_getrequest_htmls(
requestuser=mock.MagicMock(),
viewkwargs={'filters_string': 'search-usera'})
self.assertEqual(
{'Usera'},
set(self.__get_titles(mockresponse.selector)))
def test_search_username(self):
baker.make('devilry_account.UserName',
user__fullname='Test User 1',
username='testuser1')
baker.make('devilry_account.UserName',
user__fullname='Test User 2',
username='testuser2')
mockresponse = self.mock_http200_getrequest_htmls(
requestuser=mock.MagicMock(),
viewkwargs={'filters_string': 'search-testuser1'})
self.assertEqual(
{'Test User 1'},
set(self.__get_titles(mockresponse.selector)))
def test_search_useremail(self):
baker.make('devilry_account.UserEmail',
user__fullname='Test User 1',
email='testuser1@example.com')
baker.make('devilry_account.UserEmail',
user__fullname='Test User 2',
email='testuser2@example.com')
mockresponse = self.mock_http200_getrequest_htmls(
requestuser=mock.MagicMock(),
viewkwargs={'filters_string': 'search-testuser1'})
self.assertEqual(
{'Test User 1'},
set(self.__get_titles(mockresponse.selector)))
| 44.969231 | 118 | 0.632911 | 856 | 8,769 | 6.290888 | 0.129673 | 0.035097 | 0.053668 | 0.066295 | 0.810585 | 0.790344 | 0.758032 | 0.713649 | 0.709192 | 0.65441 | 0 | 0.008055 | 0.26377 | 8,769 | 194 | 119 | 45.201031 | 0.826053 | 0.007983 | 0 | 0.694611 | 0 | 0 | 0.177762 | 0.109808 | 0 | 0 | 0 | 0 | 0.107784 | 1 | 0.113772 | false | 0 | 0.047904 | 0.011976 | 0.209581 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
23def35a46648df20c9f529870df96553fc388f7 | 135 | py | Python | stdnet/utils/structures.py | stuaxo/python-stdnet | 78db5320bdedc3f28c5e4f38cda13a4469e35db7 | [
"BSD-3-Clause"
] | 61 | 2015-01-13T23:41:10.000Z | 2021-09-14T03:23:59.000Z | stdnet/utils/structures.py | drscream/python-stdnet | 78db5320bdedc3f28c5e4f38cda13a4469e35db7 | [
"BSD-3-Clause"
] | 4 | 2015-02-28T08:57:14.000Z | 2020-12-29T17:14:43.000Z | stdnet/utils/structures.py | drscream/python-stdnet | 78db5320bdedc3f28c5e4f38cda13a4469e35db7 | [
"BSD-3-Clause"
] | 12 | 2015-01-01T09:23:06.000Z | 2021-09-16T08:09:13.000Z | import sys
from collections import *
if sys.version_info < (2, 7): # pragma nocover
from .fallbacks._collections import *
| 22.5 | 50 | 0.688889 | 17 | 135 | 5.352941 | 0.705882 | 0.373626 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.019231 | 0.22963 | 135 | 5 | 51 | 27 | 0.855769 | 0.103704 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.75 | 0 | 0.75 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
9b01ca1d392db8753d720ba4bf25e6be2db1d977 | 147 | py | Python | src/orqviz/elastic_band/__init__.py | n17/orqviz | 76a3f9855515583d9a59ed3f11cef506b4f993af | [
"Apache-2.0"
] | 57 | 2021-11-09T03:21:36.000Z | 2022-03-29T08:48:00.000Z | src/orqviz/elastic_band/__init__.py | n17/orqviz | 76a3f9855515583d9a59ed3f11cef506b4f993af | [
"Apache-2.0"
] | 18 | 2021-11-09T10:58:40.000Z | 2022-03-09T16:19:22.000Z | src/orqviz/elastic_band/__init__.py | n17/orqviz | 76a3f9855515583d9a59ed3f11cef506b4f993af | [
"Apache-2.0"
] | 8 | 2021-11-09T11:55:52.000Z | 2022-02-07T20:35:37.000Z | from .auto_neb import run_AutoNEB
from .data_structures import Chain, ChainPath
from .neb import run_NEB
from .plots import plot_all_chains_losses
| 29.4 | 45 | 0.85034 | 24 | 147 | 4.916667 | 0.625 | 0.152542 | 0.20339 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.115646 | 147 | 4 | 46 | 36.75 | 0.907692 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | null | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
7b0e7810f8e57dfd771c8ec5280564f29e8e80d4 | 24 | py | Python | dynamic_systems/identification/__init__.py | eddardd/CrossDomainFaultDetection | 83dd24727a8b35cda2549b40166beaf740e14c98 | [
"MIT"
] | 3 | 2021-08-30T11:41:36.000Z | 2021-12-22T10:45:25.000Z | dynamic_systems/identification/__init__.py | eddardd/CrossDomainFaultDiagnosis | 83dd24727a8b35cda2549b40166beaf740e14c98 | [
"MIT"
] | 1 | 2021-02-26T06:02:33.000Z | 2021-02-26T06:02:33.000Z | dynamic_systems/identification/__init__.py | eddardd/CrossDomainFaultDetection | 83dd24727a8b35cda2549b40166beaf740e14c98 | [
"MIT"
] | 2 | 2021-06-03T11:46:20.000Z | 2022-03-25T09:16:03.000Z | from .foptd import FOPTD | 24 | 24 | 0.833333 | 4 | 24 | 5 | 0.75 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.125 | 24 | 1 | 24 | 24 | 0.952381 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
7b119ac390115cc4290ca2e49ef7ead632c8aee1 | 44 | py | Python | holobot/extensions/admin/database/__init__.py | rexor12/holobot | 89b7b416403d13ccfeee117ef942426b08d3651d | [
"MIT"
] | 1 | 2021-05-24T00:17:46.000Z | 2021-05-24T00:17:46.000Z | holobot/extensions/admin/database/__init__.py | rexor12/holobot | 89b7b416403d13ccfeee117ef942426b08d3651d | [
"MIT"
] | 41 | 2021-03-24T22:50:09.000Z | 2021-12-17T12:15:13.000Z | holobot/extensions/admin/database/__init__.py | rexor12/holobot | 89b7b416403d13ccfeee117ef942426b08d3651d | [
"MIT"
] | null | null | null | from .rules_migration import RulesMigration
| 22 | 43 | 0.886364 | 5 | 44 | 7.6 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.090909 | 44 | 1 | 44 | 44 | 0.95 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
9e43bc35e9f9f69c7d98282a7651cd2bee0545c5 | 156 | py | Python | src/common/exceptions.py | alexlykasov/codebuild-notifications-github | f0cad0c3e3b00e7201d79bcec83e1ec40fe8f267 | [
"Apache-2.0"
] | null | null | null | src/common/exceptions.py | alexlykasov/codebuild-notifications-github | f0cad0c3e3b00e7201d79bcec83e1ec40fe8f267 | [
"Apache-2.0"
] | null | null | null | src/common/exceptions.py | alexlykasov/codebuild-notifications-github | f0cad0c3e3b00e7201d79bcec83e1ec40fe8f267 | [
"Apache-2.0"
] | null | null | null |
class CodeBuildProjectNotFound(Exception):
pass
class UnsupportedBuildStatus(Exception):
pass
class RequiredEnvVarsNotSet(Exception):
pass
| 13 | 42 | 0.775641 | 12 | 156 | 10.083333 | 0.5 | 0.322314 | 0.297521 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.166667 | 156 | 11 | 43 | 14.181818 | 0.930769 | 0 | 0 | 0.5 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.5 | 0 | 0 | 0.5 | 0 | 1 | 0 | 1 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 6 |
7b67749ea586454c10f7fce11456a9c240f613a1 | 88 | py | Python | donutshell/utils/__init__.py | loldonut/donutshell | a53d15b0a4950797e460d38ef82172cca1141fa2 | [
"MIT"
] | null | null | null | donutshell/utils/__init__.py | loldonut/donutshell | a53d15b0a4950797e460d38ef82172cca1141fa2 | [
"MIT"
] | null | null | null | donutshell/utils/__init__.py | loldonut/donutshell | a53d15b0a4950797e460d38ef82172cca1141fa2 | [
"MIT"
] | null | null | null | from .command_not_found import *
from .help_console import *
from .read_config import *
| 22 | 32 | 0.795455 | 13 | 88 | 5.076923 | 0.692308 | 0.30303 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.136364 | 88 | 3 | 33 | 29.333333 | 0.868421 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
c875fb8a22c117ede36d40d71e22345409a1bb4b | 12,242 | py | Python | spec_classes/methods/collections/sets.py | matthewwardrop/spec-classes | d50c9ded426b5becd445c255e45b88ccc8961672 | [
"MIT"
] | 1 | 2021-07-10T11:43:16.000Z | 2021-07-10T11:43:16.000Z | spec_classes/methods/collections/sets.py | matthewwardrop/spec-classes | d50c9ded426b5becd445c255e45b88ccc8961672 | [
"MIT"
] | 1 | 2021-09-02T18:15:10.000Z | 2021-09-02T18:15:10.000Z | spec_classes/methods/collections/sets.py | matthewwardrop/spec-classes | d50c9ded426b5becd445c255e45b88ccc8961672 | [
"MIT"
] | null | null | null | import functools
from inspect import Parameter
from typing import Any, Callable, Dict, Union
from spec_classes.types import Attr, MISSING
from spec_classes.utils.method_builder import MethodBuilder
from spec_classes.utils.mutation import mutate_attr
from spec_classes.utils.type_checking import type_label
from ..base import AttrMethodDescriptor
def _get_set_item_type(attr_spec):
"""
Get the type(s) of items for set method signatures.
"""
item_type = attr_spec.item_type
if attr_spec.item_spec_key_type:
item_type = Union[
attr_spec.item_spec_key_type,
item_type,
]
return item_type
class WithSetItemMethod(AttrMethodDescriptor):
"""
The method descriptor/generator for `with_<attr_singular>' for set
collections.
The default behavior of this method is to copy the spec-class with an
additional item added to the collection associated with the singular form of
the attribute name. For more information refer to the spec-classes
documentation or the generated method.
"""
@property
def method_name(self) -> str:
return f"with_{self.attr_spec.item_name}"
@staticmethod
def with_set_item(
attr_spec: Attr,
self,
_item: Any,
*,
_inplace: bool = False,
_if: bool = True,
**attrs,
) -> Any:
if not _if:
return self
return mutate_attr(
obj=self,
attr=attr_spec.name,
value=(
attr_spec.get_collection_mutator(self, inplace=_inplace)
.add_item(
item=_item,
attrs=attrs,
)
.collection
),
inplace=_inplace,
type_check=False,
)
def build_method(self) -> Callable:
fn_item_type = _get_set_item_type(self.attr_spec)
return (
MethodBuilder(
self.name,
functools.partial(self.with_set_item, self.attr_spec),
)
.with_preamble(
f"Return a `{self.spec_cls.__name__}` instance identical to this one except with an item added to `{self.attr_spec.name}`."
)
.with_arg(
"_item",
desc=f"A new `{type_label(self.attr_spec.item_type)}` instance for {self.attr_spec.name}.",
default=MISSING if self.attr_spec.item_spec_type else Parameter.empty,
annotation=fn_item_type,
)
.with_arg(
"_inplace",
desc="Whether to perform change without first copying.",
default=False,
kind="keyword_only",
annotation=bool,
)
.with_arg(
"_if",
desc="This action is only taken when `_if` is `True`. If it is `False`, this is a no-op.",
default=True,
kind="keyword_only",
annotation=bool,
)
.with_spec_attrs_for(
self.attr_spec.item_spec_type,
desc_template=f"An optional new value for `{self.attr_spec.item_name}.{{}}`.",
)
.with_returns(
f"A reference to the mutated `{self.spec_cls.__name__}` instance.",
annotation=self.spec_cls,
)
.build()
)
class UpdateSetItemMethod(AttrMethodDescriptor):
"""
The method descriptor/generator for `update_<attr_singular>' for set
collections.
The default behavior of this method is to copy the spec-class with the item
associated with the given item in the collection associated with the
singular form of the attribute name updated with the provided new values.
For more information refer to the spec-classes documentation or the
generated method.
"""
@property
def method_name(self) -> str:
return f"update_{self.attr_spec.item_name}"
@staticmethod
def update_set_item(
attr_spec: Attr,
self,
_item: Any,
_new_item: Any,
*,
_inplace: bool = False,
_if: bool = True,
**attrs: Dict[str, Any],
) -> Any:
if not _if:
return self
return mutate_attr(
obj=self,
attr=attr_spec.name,
value=(
attr_spec.get_collection_mutator(self, inplace=_inplace)
.add_item(
item=_new_item,
attrs=attrs,
value_or_index=_item,
replace=False,
)
.collection
),
inplace=_inplace,
type_check=False,
)
def build_method(self) -> Callable:
fn_item_type = _get_set_item_type(self.attr_spec)
return (
MethodBuilder(
self.name,
functools.partial(self.update_set_item, self.attr_spec),
)
.with_preamble(
f"Return a `{self.spec_cls.__name__}` instance identical to this one except with an item updated in `{self.attr_spec.name}`."
)
.with_arg(
"_item",
desc="The value to transform.",
annotation=fn_item_type,
)
.with_arg(
"_new_item",
desc="A new item to replace the current item.",
default=MISSING if self.attr_spec.item_spec_type else Parameter.empty,
annotation=Callable[[fn_item_type], fn_item_type],
)
.with_arg(
"_inplace",
desc="Whether to perform change without first copying.",
default=False,
kind="keyword_only",
annotation=bool,
)
.with_arg(
"_if",
desc="This action is only taken when `_if` is `True`. If it is `False`, this is a no-op.",
default=True,
kind="keyword_only",
annotation=bool,
)
.with_spec_attrs_for(
self.attr_spec.item_spec_type,
desc_template=f"An optional new value for `{self.attr_spec.item_name}.{{}}`.",
)
.with_returns(
f"A reference to the mutated `{self.spec_cls.__name__}` instance.",
annotation=self.spec_cls,
)
.build()
)
class TransformSetItemMethod(AttrMethodDescriptor):
"""
The method descriptor/generator for `transform_<attr_singular>' for set
collections.
The default behavior of this method is to copy the spec-class with the item
associated with the given item in the collection associated with the
singular form of the attribute name transformed under the provided
transform. For more information refer to the spec-classes documentation or
the generated method.
"""
@property
def method_name(self) -> str:
return f"transform_{self.attr_spec.item_name}"
@staticmethod
def transform_set_item(
attr_spec: Attr,
self,
_item: Any,
_transform: Callable[[Any], Any],
*,
_inplace: bool = False,
_if: bool = True,
**attr_transforms: Dict[str, Callable[[Any], Any]],
) -> Any:
if not _if:
return self
return mutate_attr(
obj=self,
attr=attr_spec.name,
value=(
attr_spec.get_collection_mutator(self, inplace=_inplace)
.transform_item(
item=_item,
transform=_transform,
attr_transforms=attr_transforms,
)
.collection
),
inplace=_inplace,
type_check=False,
)
def build_method(self) -> Callable:
fn_item_type = _get_set_item_type(self.attr_spec)
return (
MethodBuilder(
self.name,
functools.partial(self.transform_set_item, self.attr_spec),
)
.with_preamble(
f"Return a `{self.spec_cls.__name__}` instance identical to this one except with an item transformed in `{self.attr_spec.name}`."
)
.with_arg(
"_item",
desc="The value to transform.",
annotation=fn_item_type,
)
.with_arg(
"_transform",
desc="A function that takes the old item as input, and returns the new item.",
default=MISSING if self.attr_spec.item_spec_type else Parameter.empty,
annotation=Callable[[fn_item_type], fn_item_type],
)
.with_arg(
"_inplace",
desc="Whether to perform change without first copying.",
default=False,
kind="keyword_only",
annotation=bool,
)
.with_arg(
"_if",
desc="This action is only taken when `_if` is `True`. If it is `False`, this is a no-op.",
default=True,
kind="keyword_only",
annotation=bool,
)
.with_spec_attrs_for(
self.attr_spec.item_spec_type,
desc_template=f"An optional transformer for `{self.attr_spec.item_name}.{{}}`.",
)
.with_returns(
f"A reference to the mutated `{self.spec_cls.__name__}` instance.",
annotation=self.spec_cls,
)
.build()
)
class WithoutSetItemMethod(AttrMethodDescriptor):
"""
The method descriptor/generator for `without_<attr_singular>' for set
collections.
The default behavior of this method is to copy the spec-class with the given
item in the collection associated with the singular form of the attribute
name removed. For more information refer to the spec-classes documentation
or the generated method.
"""
@property
def method_name(self) -> str:
return f"without_{self.attr_spec.item_name}"
@staticmethod
def without_set_item(
attr_spec: Attr, self, _item: Any, *, _inplace: bool = False, _if: bool = True
) -> Any:
if not _if:
return self
return mutate_attr(
obj=self,
attr=attr_spec.name,
value=(
attr_spec.get_collection_mutator(self, inplace=_inplace)
.remove_item(_item)
.collection
),
inplace=_inplace,
type_check=False,
)
def build_method(self) -> Callable:
fn_item_type = _get_set_item_type(self.attr_spec)
return (
MethodBuilder(
self.name,
functools.partial(self.without_set_item, self.attr_spec),
)
.with_preamble(
f"Return a `{self.spec_cls.__name__}` instance identical to this one except with an item removed from `{self.attr_spec.name}`."
)
.with_arg(
"_item",
desc="The value to remove.",
annotation=fn_item_type,
)
.with_arg(
"_inplace",
desc="Whether to perform change without first copying.",
default=False,
kind="keyword_only",
annotation=bool,
)
.with_arg(
"_if",
desc="This action is only taken when `_if` is `True`. If it is `False`, this is a no-op.",
default=True,
kind="keyword_only",
annotation=bool,
)
.with_returns(
f"A reference to the mutated `{self.spec_cls.__name__}` instance.",
annotation=self.spec_cls,
)
.build()
)
SET_METHODS = [
WithSetItemMethod,
UpdateSetItemMethod,
TransformSetItemMethod,
WithoutSetItemMethod,
]
| 32.908602 | 145 | 0.545172 | 1,314 | 12,242 | 4.829528 | 0.11035 | 0.054207 | 0.051056 | 0.035298 | 0.812323 | 0.812323 | 0.780176 | 0.753546 | 0.729436 | 0.72266 | 0 | 0 | 0.373468 | 12,242 | 371 | 146 | 32.997305 | 0.827379 | 0.122774 | 0 | 0.663366 | 0 | 0.026403 | 0.190638 | 0.056927 | 0 | 0 | 0 | 0 | 0 | 1 | 0.042904 | false | 0 | 0.026403 | 0.013201 | 0.138614 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
c888c8422179d073644a82a4990066217c0bc2e8 | 38 | py | Python | hocon_validator/__init__.py | chezou/hocon-validator | 1eb450a8d36f0dcad2e4fd26622bb587579bf602 | [
"Apache-2.0"
] | 5 | 2018-11-11T08:38:58.000Z | 2021-02-18T19:37:52.000Z | hocon_validator/__init__.py | chezou/hocon-validator | 1eb450a8d36f0dcad2e4fd26622bb587579bf602 | [
"Apache-2.0"
] | 1 | 2017-08-16T13:38:31.000Z | 2017-08-16T13:38:31.000Z | hocon_validator/__init__.py | chezou/hocon-validator | 1eb450a8d36f0dcad2e4fd26622bb587579bf602 | [
"Apache-2.0"
] | 1 | 2018-05-29T01:37:18.000Z | 2018-05-29T01:37:18.000Z | from .hocon_validator import validate
| 19 | 37 | 0.868421 | 5 | 38 | 6.4 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.105263 | 38 | 1 | 38 | 38 | 0.941176 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
c8ac576a4d3295811be28f392daeb1ed055b3378 | 117 | py | Python | www/lib/handlers/not_found_handler.py | cripplet/ipfire-material-design | 972dac352a097bbfe556bf4a6cad900c037cca21 | [
"MIT"
] | null | null | null | www/lib/handlers/not_found_handler.py | cripplet/ipfire-material-design | 972dac352a097bbfe556bf4a6cad900c037cca21 | [
"MIT"
] | 3 | 2019-07-13T08:03:22.000Z | 2019-07-13T08:06:03.000Z | www/lib/handlers/not_found_handler.py | cripplet/ipfire-material-design | 972dac352a097bbfe556bf4a6cad900c037cca21 | [
"MIT"
] | null | null | null | import flask
import http
def not_found_handler():
return flask.Response(
status=http.HTTPStatus.NOT_FOUND)
| 14.625 | 39 | 0.760684 | 16 | 117 | 5.375 | 0.6875 | 0.186047 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.162393 | 117 | 7 | 40 | 16.714286 | 0.877551 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.2 | true | 0 | 0.4 | 0.2 | 0.8 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 1 | 1 | 0 | 0 | 6 |
c8b68aee55d6d14a5b8da63257ca797d20dc8624 | 35 | py | Python | tuple.py | toby20-meet/meet2018y1lab6 | aa57062969a867bc242c44ba788ab134510d8470 | [
"MIT"
] | null | null | null | tuple.py | toby20-meet/meet2018y1lab6 | aa57062969a867bc242c44ba788ab134510d8470 | [
"MIT"
] | null | null | null | tuple.py | toby20-meet/meet2018y1lab6 | aa57062969a867bc242c44ba788ab134510d8470 | [
"MIT"
] | null | null | null | my_tuple = (0,1,2)
my_tuple[0] = 3
| 11.666667 | 18 | 0.6 | 9 | 35 | 2.111111 | 0.666667 | 0.736842 | 0.842105 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.172414 | 0.171429 | 35 | 2 | 19 | 17.5 | 0.482759 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
cdc2998a60e830eb36184c38550c1ac92024a2ae | 133 | py | Python | bitquant/__init__.py | rosspalmer/bitQuant | 424745deeef8ee6af6a32f8c508903c2da727f8d | [
"MIT"
] | 27 | 2015-02-22T22:01:27.000Z | 2021-06-24T15:38:03.000Z | bitquant/__init__.py | rosspalmer/bitQuant | 424745deeef8ee6af6a32f8c508903c2da727f8d | [
"MIT"
] | 17 | 2015-03-05T09:02:38.000Z | 2015-08-14T20:21:42.000Z | bitquant/__init__.py | rosspalmer/bitQuant | 424745deeef8ee6af6a32f8c508903c2da727f8d | [
"MIT"
] | 10 | 2015-03-04T08:20:44.000Z | 2020-03-18T03:24:26.000Z | # -*- coding: utf-8 -*-
from api.clss import api
from sql.setup import setup_sql
from sql.clss import sql
from data.clss import data
| 22.166667 | 31 | 0.744361 | 24 | 133 | 4.083333 | 0.416667 | 0.306122 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.008929 | 0.157895 | 133 | 5 | 32 | 26.6 | 0.866071 | 0.157895 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
cdcec445cd807ed39ce7f568bc04be2ecc4c4ef6 | 706 | py | Python | pygears/sim/log.py | bogdanvuk/pygears | a0b21d445e1d5c89ad66751447b8253536b835ee | [
"MIT"
] | 120 | 2018-04-23T08:29:04.000Z | 2022-03-30T14:41:52.000Z | pygears/sim/log.py | FZP1607152286/pygears | a0b21d445e1d5c89ad66751447b8253536b835ee | [
"MIT"
] | 12 | 2019-07-09T17:12:58.000Z | 2022-03-18T09:05:10.000Z | pygears/sim/log.py | FZP1607152286/pygears | a0b21d445e1d5c89ad66751447b8253536b835ee | [
"MIT"
] | 12 | 2019-05-10T19:42:08.000Z | 2022-03-28T18:26:44.000Z | import logging
def debug(msg, *args, **kwds):
return logging.getLogger('sim').debug(msg, *args, **kwds)
def info(msg, *args, **kwds):
return logging.getLogger('sim').info(msg, *args, **kwds)
def warning(msg, *args, **kwds):
return logging.getLogger('sim').warning(msg, *args, **kwds)
def error(msg, *args, **kwds):
return logging.getLogger('sim').error(msg, *args, **kwds)
def critical(msg, *args, **kwds):
return logging.getLogger('sim').critical(msg, *args, **kwds)
def log(level, msg, *args, **kwds):
return logging.getLogger('sim').log(level, msg, *args, **kwds)
def exception(msg, *args, **kwds):
return logging.getLogger('sim').exception(msg, *args, **kwds)
| 23.533333 | 66 | 0.644476 | 95 | 706 | 4.789474 | 0.178947 | 0.215385 | 0.338462 | 0.261538 | 0.613187 | 0.553846 | 0.553846 | 0 | 0 | 0 | 0 | 0 | 0.144476 | 706 | 29 | 67 | 24.344828 | 0.753311 | 0 | 0 | 0 | 0 | 0 | 0.029745 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.466667 | false | 0 | 0.066667 | 0.466667 | 1 | 0 | 0 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 6 |
cdf67e95c611de4b6486b851b7c8489095a47c9d | 75 | py | Python | py_tdlib/constructors/chat_report_reason_child_abuse.py | Mr-TelegramBot/python-tdlib | 2e2d21a742ebcd439971a32357f2d0abd0ce61eb | [
"MIT"
] | 24 | 2018-10-05T13:04:30.000Z | 2020-05-12T08:45:34.000Z | py_tdlib/constructors/chat_report_reason_child_abuse.py | MrMahdi313/python-tdlib | 2e2d21a742ebcd439971a32357f2d0abd0ce61eb | [
"MIT"
] | 3 | 2019-06-26T07:20:20.000Z | 2021-05-24T13:06:56.000Z | py_tdlib/constructors/chat_report_reason_child_abuse.py | MrMahdi313/python-tdlib | 2e2d21a742ebcd439971a32357f2d0abd0ce61eb | [
"MIT"
] | 5 | 2018-10-05T14:29:28.000Z | 2020-08-11T15:04:10.000Z | from ..factory import Type
class chatReportReasonChildAbuse(Type):
pass
| 12.5 | 39 | 0.8 | 8 | 75 | 7.5 | 0.875 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.133333 | 75 | 5 | 40 | 15 | 0.923077 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.333333 | 0.333333 | 0 | 0.666667 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
b54a48dd2d406324c11d3415f8942ae7dc5ebdf3 | 1,125 | py | Python | terrascript/pagerduty/r.py | hugovk/python-terrascript | 08fe185904a70246822f5cfbdc9e64e9769ec494 | [
"BSD-2-Clause"
] | 4 | 2022-02-07T21:08:14.000Z | 2022-03-03T04:41:28.000Z | terrascript/pagerduty/r.py | hugovk/python-terrascript | 08fe185904a70246822f5cfbdc9e64e9769ec494 | [
"BSD-2-Clause"
] | null | null | null | terrascript/pagerduty/r.py | hugovk/python-terrascript | 08fe185904a70246822f5cfbdc9e64e9769ec494 | [
"BSD-2-Clause"
] | 2 | 2022-02-06T01:49:42.000Z | 2022-02-08T14:15:00.000Z | # terrascript/pagerduty/r.py
import terrascript
class pagerduty_addon(terrascript.Resource):
pass
class pagerduty_escalation_policy(terrascript.Resource):
pass
class pagerduty_maintenance_window(terrascript.Resource):
pass
class pagerduty_schedule(terrascript.Resource):
pass
class pagerduty_service(terrascript.Resource):
pass
class pagerduty_service_integration(terrascript.Resource):
pass
class pagerduty_team(terrascript.Resource):
pass
class pagerduty_team_membership(terrascript.Resource):
pass
class pagerduty_user(terrascript.Resource):
pass
class pagerduty_user_contact_method(terrascript.Resource):
pass
class pagerduty_user_notification_rule(terrascript.Resource):
pass
class pagerduty_extension(terrascript.Resource):
pass
class pagerduty_event_rule(terrascript.Resource):
pass
class pagerduty_ruleset(terrascript.Resource):
pass
class pagerduty_ruleset_rule(terrascript.Resource):
pass
class pagerduty_business_service(terrascript.Resource):
pass
class pagerduty_service_dependency(terrascript.Resource):
pass
| 15.84507 | 61 | 0.796444 | 120 | 1,125 | 7.225 | 0.233333 | 0.27451 | 0.45098 | 0.516724 | 0.768166 | 0.597463 | 0.117647 | 0 | 0 | 0 | 0 | 0 | 0.139556 | 1,125 | 70 | 62 | 16.071429 | 0.895661 | 0.023111 | 0 | 0.485714 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.485714 | 0.028571 | 0 | 0.514286 | 0 | 0 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 1 | 0 | 0 | 6 |
b55a43aad6496daa1da9d49f32be4e6b21218767 | 340 | py | Python | travel/home/views.py | Alijeyrad/django_practice | da5918b9283471706378e32885943e4e829758d5 | [
"MIT"
] | null | null | null | travel/home/views.py | Alijeyrad/django_practice | da5918b9283471706378e32885943e4e829758d5 | [
"MIT"
] | null | null | null | travel/home/views.py | Alijeyrad/django_practice | da5918b9283471706378e32885943e4e829758d5 | [
"MIT"
] | null | null | null | from django.shortcuts import render
# Create your views here.
def index(request):
return render(request, 'home/index.html')
def about(request):
return render(request, 'home/about.html')
def contact(request):
return render(request, 'home/contact.html')
def elements(request):
return render(request, 'home/elements.html') | 22.666667 | 48 | 0.729412 | 45 | 340 | 5.511111 | 0.4 | 0.209677 | 0.306452 | 0.419355 | 0.483871 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.144118 | 340 | 15 | 48 | 22.666667 | 0.852234 | 0.067647 | 0 | 0 | 0 | 0 | 0.205696 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.444444 | false | 0 | 0.111111 | 0.444444 | 1 | 0 | 0 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 6 |
8d1d9982c9eea2c6279eff5b5961c3daf7fce110 | 17,859 | py | Python | server/apps/streamnote/tests/test_note_api.py | iotile/iotile_cloud | 9dc65ac86d3a730bba42108ed7d9bbb963d22ba6 | [
"MIT"
] | null | null | null | server/apps/streamnote/tests/test_note_api.py | iotile/iotile_cloud | 9dc65ac86d3a730bba42108ed7d9bbb963d22ba6 | [
"MIT"
] | null | null | null | server/apps/streamnote/tests/test_note_api.py | iotile/iotile_cloud | 9dc65ac86d3a730bba42108ed7d9bbb963d22ba6 | [
"MIT"
] | null | null | null | import json
from django.contrib.auth import get_user_model
from django.utils import timezone
from rest_framework import status
from rest_framework.test import APITestCase
from apps.streamfilter.models import *
from apps.utils.test_util import TestMixin
from apps.vartype.models import VarType
from ..models import *
user_model = get_user_model()
class StreamNoteAPITests(TestMixin, APITestCase):
def setUp(self):
self.usersTestSetup()
self.orgTestSetup()
self.deviceTemplateTestSetup()
self.v1 = StreamVariable.objects.create_variable(
name='Var A', project=self.p1, created_by=self.u2, lid=1,
)
self.v2 = StreamVariable.objects.create_variable(
name='Var B', project=self.p2, created_by=self.u3, lid=2,
)
self.pd1 = Device.objects.create_device(project=self.p1, label='d1', template=self.dt1, created_by=self.u2)
self.pd2 = Device.objects.create_device(project=self.p2, label='d2', template=self.dt1, created_by=self.u3)
StreamId.objects.create_after_new_device(self.pd1)
StreamId.objects.create_after_new_device(self.pd2)
self.s1 = StreamId.objects.filter(variable=self.v1).first()
self.s2 = StreamId.objects.filter(variable=self.v2).first()
self.var_type = VarType.objects.create(
name='Accelerometer',
storage_units_full='Object',
created_by=self.u1
)
if cache:
cache.clear()
def tearDown(self):
S3File.objects.all().delete()
StreamNote.objects.all().delete()
StreamId.objects.all().delete()
StreamVariable.objects.all().delete()
Device.objects.all().delete()
self.deviceTemplateTestTearDown()
self.orgTestTearDown()
self.userTestTearDown()
def testBasicGet(self):
n1 = StreamNote.objects.create(
target_slug=self.s1.slug, timestamp=timezone.now(), note='Note 1', created_by=self.u2
)
n2 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 2', created_by=self.u1, type='sc'
)
list_url = reverse('streamnote-list')
detail_url1 = reverse('streamnote-detail', kwargs={'pk': n1.id})
detail_url2 = reverse('streamnote-detail', kwargs={'pk': n2.id})
response = self.client.get(list_url, format='json')
self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED)
response = self.client.get(detail_url1, format='json')
self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED)
response = self.client.get(detail_url2, format='json')
self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED)
ok = self.client.login(email='user1@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.get(list_url, format='json')
self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST)
response = self.client.get(list_url+'?target={}'.format(self.s1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 1)
self.assertEqual(deserialized['results'][0]['note'], 'Note 1')
self.assertEqual(deserialized['results'][0]['user_info']['slug'], self.u2.slug)
response = self.client.get(list_url+'?target={}'.format(self.pd1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
response = self.client.get(detail_url1, format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['note'], 'Note 1')
self.assertEqual(deserialized['type'], 'ui')
self.assertEqual(deserialized['user_info']['slug'], self.u2.slug)
response = self.client.get(detail_url2, format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['note'], 'Note 2')
self.assertEqual(deserialized['type'], 'sc')
self.assertEqual(deserialized['user_info']['slug'], self.u1.slug)
self.client.logout()
ok = self.client.login(email='user2@foo.com', password='pass')
self.assertTrue(ok)
self.assertTrue(self.o2.has_permission(self.u2, 'can_read_notes'))
response = self.client.get(list_url+'?target={}'.format(self.s1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 1)
response = self.client.get(detail_url1, format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['note'], 'Note 1')
self.assertEqual(deserialized['user_info']['slug'], self.u2.slug)
response = self.client.get(detail_url2, format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
self.client.logout()
ok = self.client.login(email='user3@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.get(list_url, format='json')
self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST)
response = self.client.get(detail_url1, format='json')
self.assertEqual(response.status_code, status.HTTP_403_FORBIDDEN)
response = self.client.get(detail_url2, format='json')
self.assertEqual(response.status_code, status.HTTP_403_FORBIDDEN)
membership = self.p1.org.register_user(self.u3, role='m1')
membership.permissions['can_read_notes'] = False
membership.save()
response = self.client.get(list_url, format='json')
self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST)
response = self.client.get(detail_url2, format='json')
self.assertEqual(response.status_code, status.HTTP_403_FORBIDDEN)
self.client.logout()
def testGetLastN(self):
n1 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 1', created_by=self.u2
)
n2 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 2', created_by=self.u1, type='sc'
)
n3 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 3', created_by=self.u1, type='sc'
)
url = reverse('streamnote-list')
response = self.client.get(url, format='json')
self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED)
ok = self.client.login(email='user1@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.get(url+'?target={}'.format(self.pd1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 3)
self.assertEqual(deserialized['results'][0]['note'], 'Note 1')
response = self.client.get(url+'?target={}&lastn=1'.format(self.pd1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 1)
self.assertEqual(deserialized['results'][0]['note'], 'Note 3')
response = self.client.get(url+'?target={}&lastn=2'.format(self.pd1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 2)
self.assertEqual(deserialized['results'][0]['note'], 'Note 2')
self.assertEqual(deserialized['results'][1]['note'], 'Note 3')
response = self.client.get(url+'?target={}&lastn=-1'.format(self.pd1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST)
response = self.client.get(url+'?target={}&lastn=20000000000'.format(self.pd1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST)
self.client.logout()
def testGetWithFilter(self):
n1 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 1', created_by=self.u2
)
n2 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 2', created_by=self.u1, type='sc'
)
n3 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 3', created_by=self.u1, type='sc'
)
n4 = StreamNote.objects.create(
target_slug=self.pd1.slug, timestamp=timezone.now(), note='Note 4', created_by=self.u1, type='sc'
)
n5 = StreamNote.objects.create(
target_slug=self.s1.slug, timestamp=timezone.now(), note='Note 5', created_by=self.u1, type='sc'
)
url = reverse('streamnote-list')
ok = self.client.login(email='user1@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.get(url, format='json')
self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST)
response = self.client.get(url+'?target={}'.format(self.pd1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 4)
response = self.client.get(url+'?target={}'.format(self.s1.slug), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 1)
response = self.client.get(url+'?target={0}&id_min={1}'.format(self.pd1.slug, n1.id), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 4)
response = self.client.get(url+'?target={0}&id_min={1}&id_max={1}'.format(self.pd1.slug, n1.id), format='json')
self.assertEqual(response.status_code, status.HTTP_200_OK)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 1)
self.client.logout()
def testBasicPost(self):
url = reverse('streamnote-list')
payload = {
'target': self.s1.slug,
'timestamp': timezone.now(),
'note': 'This is my first node'
}
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED)
ok = self.client.login(email='user3@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_403_FORBIDDEN)
self.client.logout()
ok = self.client.login(email='user1@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_201_CREATED)
self.assertEqual(StreamNote.objects.count(), 1)
deserialized = json.loads(response.content.decode())
self.assertTrue('id' in deserialized)
self.assertEqual(deserialized['target'], self.s1.slug)
self.assertTrue('user_info' in deserialized)
self.assertEqual(deserialized['user_info']['slug'], self.u1.slug)
self.client.logout()
ok = self.client.login(email='user2@foo.com', password='pass')
self.assertTrue(ok)
payload = {
'target': self.s1.slug,
'timestamp': timezone.now(),
'note': 'This is my second node'
}
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_201_CREATED)
self.assertEqual(StreamNote.objects.count(), 2)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['target'], self.s1.slug)
self.client.logout()
ok = self.client.login(email='user3@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_403_FORBIDDEN)
self.p1.org.register_user(self.u3, role='r1')
payload = {
'target': self.s1.slug,
'timestamp': timezone.now(),
'note': 'This is my third node (operator)'
}
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_201_CREATED)
self.assertEqual(StreamNote.objects.count(), 3)
self.client.logout()
def testMultiPost(self):
url = reverse('streamnote-list')
payload = [
{
'target': self.s1.slug,
'timestamp': timezone.now(),
'note': 'This is my first node'
},
{
'target': self.s1.slug,
'timestamp': timezone.now(),
'note': 'This is my second node'
}
]
ok = self.client.login(email='user1@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_201_CREATED)
self.assertEqual(StreamNote.objects.count(), 2)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['count'], 2)
self.client.logout()
def testS3FileAttachUrl(self):
"""
Ensure we can create a new s3file with the script
"""
n1 = StreamNote.objects.create(
target_slug=self.s1.slug, timestamp=timezone.now(), note='Note 1', created_by=self.u2
)
url = reverse('streamnote-uploadurl', kwargs={'pk': n1.pk})
payload = {
'name': 'deleteme.png'
}
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED)
ok = self.client.login(email='user2@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_202_ACCEPTED)
self.assertEqual(StreamNote.objects.count(), 1)
self.assertEqual(S3File.objects.count(), 0)
deserialized = json.loads(response.content.decode())
self.assertTrue('url' in deserialized)
self.assertTrue('uuid' in deserialized)
self.assertTrue('fields' in deserialized)
self.assertTrue('acl' in deserialized['fields'])
self.assertEqual(deserialized['fields']['acl'], 'private')
self.assertEqual(deserialized['fields']['x-amz-meta-filename'], 'deleteme.png')
self.assertEqual(deserialized['fields']['x-amz-meta-type'], 'note')
"""
import os
import requests
test_filename = __file__
self.assertTrue(os.path.isfile(test_filename))
with open(test_filename, 'r') as fp:
files = {"file": fp}
response = requests.post(deserialized["url"], data=deserialized["fields"], files=files)
print(response)
"""
self.client.logout()
def testS3FileAttachSuccess(self):
"""
Ensure we can create a new s3file with the script
"""
n1 = StreamNote.objects.create(
target_slug=self.s1.slug, timestamp=timezone.now(), note='Note 1', created_by=self.u2
)
url = reverse('streamnote-uploadsuccess', kwargs={'pk': n1.pk})
payload = {
'name': 'deleteme.png',
'uuid': 'a470cd29-915f-4cfb-97de-ea378c46d51c'
}
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED)
ok = self.client.login(email='user2@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_202_ACCEPTED)
self.assertEqual(StreamNote.objects.count(), 1)
self.assertEqual(S3File.objects.count(), 1)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['id'], payload['uuid'])
self.client.logout()
ok = self.client.login(email='user3@foo.com', password='pass')
self.assertTrue(ok)
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_403_FORBIDDEN)
self.p1.org.register_user(self.u3, role='r1')
payload = {
'name': 'deleteme.png',
'uuid': 'a470cd29-915f-0000-97de-ea378c461234'
}
response = self.client.post(url, payload, format='json')
self.assertEqual(response.status_code, status.HTTP_202_ACCEPTED)
self.assertEqual(S3File.objects.count(), 2)
deserialized = json.loads(response.content.decode())
self.assertEqual(deserialized['id'], payload['uuid'])
self.client.logout()
| 42.420428 | 119 | 0.646285 | 2,111 | 17,859 | 5.363809 | 0.102321 | 0.107304 | 0.065177 | 0.088316 | 0.845536 | 0.83061 | 0.801996 | 0.779829 | 0.755718 | 0.755012 | 0 | 0.025519 | 0.212274 | 17,859 | 420 | 120 | 42.521429 | 0.779357 | 0.005543 | 0 | 0.628483 | 0 | 0 | 0.093208 | 0.010312 | 0 | 0 | 0 | 0 | 0.312694 | 1 | 0.027864 | false | 0.040248 | 0.027864 | 0 | 0.058824 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
8d56322e420a9b87c08c3b68f54ac1cc60fe613c | 42 | py | Python | syfertext/data/readers/__init__.py | Dat-Boi-Arjun/SyferText | 8df9c4807501b613df79773b391ded22c101e0b0 | [
"Apache-2.0"
] | 204 | 2019-10-18T15:49:15.000Z | 2022-02-16T12:34:29.000Z | syfertext/data/readers/__init__.py | Dat-Boi-Arjun/SyferText | 8df9c4807501b613df79773b391ded22c101e0b0 | [
"Apache-2.0"
] | 162 | 2019-12-16T21:03:17.000Z | 2021-05-22T19:40:37.000Z | syfertext/data/readers/__init__.py | Dat-Boi-Arjun/SyferText | 8df9c4807501b613df79773b391ded22c101e0b0 | [
"Apache-2.0"
] | 82 | 2020-01-18T14:15:29.000Z | 2021-04-30T09:48:27.000Z | from .language_modeling import TextReader
| 21 | 41 | 0.880952 | 5 | 42 | 7.2 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.095238 | 42 | 1 | 42 | 42 | 0.947368 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
8da1f174c319060662a0a56587e4d520273a6155 | 281 | py | Python | fohCreateThreadInProcessForIdAndAddress.py | SkyLined/mWindowsAPI | d64d57bbf87d2a7b33cf7de89263553793484a84 | [
"CC-BY-4.0"
] | 7 | 2017-10-09T14:32:22.000Z | 2021-01-30T07:25:50.000Z | fohCreateThreadInProcessForIdAndAddress.py | SkyLined/mWindowsAPI | d64d57bbf87d2a7b33cf7de89263553793484a84 | [
"CC-BY-4.0"
] | 2 | 2017-12-12T02:53:18.000Z | 2019-02-19T09:23:18.000Z | fohCreateThreadInProcessForIdAndAddress.py | SkyLined/mWindowsAPI | d64d57bbf87d2a7b33cf7de89263553793484a84 | [
"CC-BY-4.0"
] | 1 | 2017-12-12T02:42:18.000Z | 2017-12-12T02:42:18.000Z | from .ftohuCreateThreadForProcessIdAndAddress import ftohuCreateThreadForProcessIdAndAddress;
def fohCreateThreadForProcessIdAndAddress(*txArguments, **dxArguments):
(ohThread, uThreadId) = ftohuCreateThreadForProcessIdAndAddress(*txArguments, **dxArguments);
return ohThread; | 56.2 | 95 | 0.86121 | 15 | 281 | 16.133333 | 0.666667 | 0.181818 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.064057 | 281 | 5 | 96 | 56.2 | 0.920152 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | true | 0 | 0.25 | 0 | 0.75 | 0 | 1 | 0 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 0 | 1 | 0 | 0 | 6 |
a5f8d8c57ed6f8f4cf0ba51dd7c760a9d9354fb6 | 202 | py | Python | squid/core/admin.py | DjangoNYC/squid | e9776df722d6c4d8e43738c053c610475f73f0db | [
"MIT"
] | null | null | null | squid/core/admin.py | DjangoNYC/squid | e9776df722d6c4d8e43738c053c610475f73f0db | [
"MIT"
] | null | null | null | squid/core/admin.py | DjangoNYC/squid | e9776df722d6c4d8e43738c053c610475f73f0db | [
"MIT"
] | null | null | null | from django.contrib import admin
from .models import Member, Event, Venue, MemberRSVP
admin.site.register(Member)
admin.site.register(Event)
admin.site.register(Venue)
admin.site.register(MemberRSVP)
| 22.444444 | 52 | 0.811881 | 28 | 202 | 5.857143 | 0.428571 | 0.219512 | 0.414634 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.084158 | 202 | 8 | 53 | 25.25 | 0.886486 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.333333 | 0 | 0.333333 | 0 | 1 | 0 | 0 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
574a0e4bcf031f1727caaad1550885dec0c0c961 | 2,036 | py | Python | spareparts/lib/colors.py | recs12/spareparts | 6dd66c2992e4fbe598a9e30b065f5752f8ff6c1c | [
"Apache-2.0",
"MIT"
] | null | null | null | spareparts/lib/colors.py | recs12/spareparts | 6dd66c2992e4fbe598a9e30b065f5752f8ff6c1c | [
"Apache-2.0",
"MIT"
] | 18 | 2020-03-25T19:55:19.000Z | 2020-05-27T19:01:26.000Z | spareparts/lib/colors.py | recs12/spareparts | 6dd66c2992e4fbe598a9e30b065f5752f8ff6c1c | [
"Apache-2.0",
"MIT"
] | null | null | null | import functools
class Colors:
def electric(prp1, color):
def _outer_wrapper(wrapped_function):
@functools.wraps(wrapped_function)
def _wrapper(*args, **kwargs):
d, s = wrapped_function(*args, **kwargs)
targeted_index = d.index[d.prp1.isin(prp1)].tolist()
for row in targeted_index:
cellule = (
f"A{row+2}:U{row+2}"
) # number 2 added for compensate lapse in excel file
s.range(cellule).color = color
return (d, s)
return _wrapper
return _outer_wrapper
def obsolete(color):
def _outer_wrapper(wrapped_function):
@functools.wraps(wrapped_function)
def _wrapper(*args, **kwargs):
d, s = wrapped_function(*args, **kwargs)
targeted_index = d.index[d.ST.isin(["O", "U"])].tolist()
for row in targeted_index:
cellule = (
f"J{row+2}"
) # number 2 added for compensate lapse in excel file
s.range(cellule).color = color
return (d, s)
return _wrapper
return _outer_wrapper
def meter_foot(color):
def _outer_wrapper(wrapped_function):
@functools.wraps(wrapped_function)
def _wrapper(*args, **kwargs):
d, s = wrapped_function(*args, **kwargs)
targeted_index = d.index[d.UOM.isin(["MT", "FT", "RL", "SF"])].tolist()
for row in targeted_index:
cellule = (
f"I{row+2}"
) # number 2 added for compensate lapse in excel file
s.range(cellule).color = color
return (d, s)
return _wrapper
return _outer_wrapper
electric = staticmethod(electric)
obsolete = staticmethod(obsolete)
meter_foot = staticmethod(meter_foot)
| 34.508475 | 87 | 0.514735 | 213 | 2,036 | 4.751174 | 0.234742 | 0.133399 | 0.038538 | 0.059289 | 0.815217 | 0.815217 | 0.815217 | 0.815217 | 0.711462 | 0.711462 | 0 | 0.008032 | 0.388507 | 2,036 | 58 | 88 | 35.103448 | 0.804819 | 0.073183 | 0 | 0.638298 | 0 | 0 | 0.022836 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.191489 | false | 0 | 0.021277 | 0 | 0.489362 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
93a1d968a38b1a1f17add4e2b5c4c45c2869df78 | 21 | py | Python | model/mlp/dbm/__init__.py | remmyzen/nqs-tensorflow2 | 2af5d5ebb108eac4d2daa5082bdef11c8107bd1b | [
"MIT"
] | 4 | 2021-07-29T17:52:54.000Z | 2022-02-15T06:32:15.000Z | model/mlp/dbm/__init__.py | remmyzen/nqs-tensorflow2 | 2af5d5ebb108eac4d2daa5082bdef11c8107bd1b | [
"MIT"
] | null | null | null | model/mlp/dbm/__init__.py | remmyzen/nqs-tensorflow2 | 2af5d5ebb108eac4d2daa5082bdef11c8107bd1b | [
"MIT"
] | null | null | null | from .dbm import DBM
| 10.5 | 20 | 0.761905 | 4 | 21 | 4 | 0.75 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.190476 | 21 | 1 | 21 | 21 | 0.941176 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
93d5d780bcc5ed64d7215cba088fc100f3ce6870 | 899 | py | Python | pytools_sample_#5.py | gnokem/blog-code | ba3bf3be939d91a808910f2d5407b350237f93e7 | [
"MIT"
] | null | null | null | pytools_sample_#5.py | gnokem/blog-code | ba3bf3be939d91a808910f2d5407b350237f93e7 | [
"MIT"
] | null | null | null | pytools_sample_#5.py | gnokem/blog-code | ba3bf3be939d91a808910f2d5407b350237f93e7 | [
"MIT"
] | null | null | null | import os, sys;
def F(x): # this function factors a number x into its prime factors
r=[];
i=2;
while x>1:
while (x % i)==0:
r+=[i];
x/=i;
i+=1;
return r;
print "prime factors of 100 are: ",F(100);
print "prime factors of 1024 are: ",F(1024);
print "prime factors of 1789 are: ",F(1789);
print "prime factors of 2013 are: ",F(2013);
print "prime factors of 11204243 are: ",F(11204243);
print "prime factors of 112042431 are: ",F(112042431);
print "prime factors of 1120424311 are: ",F(1120424311);
# output follows:
# prime factors of 100 are: [2, 2, 5, 5]
# prime factors of 1024 are: [2, 2, 2, 2, 2, 2, 2, 2, 2, 2]
# prime factors of 1789 are: [1789]
# prime factors of 2013 are: [3, 11, 61]
# prime factors of 11204243 are: [19, 23, 25639]
# prime factors of 112042431 are: [3, 3, 101, 123259]
# prime factors of 1120424311 are: [1120424311]
| 29.966667 | 68 | 0.628476 | 153 | 899 | 3.69281 | 0.27451 | 0.318584 | 0.346903 | 0.235398 | 0.587611 | 0.017699 | 0.017699 | 0.017699 | 0.017699 | 0 | 0 | 0.263309 | 0.226919 | 899 | 29 | 69 | 31 | 0.54964 | 0.437152 | 0 | 0 | 0 | 0 | 0.43469 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | null | 0 | 0.058824 | null | null | 0.411765 | 0 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 6 |
9e16c4d5033f921c698febe768f1c769e05e2e14 | 14,602 | py | Python | gala/coordinates/tests/test_velocity_frame_transforms.py | ltlancas/gala | 2621bb599d67e74a85446abf72d5930ef70ca181 | [
"MIT"
] | 1 | 2021-10-14T03:36:15.000Z | 2021-10-14T03:36:15.000Z | gala/coordinates/tests/test_velocity_frame_transforms.py | ltlancas/gala | 2621bb599d67e74a85446abf72d5930ef70ca181 | [
"MIT"
] | null | null | null | gala/coordinates/tests/test_velocity_frame_transforms.py | ltlancas/gala | 2621bb599d67e74a85446abf72d5930ef70ca181 | [
"MIT"
] | null | null | null | # coding: utf-8
"""
Test conversions in core.py
"""
from __future__ import absolute_import, division, print_function
# Standard library
import tempfile
# Third-party
import astropy.coordinates as coord
import astropy.units as u
from astropy.utils.data import get_pkg_data_filename
from astropy.tests.helper import quantity_allclose
import numpy as np
# This package
from ..velocity_frame_transforms import (vgal_to_hel, vhel_to_gal,
vgsr_to_vhel, vhel_to_vgsr)
def test_vgsr_to_vhel():
filename = get_pkg_data_filename('idl_vgsr_vhel.txt')
data = np.genfromtxt(filename, names=True, skip_header=2)
# one row
row = data[0]
l = coord.Angle(row["lon"] * u.degree)
b = coord.Angle(row["lat"] * u.degree)
c = coord.Galactic(l, b)
vgsr = row["vgsr"] * u.km/u.s
vlsr = [row["vx"],row["vy"],row["vz"]]*u.km/u.s # this is right
vcirc = row["vcirc"]*u.km/u.s
vsun = vlsr + [0,1,0]*vcirc
vhel = vgsr_to_vhel(c, vgsr, vsun=vsun)
return
np.testing.assert_almost_equal(vhel.value, row['vhelio'], decimal=4)
# now check still get right answer passing in ICRS coordinates
vhel = vgsr_to_vhel(c.transform_to(coord.ICRS), vgsr, vsun=vsun)
np.testing.assert_almost_equal(vhel.value, row['vhelio'], decimal=4)
# all together now
l = coord.Angle(data["lon"] * u.degree)
b = coord.Angle(data["lat"] * u.degree)
c = coord.Galactic(l, b)
vgsr = data["vgsr"] * u.km/u.s
vhel = vgsr_to_vhel(c, vgsr, vsun=vsun)
np.testing.assert_almost_equal(vhel.value, data['vhelio'], decimal=4)
# now check still get right answer passing in ICRS coordinates
vhel = vgsr_to_vhel(c.transform_to(coord.ICRS), vgsr, vsun=vsun)
np.testing.assert_almost_equal(vhel.value, data['vhelio'], decimal=4)
def test_vgsr_to_vhel_misc():
# make sure it works with longitude in 0-360 or -180-180
l1 = coord.Angle(190.*u.deg)
l2 = coord.Angle(-170.*u.deg)
b = coord.Angle(30.*u.deg)
c1 = coord.Galactic(l1, b)
c2 = coord.Galactic(l2, b)
vgsr = -110.*u.km/u.s
vhel1 = vgsr_to_vhel(c1, vgsr)
vhel2 = vgsr_to_vhel(c2, vgsr)
np.testing.assert_almost_equal(vhel1.value, vhel2.value, decimal=9)
def test_vhel_to_vgsr():
filename = get_pkg_data_filename('idl_vgsr_vhel.txt')
data = np.genfromtxt(filename, names=True, skip_header=2)
# one row
row = data[0]
l = coord.Angle(row["lon"] * u.degree)
b = coord.Angle(row["lat"] * u.degree)
c = coord.Galactic(l, b)
vhel = row["vhelio"] * u.km/u.s
vlsr = [row["vx"],row["vy"],row["vz"]]*u.km/u.s # this is right
vcirc = row["vcirc"]*u.km/u.s
vsun = vlsr + [0,1,0]*vcirc
vgsr = vhel_to_vgsr(c, vhel, vsun=vsun)
np.testing.assert_almost_equal(vgsr.value, row['vgsr'], decimal=4)
# now check still get right answer passing in ICRS coordinates
vgsr = vhel_to_vgsr(c.transform_to(coord.ICRS), vhel, vsun=vsun)
np.testing.assert_almost_equal(vgsr.value, row['vgsr'], decimal=4)
# all together now
l = coord.Angle(data["lon"] * u.degree)
b = coord.Angle(data["lat"] * u.degree)
c = coord.Galactic(l, b)
vhel = data["vhelio"] * u.km/u.s
vgsr = vhel_to_vgsr(c, vhel, vsun=vsun)
np.testing.assert_almost_equal(vgsr.value, data['vgsr'], decimal=4)
# now check still get right answer passing in ICRS coordinates
vgsr = vhel_to_vgsr(c.transform_to(coord.ICRS), vhel, vsun=vsun)
np.testing.assert_almost_equal(vgsr.value, data['vgsr'], decimal=4)
_txt = """# from: XHIP catalog
# ra dec HIPID l b dist pml pmb rv U V W
0.022010 20.036114 7 106.82021040 -41.22316218 57.56 -253.69 -138.84 8.30 71.7 2.1 -34.0
2.208349 40.494550 714 114.23363142 -21.65650026 249.00 5.57 -9.00 -11.78 0.1 -16.3 -5.5
3.126297 14.563522 999 108.98177530 -47.25067692 40.94 296.66 -141.05 -15.30 -44.5 -47.6 -7.3
"""
class TestVHelGalConvert(object):
def setup(self):
with tempfile.NamedTemporaryFile(mode='w+b') as temp:
temp.write(_txt.encode('utf-8'))
temp.flush()
temp.seek(0)
self.data = np.genfromtxt(temp, names=True, skip_header=1)
# This should make the transformations more compatible
g = coord.Galactic(l=0*u.deg, b=0*u.deg).transform_to(coord.ICRS)
self.galcen_frame = coord.Galactocentric(galcen_coord=g,
z_sun=0*u.kpc)
def test_vhel_to_gal_single(self):
for row in self.data: # test one entry at a time
c = coord.SkyCoord(ra=row['ra']*u.deg, dec=row['dec']*u.deg,
distance=row['dist']*u.pc)
icrs = c.icrs
gal = c.galactic
pm = [row['pml']*u.mas/u.yr, row['pmb']*u.mas/u.yr,]
rv = row['rv']*u.km/u.s
# stupid check
vxyz_i = vhel_to_gal(icrs, pm=pm, rv=rv,
vcirc=0*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s)
vxyz = vhel_to_gal(gal, pm=pm, rv=rv,
vcirc=0*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s)
assert vxyz_i.shape == vxyz.shape
true_UVW = np.array([row['U'], row['V'], row['W']])
UVW = vxyz.to(u.km/u.s).value
# catalog values are rounded
assert np.allclose(UVW, true_UVW, rtol=1E-2, atol=0.1)
# --------------------------------------------------------------------
# l = 0
# without LSR and circular velocity
c = coord.SkyCoord(ra=self.galcen_frame.galcen_coord.ra,
dec=self.galcen_frame.galcen_coord.dec,
distance=2*u.kpc)
pm = [0,0]*u.mas/u.yr
rv = 20*u.km/u.s
vxyz = vhel_to_gal(c.galactic, pm=pm, rv=rv,
vcirc=0*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
assert np.allclose(vxyz.to(u.km/u.s).value, [20,0,0.],
atol=1E-12)
# with LSR and circular velocity
c = coord.SkyCoord(ra=self.galcen_frame.galcen_coord.ra,
dec=self.galcen_frame.galcen_coord.dec,
distance=2*u.kpc)
vxyz = vhel_to_gal(c.galactic, pm=pm, rv=rv,
vcirc=200*u.km/u.s,
vlsr=[-20.,0,10]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
assert np.allclose(vxyz.to(u.km/u.s).value, [0,200,10],
atol=1E-12)
# l = 90
# with LSR and circular velocity
c = coord.SkyCoord(l=90*u.deg, b=0*u.deg,
distance=2*u.kpc, frame=coord.Galactic)
vxyz = vhel_to_gal(c.galactic, pm=pm, rv=rv,
vcirc=200*u.km/u.s,
vlsr=[-20.,0,10]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
assert np.allclose(vxyz.to(u.km/u.s).value, [-20,220,10],
atol=1E-5)
# l = 180
# with LSR and circular velocity
c = coord.SkyCoord(l=180*u.deg, b=0*u.deg,
distance=2*u.kpc, frame=coord.Galactic)
vxyz = vhel_to_gal(c.galactic, pm=pm, rv=rv,
vcirc=200*u.km/u.s,
vlsr=[-20.,0,10]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
assert np.allclose(vxyz.to(u.km/u.s).value, [-40,200,10],
atol=1E-12)
# l = 270
# with LSR and circular velocity
c = coord.SkyCoord(l=270*u.deg, b=0*u.deg,
distance=2*u.kpc, frame=coord.Galactic)
vxyz = vhel_to_gal(c.galactic, pm=pm, rv=rv,
vcirc=200*u.km/u.s,
vlsr=[-20.,0,10]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
assert np.allclose(vxyz.to(u.km/u.s).value, [-20,180,10],
atol=1E-5)
def test_vhel_to_gal_array(self):
# test all together
d = self.data
c = coord.SkyCoord(ra=d['ra']*u.deg, dec=d['dec']*u.deg,
distance=d['dist']*u.pc)
icrs = c.icrs
gal = c.galactic
pm = [d['pml'], d['pmb']]*u.mas/u.yr
rv = d['rv']*u.km/u.s
# stupid check
vxyz_i = vhel_to_gal(icrs, pm=pm, rv=rv,
vcirc=0*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s)
vxyz = vhel_to_gal(gal, pm=pm, rv=rv,
vcirc=0*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s)
assert vxyz_i.shape == vxyz.shape
# check values
true_UVW = np.array([d['U'], d['V'], d['W']])
UVW = vxyz.to(u.km/u.s).value
# catalog values are rounded
assert np.allclose(UVW, true_UVW, rtol=1E-2, atol=0.1)
def test_vgal_to_hel_single(self):
for row in self.data: # test one entry at a time
c = coord.SkyCoord(ra=row['ra']*u.deg, dec=row['dec']*u.deg,
distance=row['dist']*u.pc)
gal = c.galactic
vxyz = [row['U'], row['V'], row['W']] * u.km/u.s
vhel = vgal_to_hel(gal, vxyz,
vcirc=0.*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
# tolerance set by the catalog rounded numbers
assert quantity_allclose(vhel[0], row['pml'] * u.mas/u.yr, rtol=1E-2)
assert quantity_allclose(vhel[1], row['pmb'] * u.mas/u.yr, rtol=1E-2)
assert quantity_allclose(vhel[2], row['rv'] * u.km/u.s, rtol=1E-2)
# --------------------------------------------------------------------
# l = 0
# without LSR and circular velocity
c = coord.SkyCoord(l=0*u.deg, b=0*u.deg, distance=2*u.kpc,
frame=coord.Galactic)
vxyz = [20., 0, 0]*u.km/u.s
vhel = vgal_to_hel(c.galactic, vxyz,
vcirc=0*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
assert np.allclose(vhel[0].value, 0., atol=1E-12)
assert np.allclose(vhel[1].value, 0., atol=1E-12)
assert np.allclose(vhel[2].to(u.km/u.s).value, 20., atol=1E-12)
vxyz = [20., 0, 50]*u.km/u.s
vhel = vgal_to_hel(c.galactic, vxyz,
vcirc=0*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
assert np.allclose(vhel[0].value, 0., atol=2E-5) # TODO: astropy precision issues
with u.set_enabled_equivalencies(u.dimensionless_angles()):
assert quantity_allclose(vhel[1], 50*u.km/u.s / (2*u.kpc),
atol=1E-10*u.mas/u.yr)
assert quantity_allclose(vhel[2].to(u.km/u.s), vxyz[0],
atol=1E-10*u.km/u.s)
# with LSR and circular velocity
vxyz = [20., 0, 50]*u.km/u.s
vhel = vgal_to_hel(c.galactic, vxyz,
vcirc=-200*u.km/u.s,
vlsr=[0., 0, 10]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
with u.set_enabled_equivalencies(u.dimensionless_angles()):
assert quantity_allclose(vhel[0],
(200.*u.km/u.s) / (2*u.kpc),
atol=1E-10*u.mas/u.yr)
assert quantity_allclose(vhel[1],
(40.*u.km/u.s) / (2*u.kpc),
atol=1E-6*u.mas/u.yr)
assert quantity_allclose(vhel[2], 20.*u.km/u.s,
atol=1E-10*u.km/u.s)
def test_vgal_to_hel_array(self):
# test all together
d = self.data
c = coord.SkyCoord(ra=d['ra']*u.deg, dec=d['dec']*u.deg,
distance=d['dist']*u.pc)
pm = np.vstack([d['pml'],d['pmb']])*u.mas/u.yr
rv = d['rv']*u.km/u.s
vxyz = np.vstack((d['U'], d['V'], d['W']))*u.km/u.s
vhel = vgal_to_hel(c.galactic, vxyz,
vcirc=0.*u.km/u.s,
vlsr=[0.,0,0]*u.km/u.s,
galactocentric_frame=self.galcen_frame)
# tolerance set by the catalog rounded numbers
assert quantity_allclose(vhel[0], pm[0], rtol=1E-2)
assert quantity_allclose(vhel[1], pm[1], rtol=1E-2)
assert quantity_allclose(vhel[2], rv, rtol=5E-3)
def test_roundtrip_icrs(self):
np.random.seed(42)
n = 100
# yeahhhh, i know this isn't uniform on the sphere - shut up
c = coord.SkyCoord(ra=np.random.uniform(0,360,n)*u.degree,
dec=np.random.uniform(-90,90,n)*u.degree,
distance=np.random.uniform(0.1,10.,n)*u.kpc)
pm = np.random.uniform(-20,20,size=(2,n)) * u.mas/u.yr
vr = np.random.normal(0., 75., size=n)*u.km/u.s
# first to galactocentric
vxyz = vhel_to_gal(c.icrs, pm=pm, rv=vr)
# then back again, wooo
vhel2 = vgal_to_hel(c.icrs, vxyz)
assert quantity_allclose(vhel2[0], pm[0], rtol=1e-12)
assert quantity_allclose(vhel2[1], pm[1], rtol=1e-12)
assert quantity_allclose(vhel2[2], vr, rtol=1e-12)
def test_roundtrip_gal(self):
np.random.seed(42)
n = 100
# yeahhhh, i know this isn't uniform on the sphere - shut up
c = coord.SkyCoord(ra=np.random.uniform(0,360,n)*u.degree,
dec=np.random.uniform(-90,90,n)*u.degree,
distance=np.random.uniform(0.1,10.,n)*u.kpc)
pm = np.random.uniform(-20,20,size=(2,n)) * u.mas/u.yr
vr = np.random.normal(0., 75., size=n)*u.km/u.s
# first to galactocentric
vxyz = vhel_to_gal(c.galactic, pm=pm, rv=vr)
# then back again, wooo
vhel2 = vgal_to_hel(c.galactic, vxyz)
# TODO: why such bad roundtripping???
assert quantity_allclose(vhel2[0], pm[0], rtol=1e-12)
assert quantity_allclose(vhel2[1], pm[1], rtol=1e-12)
assert quantity_allclose(vhel2[2], vr, rtol=1e-12)
| 40.005479 | 106 | 0.52753 | 2,202 | 14,602 | 3.404632 | 0.126249 | 0.02561 | 0.034147 | 0.042684 | 0.810191 | 0.780846 | 0.763906 | 0.75777 | 0.737762 | 0.700947 | 0 | 0.058133 | 0.317902 | 14,602 | 364 | 107 | 40.115385 | 0.694578 | 0.099712 | 0 | 0.624 | 0 | 0.012 | 0.046691 | 0 | 0 | 0 | 0 | 0.002747 | 0.156 | 1 | 0.04 | false | 0 | 0.032 | 0 | 0.08 | 0.004 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
f55ccb7d78870351f12e275fb139e1c15251ab9e | 98 | py | Python | project/RealEstateMarketPlace/views/handler500.py | Mihaaai/RealEstateMarketplace | 9b9fa1376436801303e1ed0207ef09845a7d827e | [
"Apache-2.0"
] | null | null | null | project/RealEstateMarketPlace/views/handler500.py | Mihaaai/RealEstateMarketplace | 9b9fa1376436801303e1ed0207ef09845a7d827e | [
"Apache-2.0"
] | null | null | null | project/RealEstateMarketPlace/views/handler500.py | Mihaaai/RealEstateMarketplace | 9b9fa1376436801303e1ed0207ef09845a7d827e | [
"Apache-2.0"
] | null | null | null | from django.shortcuts import redirect
def handler500(request):
return redirect('list_listings')
| 19.6 | 37 | 0.816327 | 12 | 98 | 6.583333 | 0.916667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.034091 | 0.102041 | 98 | 4 | 38 | 24.5 | 0.863636 | 0 | 0 | 0 | 0 | 0 | 0.132653 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.333333 | false | 0 | 0.333333 | 0.333333 | 1 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 1 | 1 | 0 | 0 | 6 |
f5a4b0b2443eabe5db1995e89cba0becf6858602 | 46 | py | Python | examples/lb-provider-reactive/lib/charms/layer/provides_reactive.py | juju-solutions/loadbalancer-interface | ee84fb93ea52e55506f267cde28935df7d60a16d | [
"Apache-2.0"
] | null | null | null | examples/lb-provider-reactive/lib/charms/layer/provides_reactive.py | juju-solutions/loadbalancer-interface | ee84fb93ea52e55506f267cde28935df7d60a16d | [
"Apache-2.0"
] | 2 | 2021-01-19T22:29:02.000Z | 2021-03-12T16:55:06.000Z | examples/lb-provider-reactive/lib/charms/layer/provides_reactive.py | juju-solutions/loadbalancer-interface | ee84fb93ea52e55506f267cde28935df7d60a16d | [
"Apache-2.0"
] | null | null | null | def create_lb(request):
return "dummy-lb"
| 15.333333 | 23 | 0.695652 | 7 | 46 | 4.428571 | 0.857143 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.173913 | 46 | 2 | 24 | 23 | 0.815789 | 0 | 0 | 0 | 0 | 0 | 0.173913 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.5 | false | 0 | 0 | 0.5 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 1 | 1 | 0 | 0 | 6 |
1928dc23810efe224469e6152f98f1ab2d07764b | 36 | py | Python | tests-bad-syntax/dup-arg-names.py | brownplt/lambda-py | c3ee39502c8953d36b886e5a203f2eb51d2f495b | [
"Apache-2.0"
] | 25 | 2015-04-16T04:31:49.000Z | 2022-03-10T15:53:28.000Z | tests-bad-syntax/dup-arg-names.py | brownplt/lambda-py | c3ee39502c8953d36b886e5a203f2eb51d2f495b | [
"Apache-2.0"
] | 1 | 2018-11-21T22:40:02.000Z | 2018-11-26T17:53:11.000Z | tests-bad-syntax/dup-arg-names.py | brownplt/lambda-py | c3ee39502c8953d36b886e5a203f2eb51d2f495b | [
"Apache-2.0"
] | 1 | 2021-03-26T03:36:19.000Z | 2021-03-26T03:36:19.000Z | def f(a,*a):pass # No dup arg names
| 18 | 35 | 0.638889 | 9 | 36 | 2.555556 | 0.888889 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.194444 | 36 | 1 | 36 | 36 | 0.793103 | 0.444444 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | false | 1 | 0 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 6 |
193a960b2b0112d76e3366388622207dda07357d | 72 | py | Python | fiscomp/methods.py | fiscomp-usp/fiscomp | 6f50655c8c0d78fdb39d3dcef454906c2513026e | [
"MIT"
] | null | null | null | fiscomp/methods.py | fiscomp-usp/fiscomp | 6f50655c8c0d78fdb39d3dcef454906c2513026e | [
"MIT"
] | null | null | null | fiscomp/methods.py | fiscomp-usp/fiscomp | 6f50655c8c0d78fdb39d3dcef454906c2513026e | [
"MIT"
] | null | null | null | import numpy as np
def difference(f,tag='data',mode='central'):
pass
| 14.4 | 44 | 0.708333 | 12 | 72 | 4.25 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.138889 | 72 | 4 | 45 | 18 | 0.822581 | 0 | 0 | 0 | 0 | 0 | 0.152778 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.333333 | false | 0.333333 | 0.333333 | 0 | 0.666667 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
193b69329d5e7a198b76dd15004c97229b2dc376 | 25,397 | py | Python | seed_services_client/tests/test_identity_store.py | praekeltfoundation/seed-services-client | bfb216b6b770f9433bd9cda573f13199c4afee9c | [
"BSD-3-Clause"
] | null | null | null | seed_services_client/tests/test_identity_store.py | praekeltfoundation/seed-services-client | bfb216b6b770f9433bd9cda573f13199c4afee9c | [
"BSD-3-Clause"
] | 25 | 2016-06-24T14:37:51.000Z | 2018-06-26T09:08:31.000Z | seed_services_client/tests/test_identity_store.py | praekeltfoundation/seed-services-client | bfb216b6b770f9433bd9cda573f13199c4afee9c | [
"BSD-3-Clause"
] | null | null | null | from mock import patch
from unittest import TestCase
import responses
from seed_services_client.identity_store import IdentityStoreApiClient
from seed_services_client.seed_services import SeedServicesApiClient
class TestIdentityStoreClient(TestCase):
def setUp(self):
self.api = IdentityStoreApiClient("NO", "http://id.example.org/api/v1")
@patch("seed_services_client.seed_services.SeedServicesApiClient.__init__")
def test_inherited_from_base_api_class(self, mock_parent_init):
self.assertTrue(
issubclass(IdentityStoreApiClient, SeedServicesApiClient))
IdentityStoreApiClient(
'token', 'http://api/', session='session', argument=True)
mock_parent_init.assert_called_with(
'token', 'http://api/', session='session', argument=True)
@responses.activate
def test_identity_search_one_page(self):
# setup
search_response = {
"next": None,
"previous": None,
"results": [
{
"id": "0c03d360-1180-4fb4-9eed-ecd2cff8fa05",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+27123": {}
}
}
}
}
]
}
qs = "?details__addresses__msisdn=%2B27001"
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/search/%s" % qs,
json=search_response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identity_by_address(address_type="msisdn",
address_value="+27001")
# Check
result1 = next(result["results"])
self.assertEqual(result1["id"], "0c03d360-1180-4fb4-9eed-ecd2cff8fa05")
self.assertEqual(len(responses.calls), 1)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/search/?details__addresses__msisdn=%2B27001") # noqa
@responses.activate
def test_identity_search_multiple_pages(self):
# setup
qs = "?details__addresses__msisdn=%2B27001"
search_response = {
"next": "http://id.example.org/api/v1/identities/search/%s&"
"cursor=1" % qs,
"previous": None,
"results": [
{
"id": "identity-1-80-4fb4-9eed-ecd2cff8fa05",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+27123": {}
}
}
}
}
]
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/search/%s" % qs,
json=search_response, status=200,
match_querystring=True)
search_response = {
"next": None,
"previous": "http://id.example.org/api/v1/identities/search/%s&"
"cursor=0" % qs,
"results": [
{
"id": "identity-2-80-4fb4-9eed-ecd2cff8fa05",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+27123": {}
}
}
}
}
]
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/search/%s&"
"cursor=1" % qs,
json=search_response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identity_by_address(address_type="msisdn",
address_value="+27001")
# Check
result1 = next(result["results"])
result2 = next(result["results"])
self.assertEqual(result1["id"], "identity-1-80-4fb4-9eed-ecd2cff8fa05")
self.assertEqual(result2["id"], "identity-2-80-4fb4-9eed-ecd2cff8fa05")
self.assertEqual(len(responses.calls), 2)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/search/?details__addresses__msisdn=%2B27001") # noqa
self.assertEqual(responses.calls[1].request.url,
"http://id.example.org/api/v1/identities/search/?details__addresses__msisdn=%2B27001&cursor=1") # noqa
@responses.activate
def test_details_search(self):
# setup
qs = "?details__preferred_language=eng_ZA"
search_response = {
"next": "http://id.example.org/api/v1/identities/search/%s&"
"cursor=1" % qs,
"previous": None,
"results": [
{
"id": "identity-1-80-4fb4-9eed-ecd2cff8fa05",
"version": 1,
"details": {
"preferred_language": "eng_ZA",
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+27123": {}
}
}
}
}
]
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/search/%s" % qs,
json=search_response, status=200,
match_querystring=True)
search_response = {
"next": None,
"previous": "http://id.example.org/api/v1/identities/search/%s&"
"cursor=0" % qs,
"results": [
{
"id": "identity-2-80-4fb4-9eed-ecd2cff8fa05",
"version": 1,
"details": {
"preferred_language": "eng_ZA",
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+27123": {}
}
}
}
}
]
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/search/%s&"
"cursor=1" % qs,
json=search_response, status=200,
match_querystring=True)
# Execute
result = self.api.search_identities("details__preferred_language",
"eng_ZA")
# Check
result1 = next(result["results"])
result2 = next(result["results"])
self.assertEqual(result1["id"], "identity-1-80-4fb4-9eed-ecd2cff8fa05")
self.assertEqual(result2["id"], "identity-2-80-4fb4-9eed-ecd2cff8fa05")
self.assertEqual(len(responses.calls), 2)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/search/?details__preferred_language=eng_ZA") # noqa
self.assertEqual(responses.calls[1].request.url,
"http://id.example.org/api/v1/identities/search/?details__preferred_language=eng_ZA&cursor=1") # noqa
@responses.activate
def test_identity_search_no_results(self):
# setup
search_response = {
"next": None,
"previous": None,
"results": []
}
qs = "?details__addresses__msisdn=%2B27002"
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/search/%s" % qs,
json=search_response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identity_by_address(address_type="msisdn",
address_value="+27002")
# Check
self.assertEqual(len(list(result["results"])), 0)
self.assertEqual(len(responses.calls), 1)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/search/?details__addresses__msisdn=%2B27002") # noqa
@responses.activate
def test_get_identity_none(self):
# setup
four_oh_four = {
"detail": "Not found."
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/uuid/",
json=four_oh_four, status=404,
match_querystring=True)
# Execute
result = self.api.get_identity(identity="uuid")
# Check
self.assertEqual(result, None)
self.assertEqual(len(responses.calls), 1)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/uuid/")
@responses.activate
def test_get_identity_found(self):
# setup
identity = {
"id": "4275a063-3129-45ac-853b-0d64aaefd8c5",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+26773000000": {}
}
}
},
"communicate_through": None,
"operator": None,
"created_at": "2016-04-21T09:11:05.725680Z",
"created_by": 2,
"updated_at": "2016-06-15T15:09:05.333526Z",
"updated_by": 2
}
uid = identity["id"]
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/%s/" % uid,
json=identity, status=200,
match_querystring=True)
# Execute
result = self.api.get_identity(identity=uid)
# Check
self.assertEqual(result["id"], uid)
self.assertEqual(result["version"], 1)
self.assertEqual(result["details"]["default_addr_type"], "msisdn")
self.assertEqual(len(responses.calls), 1)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/%s/" % uid)
@responses.activate
def test_get_identity_address(self):
# Setup
uid = 'uid'
url = ('http://id.example.org/api/v1/identities/{0}'
'/addresses/msisdn?default=True').format(uid)
addresses_msisdn_response = {'results': [
{'address': '+27000000000'},
{'address': '+27000000001'},
]}
responses.add(responses.GET, url,
json=addresses_msisdn_response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identity_address(identity_id=uid)
# Check
self.assertEqual(result, '+27000000000')
@responses.activate
def test_get_identity_address_no_results(self):
# Setup
uid = 'uid'
url = ('http://id.example.org/api/v1/identities/{0}'
'/addresses/msisdn?default=True').format(uid)
addresses_msisdn_response = {'results': []}
responses.add(responses.GET, url,
json=addresses_msisdn_response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identity_address(identity_id=uid)
# Check
self.assertEqual(result, None)
@responses.activate
def test_get_identity_address_custom_params(self):
# Setup
uid = 'uid'
url = ('http://id.example.org/api/v1/identities/{0}'
'/addresses/msisdn?param_one=set').format(uid)
addresses_msisdn_response = {'results': []}
responses.add(responses.GET, url,
json=addresses_msisdn_response, status=200,
match_querystring=True)
# Execute
self.api.get_identity_address(identity_id=uid,
params={'param_one': 'set'})
# This test doesn't assert anything, but responses will raise a
# ConnectionError if the params don't match
@responses.activate
def test_identity_list_no_results(self):
# setup
response = {
"next": None,
"previous": None,
"results": []
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/",
json=response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identities()
# Check
self.assertEqual(len(list(result["results"])), 0)
self.assertEqual(len(responses.calls), 1)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/")
@responses.activate
def test_identity_list_one_results(self):
# setup
response = {
"next": None,
"previous": None,
"results": [
{
"id": "4275a063-3129-45ac-853b-0d64aaefd8c5",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+26773000000": {}
}
}
},
"communicate_through": None,
"operator": None,
"created_at": "2016-04-21T09:11:05.725680Z",
"created_by": 2,
"updated_at": "2016-06-15T15:09:05.333526Z",
"updated_by": 2
}
]
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/",
json=response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identities()
# Check
result1 = next(result["results"])
self.assertEqual(result1["version"], 1)
self.assertEqual(result1["details"]["default_addr_type"], "msisdn")
self.assertEqual(len(responses.calls), 1)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/")
@responses.activate
def test_identity_list_multiple_pages(self):
# setup
search_response = {
"next": "http://id.example.org/api/v1/identities/?cursor=1",
"previous": None,
"results": [
{
"id": "identity-1-80-4fb4-9eed-ecd2cff8fa05",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+27123": {}
}
}
}
}
]
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/",
json=search_response, status=200,
match_querystring=True)
search_response = {
"next": None,
"previous": "http://id.example.org/api/v1/identities/?cursor=0",
"results": [
{
"id": "identity-2-80-4fb4-9eed-ecd2cff8fa05",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+27123": {}
}
}
}
}
]
}
responses.add(responses.GET,
"http://id.example.org/api/v1/identities/?cursor=1",
json=search_response, status=200,
match_querystring=True)
# Execute
result = self.api.get_identities()
# Check
result1 = next(result["results"])
result2 = next(result["results"])
self.assertEqual(result1["id"], "identity-1-80-4fb4-9eed-ecd2cff8fa05")
self.assertEqual(result2["id"], "identity-2-80-4fb4-9eed-ecd2cff8fa05")
self.assertEqual(len(responses.calls), 2)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/") # noqa
self.assertEqual(responses.calls[1].request.url,
"http://id.example.org/api/v1/identities/?cursor=1") # noqa
@responses.activate
def test_update_identity_details(self):
# Setup
uid = "4275a063-3129-45ac-853b-0d64aaefd8c5"
response = {
"id": uid,
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+26773000000": {}
}
},
"risk": "high"
},
"communicate_through": None,
"operator": None,
"created_at": "2016-04-21T09:11:05.725680Z",
"created_by": 2,
"updated_at": "2016-06-15T15:09:05.333526Z",
"updated_by": 2
}
responses.add(responses.PATCH,
"http://id.example.org/api/v1/identities/%s/" % uid,
json=response, status=200)
data = {
"details": {
"risk": "high"
}
}
# Execute
result = self.api.update_identity(uid, data)
# Check
self.assertEqual(result["id"], uid)
self.assertEqual(result["version"], 1)
self.assertEqual(result["details"]["default_addr_type"], "msisdn")
self.assertEqual(result["details"]["risk"], "high")
self.assertEqual(len(responses.calls), 1)
self.assertEqual(responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/%s/" % uid)
@responses.activate
def test_create_identity(self):
# Setup
identity = {
"id": "4275a063-3129-45ac-853b-0d64aaefd8c5",
"version": 1,
"details": {
"default_addr_type": "msisdn",
"addresses": {
"msisdn": {
"+26773000000": {}
}
},
"risk": "high"
},
"communicate_through": None,
"operator": None,
"created_at": "2016-04-21T09:11:05.725680Z",
"created_by": 2,
"updated_at": "2016-06-15T15:09:05.333526Z",
"updated_by": 2
}
responses.add(responses.POST,
"http://id.example.org/api/v1/identities/",
json=identity, status=201)
# Execute
self.api.create_identity(identity)
self.assertEqual(len(responses.calls), 1)
self.assertEqual(
responses.calls[0].request.url,
"http://id.example.org/api/v1/identities/")
@responses.activate
def test_get_optouts_one_page(self):
optouts = {
"next": None,
"previous": None,
"results": [
{
"id": "e5210c99-8d8a-40f1-8e7f-8a66c4de9e29",
"optout_type": "stop",
"identity": "8311c23d-f3c4-4cab-9e20-5208d77dcd1b",
"address_type": "msisdn",
"address": "+1234",
"request_source": "testsource",
"requestor_source_id": "1",
"reason": "Test reason",
"created_at": "2017-01-27T10:00:06.354178Z"
},
]
}
responses.add(
responses.GET,
"http://id.example.org/api/v1/optouts/search/?optout_type=stop",
json=optouts, match_querystring=True)
res = self.api.get_optouts(params={'optout_type': 'stop'})
result1 = next(res["results"])
self.assertEqual(result1['id'], "e5210c99-8d8a-40f1-8e7f-8a66c4de9e29")
self.assertEqual(len(responses.calls), 1)
self.assertEqual(
responses.calls[0].request.url,
"http://id.example.org/api/v1/optouts/search/?optout_type=stop"
)
@responses.activate
def test_get_optouts_multiple_pages(self):
optouts = {
"next": "http://id.example.org/api/v1/optouts/search/?"
"optout_type=stop&cursor=1",
"previous": None,
"results": [
{
"id": "optout-1-8d8a-40f1-8e7f-8a66c4de9e29",
"optout_type": "stop",
"identity": "identity-1-c4-4cab-9e20-5208d77dcd1b",
"address_type": "msisdn",
"address": "+1234",
"request_source": "testsource",
"requestor_source_id": "1",
"reason": "Test reason",
"created_at": "2017-01-27T10:00:06.354178Z"
},
]
}
responses.add(
responses.GET,
"http://id.example.org/api/v1/optouts/search/?optout_type=stop",
json=optouts, match_querystring=True)
optouts = {
"next": None,
"previous": "http://id.example.org/api/v1/optouts/search/?"
"optout_type=stop&cursor=0",
"results": [
{
"id": "optout-2-8d8a-40f1-8e7f-8a66c4de9e29",
"optout_type": "stop",
"identity": "identity-2-c4-4cab-9e20-5208d77dcd1b",
"address_type": "msisdn",
"address": "+1234",
"request_source": "testsource",
"requestor_source_id": "1",
"reason": "Test reason",
"created_at": "2017-01-27T10:00:06.354178Z"
},
]
}
responses.add(
responses.GET,
"http://id.example.org/api/v1/optouts/search/?optout_type=stop&"
"cursor=1",
json=optouts, match_querystring=True)
res = self.api.get_optouts(params={'optout_type': 'stop'})
result1 = next(res["results"])
result2 = next(res["results"])
self.assertEqual(result1['id'], "optout-1-8d8a-40f1-8e7f-8a66c4de9e29")
self.assertEqual(result2['id'], "optout-2-8d8a-40f1-8e7f-8a66c4de9e29")
self.assertEqual(len(responses.calls), 2)
self.assertEqual(
responses.calls[0].request.url,
"http://id.example.org/api/v1/optouts/search/?optout_type=stop"
)
self.assertEqual(
responses.calls[1].request.url,
"http://id.example.org/api/v1/optouts/search/?optout_type=stop&"
"cursor=1"
)
@responses.activate
def test_create_optout(self):
optout = {
"id": "e5210c99-8d8a-40f1-8e7f-8a66c4de9e29",
"optout_type": "stop",
"identity": "8311c23d-f3c4-4cab-9e20-5208d77dcd1b",
"address_type": "msisdn",
"address": "+1234",
"request_source": "testsource",
"requestor_source_id": "1",
"reason": "Test reason",
"created_at": "2017-01-27T10:00:06.354178Z"
}
responses.add(
responses.POST,
'http://id.example.org/api/v1/optout/',
json=optout, status=201)
self.api.create_optout(optout)
self.assertEqual(len(responses.calls), 1)
self.assertEqual(
responses.calls[0].request.url,
"http://id.example.org/api/v1/optout/"
)
@responses.activate
def test_create_optin(self):
optin = {
"id": "ba27bb4e-49a3-49cd-81a4-9f6af7380cbf",
"identity": "46f61a96-d54f-4eda-8250-e5bb86be2580",
"address_type": "msisdn",
"address": "+1234",
"request_source": "Test source",
"requestor_source_id": "1",
"created_at": "2017-01-27T10:41:38.924319Z"
}
responses.add(
responses.POST,
'http://id.example.org/api/v1/optin/',
json=optin, status=201)
self.api.create_optin(optin)
self.assertEqual(len(responses.calls), 1)
self.assertEqual(
responses.calls[0].request.url,
'http://id.example.org/api/v1/optin/'
)
| 38.656012 | 127 | 0.486278 | 2,278 | 25,397 | 5.285777 | 0.086479 | 0.072253 | 0.053982 | 0.06644 | 0.888714 | 0.856158 | 0.831077 | 0.787974 | 0.777178 | 0.744373 | 0 | 0.071726 | 0.385164 | 25,397 | 656 | 128 | 38.714939 | 0.699392 | 0.016183 | 0 | 0.663248 | 0 | 0.003419 | 0.272869 | 0.073912 | 0 | 0 | 0 | 0 | 0.102564 | 1 | 0.034188 | false | 0 | 0.008547 | 0 | 0.044444 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
1986375e3e5b64e2ae5732a9f6cf07109006b3ca | 36 | py | Python | hackerrank/interview-preparation-kit/f2018.py | AmrMKayid/KayAlgo | df6e2b5b0f74174d5c0950520f0c47b04212dfaa | [
"MIT"
] | 1 | 2019-02-11T13:29:32.000Z | 2019-02-11T13:29:32.000Z | hackerrank/interview-preparation-kit/f2018.py | AmrMKayid/KayAlgo | df6e2b5b0f74174d5c0950520f0c47b04212dfaa | [
"MIT"
] | 1 | 2019-02-11T15:26:36.000Z | 2019-02-11T15:26:36.000Z | hackerrank/interview-preparation-kit/f2018.py | AmrMKayid/KayAlgo | df6e2b5b0f74174d5c0950520f0c47b04212dfaa | [
"MIT"
] | null | null | null | print('Interview Preparation Kit')
| 18 | 35 | 0.777778 | 4 | 36 | 7 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.111111 | 36 | 1 | 36 | 36 | 0.875 | 0 | 0 | 0 | 0 | 0 | 0.714286 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 1 | 0 | 6 |
273cb7471e32c8a6a1649821b5e68bd9da595bea | 6,686 | py | Python | experiment/deep_learning.py | howietiangh/patch_prediction2 | e1effc0a6cd384412cb64b6d78ef93b0ade30ed6 | [
"MIT"
] | 2 | 2022-01-08T21:24:22.000Z | 2022-01-08T21:24:25.000Z | experiment/deep_learning.py | howietiangh/patch_prediction2 | e1effc0a6cd384412cb64b6d78ef93b0ade30ed6 | [
"MIT"
] | null | null | null | experiment/deep_learning.py | howietiangh/patch_prediction2 | e1effc0a6cd384412cb64b6d78ef93b0ade30ed6 | [
"MIT"
] | null | null | null | import random
import numpy as np
import lightgbm as lgb
import keras
from sklearn.model_selection import KFold, StratifiedKFold
from sklearn.preprocessing import StandardScaler,MinMaxScaler
from sklearn.linear_model import LogisticRegression
from sklearn.metrics import roc_curve, auc
from sklearn.metrics import confusion_matrix
from keras.models import load_model
from sklearn import preprocessing
from keras import models
from keras.layers import MaxPool1D, Activation, Dense, Flatten, Input, Multiply, Permute, RepeatVector, Reshape, Concatenate, Conv1D
from keras.utils import plot_model
from sklearn.metrics import roc_curve, auc, accuracy_score, recall_score, precision_score
def get_dnn(dimension):
input_embeddings_tensor = Input(shape=(dimension,))
embeddings_tensor = Dense(512, activation='tanh')(input_embeddings_tensor) # 100为神经元
# for _ in range(3): # DNN层数，该为3层
embeddings_tensor = Dense(128, activation='tanh')(embeddings_tensor)
embeddings_tensor = Dense(128, activation='tanh')(embeddings_tensor)
# embeddings_tensor = Dense(64, activation='tanh')(embeddings_tensor)
output_tensor = Dense(1, activation='sigmoid')(embeddings_tensor)
model = models.Model(inputs=input_embeddings_tensor, outputs=output_tensor)
model.compile(loss='binary_crossentropy', optimizer='adam', metrics=['AUC'])
# plot_model(model, to_file='./model.png', show_shapes=True)
return model
def get_dnn_4engineered(dimension):
input_engineered_tensor = Input(shape=(dimension,))
engineered_tensor = Dense(128, activation='tanh')(input_engineered_tensor)
engineered_tensor = Dense(64, activation='tanh')(engineered_tensor)
# engineered_tensor = Dense(1024, activation='tanh')(engineered_tensor)
# engineered_tensor = Dense(512, activation='sigmoid')(engineered_tensor)
output_tensor = Dense(1, activation='sigmoid')(engineered_tensor)
model = models.Model(inputs=input_engineered_tensor, outputs=output_tensor)
model.compile(loss='binary_crossentropy', optimizer='adam', metrics=['AUC'])
# plot_model(model, to_file='./model.png', show_shapes=True)
return model
def get_cnn():
input_engineered_tensor = Input(shape=(4497,))
engineered_tensor = Reshape((4497, 1))(input_engineered_tensor)
engineered_tensor = Conv1D(256, (50), activation='relu')(engineered_tensor)
engineered_tensor = MaxPool1D((8))(engineered_tensor)
# engineered_tensor = Conv1D(128, (50), activation='relu')(engineered_tensor)
# engineered_tensor = MaxPool1D((8))(engineered_tensor)
engineered_tensor = Flatten()(engineered_tensor)
output_tensor = Dense(1, activation='sigmoid')(engineered_tensor)
model = models.Model(inputs=input_engineered_tensor, outputs=output_tensor)
model.compile(loss='binary_crossentropy', optimizer='adam', metrics=['AUC'])
# plot_model(model, to_file='./model.png', show_shapes=True)
return model
def get_wide_deep(dimension_learned, dimension_engineered):
input_embeddings_tensor = Input(shape=(dimension_learned,))
embeddings_tensor = Dense(512, activation='tanh')(input_embeddings_tensor) # 100为神经元
# for _ in range(3): # DNN层数，该为3层
embeddings_tensor = Dense(128, activation='tanh')(embeddings_tensor)
embeddings_tensor = Dense(128, activation='tanh')(embeddings_tensor)
# embeddings_tensor = Dense(64, activation='tanh')(embeddings_tensor)
input_fe_tensor = Input(shape=(dimension_engineered,))
# engineered_tensor = Dense(1, activation='sigmoid')(input_fe_tensor)
concat_tensor = Concatenate()([embeddings_tensor, input_fe_tensor])
output_tensor = Dense(1, activation='sigmoid')(concat_tensor)
model = models.Model(inputs=[input_embeddings_tensor, input_fe_tensor], outputs=output_tensor)
model.compile(loss='binary_crossentropy', optimizer='adam', metrics=['AUC'])
plot_model(model, to_file='../model/wide_deep.png', show_shapes=True)
return model
def get_dnn_dnn(dimension_learned, dimension_engineered):
input_embeddings_tensor = Input(shape=(dimension_learned,))
embeddings_tensor = Dense(512, activation='tanh')(input_embeddings_tensor) # 100为神经元
# for _ in range(3): # DNN层数，该为3层
embeddings_tensor = Dense(128, activation='tanh')(embeddings_tensor)
embeddings_tensor = Dense(128, activation='tanh')(embeddings_tensor)
# embeddings_tensor = Dense(1, activation='sigmoid')(embeddings_tensor)
input_engineered_tensor = Input(shape=(dimension_engineered,))
engineered_tensor = Dense(128, activation='tanh')(input_engineered_tensor)
engineered_tensor = Dense(64, activation='tanh')(engineered_tensor)
# engineered_tensor = Dense(512, activation='tanh')(engineered_tensor)
# engineered_tensor = Dense(128, activation='sigmoid')(engineered_tensor)
concat_tensor = Concatenate()([embeddings_tensor, engineered_tensor])
output_tensor = Dense(1, activation='sigmoid')(concat_tensor)
model = models.Model(inputs=[input_embeddings_tensor, input_engineered_tensor], outputs=output_tensor)
model.compile(loss='binary_crossentropy', optimizer='adam', metrics=['AUC'])
plot_model(model, to_file='../model/dnn_dnn.png', show_shapes=True)
return model
def get_dnn_cnn(dimension_learned, dimension_engineered):
input_embeddings_tensor = Input(shape=(dimension_learned,))
embeddings_tensor = Dense(1024, activation='tanh')(input_embeddings_tensor) # 100为神经元
# for _ in range(3): # DNN层数，该为3层
embeddings_tensor = Dense(512, activation='tanh')(embeddings_tensor)
embeddings_tensor = Dense(512, activation='tanh')(embeddings_tensor)
# embeddings_tensor = Dense(1, activation='sigmoid')(embeddings_tensor)
input_engineered_tensor = Input(shape=(dimension_engineered,))
# CNN
engineered_tensor = Reshape((dimension_engineered, 1))(input_engineered_tensor)
engineered_tensor = Conv1D(256, (50), activation='relu')(engineered_tensor)
engineered_tensor = MaxPool1D((8))(engineered_tensor)
# engineered_tensor = Conv1D(32, (50), activation='relu')(engineered_tensor)
# engineered_tensor = MaxPool1D((2))(engineered_tensor)
engineered_tensor = Flatten()(engineered_tensor)
# engineered_tensor = Dense(1, activation='sigmoid')(engineered_tensor)
concat_tensor = Concatenate()([embeddings_tensor, engineered_tensor])
output_tensor = Dense(1, activation='sigmoid')(concat_tensor)
model = models.Model(inputs=[input_embeddings_tensor, input_engineered_tensor], outputs=output_tensor)
model.compile(loss='binary_crossentropy', optimizer='adam', metrics=['AUC'])
plot_model(model, to_file='../model/dnn_cnn.png', show_shapes=True)
return model | 48.449275 | 132 | 0.760395 | 790 | 6,686 | 6.165823 | 0.122785 | 0.180661 | 0.085814 | 0.111681 | 0.862451 | 0.850544 | 0.821597 | 0.766167 | 0.734141 | 0.702525 | 0 | 0.023497 | 0.121597 | 6,686 | 138 | 133 | 48.449275 | 0.805891 | 0.194436 | 0 | 0.583333 | 0 | 0 | 0.061987 | 0.004108 | 0 | 0 | 0 | 0 | 0 | 1 | 0.071429 | false | 0 | 0.178571 | 0 | 0.321429 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
2785bc1626cfd268ef70c3f27d8be47f5bbccefe | 166 | py | Python | main.py | TSpidermanBoss/hppylinebot | 13fb7a99c673565d323469c450fda542d7d2d474 | [
"MIT"
] | null | null | null | main.py | TSpidermanBoss/hppylinebot | 13fb7a99c673565d323469c450fda542d7d2d474 | [
"MIT"
] | null | null | null | main.py | TSpidermanBoss/hppylinebot | 13fb7a99c673565d323469c450fda542d7d2d474 | [
"MIT"
] | null | null | null | from pyrogram import Client
Client("mnnn",bot_token="918978080:AAHHAghRQq83v3tDhQp1H75rvbPpjHAgmZ0",api_id=768402,api_hash="f6420bf67303614279049d48d3e670f6").run()
| 41.5 | 136 | 0.855422 | 17 | 166 | 8.176471 | 0.882353 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.29375 | 0.036145 | 166 | 3 | 137 | 55.333333 | 0.575 | 0 | 0 | 0 | 0 | 0 | 0.487952 | 0.463855 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.5 | 0 | 0.5 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
27dacf291bbe5e967cafdf4129e63c99b8b984ae | 23,118 | py | Python | DAD/Sala_aula/runtests_lms_v2.py | Gustavolsl/Falculdade_Impacta_3s | bf1a12c81fd088c4e1a0cd9182600730b43dcd63 | [
"Apache-2.0"
] | null | null | null | DAD/Sala_aula/runtests_lms_v2.py | Gustavolsl/Falculdade_Impacta_3s | bf1a12c81fd088c4e1a0cd9182600730b43dcd63 | [
"Apache-2.0"
] | 6 | 2021-03-19T03:57:08.000Z | 2022-03-12T00:00:33.000Z | DAD/Sala_aula/runtests_lms_v2.py | Gustavolsl/Falculdade_Impacta_3s | bf1a12c81fd088c4e1a0cd9182600730b43dcd63 | [
"Apache-2.0"
] | null | null | null | import requests
import unittest
import sqlite3
class TestStringMethods(unittest.TestCase):
def test_000_alunos_retorna_lista(self):
r = requests.get('http://localhost:5002/alunos')
self.assertEqual(type(r.json()),type([]))
def test_001_adiciona_alunos(self):
r = requests.post('http://localhost:5002/alunos',json={'nome':'fernando','id':1})
r = requests.post('http://localhost:5002/alunos',json={'nome':'roberto','id':2})
r_lista = requests.get('http://localhost:5002/alunos')
achei_fernando = False
achei_roberto = False
for aluno in r_lista.json():
if aluno['nome'] == 'fernando':
achei_fernando = True
if aluno['nome'] == 'roberto':
achei_roberto = True
if not achei_fernando:
self.fail('aluno fernando nao apareceu na lista de alunos')
if not achei_roberto:
self.fail('aluno roberto nao apareceu na lista de alunos')
def test_002_aluno_por_id(self):
r = requests.post('http://localhost:5002/alunos',json={'nome':'mario','id':20})
r_id = requests.get('http://localhost:5002/alunos/20')
self.assertEqual(r_id.json()['nome'],'mario')
def test_003_adiciona_e_reseta(self):
r = requests.post('http://localhost:5002/alunos',json={'nome':'cicero','id':29})
r_lista = requests.get('http://localhost:5002/alunos')
self.assertTrue(len(r_lista.json()) > 0)
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r_lista_depois = requests.get('http://localhost:5002/alunos')
self.assertEqual(len(r_lista_depois.json()),0)
def test_004_adiciona_e_deleta(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
requests.post('http://localhost:5002/alunos',json={'nome':'cicero','id':29})
requests.post('http://localhost:5002/alunos',json={'nome':'lucas','id':28})
r_lista = requests.get('http://localhost:5002/alunos')
self.assertEqual(len(r_lista.json()),2)
requests.delete('http://localhost:5002/alunos/28')
r_lista = requests.get('http://localhost:5002/alunos')
self.assertEqual(len(r_lista.json()),1)
def test_005_edita(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
requests.post('http://localhost:5002/alunos',json={'nome':'lucas','id':28})
r_antes = requests.get('http://localhost:5002/alunos/28')
self.assertEqual(r_antes.json()['nome'],'lucas')
requests.put('http://localhost:5002/alunos/28', json={'nome':'lucas mendes'})
r_depois = requests.get('http://localhost:5002/alunos/28')
self.assertEqual(r_depois.json()['nome'],'lucas mendes')
def test_006_id_inexistente(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.put('http://localhost:5002/alunos/15',json={'nome':'bowser','id':15})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'aluno nao encontrado')
r = requests.get('http://localhost:5002/alunos/15')
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'aluno nao encontrado')
r = requests.delete('http://localhost:5002/alunos/15')
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'aluno nao encontrado')
def test_007_criar_com_id_ja_existente(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5002/alunos',json={'nome':'bond','id':7})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5002/alunos',json={'nome':'james','id':7})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'id ja utilizada')
def test_008_post_ou_put_sem_nome(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5002/alunos',json={'id':8})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'aluno sem nome')
r = requests.post('http://localhost:5002/alunos',json={'nome':'maximus','id':7})
self.assertEqual(r.status_code,200)
r = requests.put('http://localhost:5002/alunos/7',json={'id':7})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'aluno sem nome')
def test_100_professores_retorna_lista(self):
r = requests.get('http://localhost:5002/professores')
self.assertEqual(type(r.json()),type([]))
def test_100b_nao_confundir_professor_e_aluno(self):
r_reset = requests.post('http://localhost:5002/reseta')
r = requests.post('http://localhost:5002/alunos',json={'nome':'fernando','id':1})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5002/alunos',json={'nome':'roberto','id':2})
self.assertEqual(r.status_code,200)
r_lista = requests.get('http://localhost:5002/professores')
self.assertEqual(len(r_lista.json()),0)
r_lista_alunos = requests.get('http://localhost:5002/alunos')
self.assertEqual(len(r_lista_alunos.json()),2)
def test_101_adiciona_professores(self):
r = requests.post('http://localhost:5002/professores',json={'nome':'fernando','id':1})
r = requests.post('http://localhost:5002/professores',json={'nome':'roberto','id':2})
r_lista = requests.get('http://localhost:5002/professores')
achei_fernando = False
achei_roberto = False
for professor in r_lista.json():
if professor['nome'] == 'fernando':
achei_fernando = True
if professor['nome'] == 'roberto':
achei_roberto = True
if not achei_fernando:
self.fail('professor fernando nao apareceu na lista de professores')
if not achei_roberto:
self.fail('professor roberto nao apareceu na lista de professores')
def test_102_professores_por_id(self):
r = requests.post('http://localhost:5002/professores',json={'nome':'mario','id':20})
r_lista = requests.get('http://localhost:5002/professores/20')
self.assertEqual(r_lista.json()['nome'],'mario')
def test_103_adiciona_e_reseta(self):
r = requests.post('http://localhost:5002/professores',json={'nome':'cicero','id':29})
r_lista = requests.get('http://localhost:5002/professores')
self.assertTrue(len(r_lista.json()) > 0)
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r_lista_depois = requests.get('http://localhost:5002/professores')
self.assertEqual(len(r_lista_depois.json()),0)
def test_104_adiciona_e_deleta(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
requests.post('http://localhost:5002/professores',json={'nome':'cicero','id':29})
requests.post('http://localhost:5002/professores',json={'nome':'lucas','id':28})
r_lista = requests.get('http://localhost:5002/professores')
self.assertEqual(len(r_lista.json()),2)
requests.delete('http://localhost:5002/professores/28')
r_lista = requests.get('http://localhost:5002/professores')
self.assertEqual(len(r_lista.json()),1)
def test_105_edita(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
requests.post('http://localhost:5002/professores',json={'nome':'lucas','id':28})
r_antes = requests.get('http://localhost:5002/professores/28')
self.assertEqual(r_antes.json()['nome'],'lucas')
requests.put('http://localhost:5002/professores/28', json={'nome':'lucas mendes'})
r_depois = requests.get('http://localhost:5002/professores/28')
self.assertEqual(r_depois.json()['nome'],'lucas mendes')
def test_106_id_inexistente(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.put('http://localhost:5002/professores/15',json={'nome':'bowser','id':15})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'professor nao encontrado')
r = requests.get('http://localhost:5002/professores/15')
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'professor nao encontrado')
r = requests.delete('http://localhost:5002/professores/15')
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'professor nao encontrado')
def test_107_criar_com_id_ja_existente(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'nome':'bond','id':7})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'nome':'james','id':7})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'id ja utilizada')
def test_108_post_ou_put_sem_nome(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'id':8})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'professor sem nome')
r = requests.post('http://localhost:5002/professores',json={'nome':'maximus','id':7})
self.assertEqual(r.status_code,200)
r = requests.put('http://localhost:5002/professores/7',json={'id':7})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'professor sem nome')
def test_109_nao_confundir_professor_e_aluno(self):
r_reset = requests.post('http://localhost:5002/reseta')
r = requests.post('http://localhost:5002/professores',json={'nome':'fernando','id':1})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'nome':'roberto','id':2})
self.assertEqual(r.status_code,200)
r_lista = requests.get('http://localhost:5002/professores')
self.assertEqual(len(r_lista.json()),2)
r_lista_alunos = requests.get('http://localhost:5002/alunos')
self.assertEqual(len(r_lista_alunos.json()),0)
def test_200_disciplinas_retorna_lista(self):
r_reset = requests.post('http://localhost:5003/reseta')
r = requests.get('http://localhost:5003/disciplinas')
self.assertEqual(type(r.json()),type([]))
def test_200b_nao_confundir_disciplina_e_pessoas(self):
r_lista = requests.get('http://localhost:5003/disciplinas')
tam_inicial = len(r_lista.json())
r_reset = requests.post('http://localhost:5002/reseta')
r_reset = requests.post('http://localhost:5003/reseta')
r = requests.post('http://localhost:5002/alunos',json={'nome':'fernando','id':1})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'nome':'roberto','id':2})
self.assertEqual(r.status_code,200)
r_lista = requests.get('http://localhost:5003/disciplinas')
self.assertEqual(len(r_lista.json()),tam_inicial)
def test_201_adiciona_disciplinas(self):
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
r = requests.post('http://localhost:5003/disciplinas',json={'id':101,'nome':'distribuidos','status':12,'plano_ensino':'clientes e servidores','carga_horaria':10})
r_lista = requests.get('http://localhost:5003/disciplinas')
achei_dados = False
achei_distribuidos = False
for disciplina in r_lista.json():
if 'dados' in disciplina['nome']:
achei_dados = True
if 'distri' in disciplina['nome']:
achei_distribuidos = True
if not achei_dados:
self.fail('disciplina estrutura de dados nao apareceu na lista de disciplinas')
if not achei_distribuidos:
self.fail('disciplina distribuidos nao apareceu na lista de disciplinas')
def test_202_disciplinas_por_id(self):
r = requests.post('http://localhost:5003/disciplinas',json={'id':103,'nome':'matematica','status':12,'plano_ensino':'funcoes e calculo','carga_horaria':15})
r_lista = requests.get('http://localhost:5003/disciplinas/103')
self.assertEqual(r_lista.json()['nome'],'matematica')
self.assertEqual(r_lista.json()['plano_ensino'],'funcoes e calculo')
self.assertEqual(r_lista.json()['carga_horaria'],15)
self.assertEqual(r_lista.json()['status'],12)
def test_203_adiciona_e_reseta(self):
r = requests.post('http://localhost:5003/disciplinas',json={'id':104,'nome':'lp2','status':12,'plano_ensino':'dicionarios e classes','carga_horaria':15})
r_lista = requests.get('http://localhost:5003/disciplinas')
self.assertTrue(len(r_lista.json()) > 0)
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r_lista_depois = requests.get('http://localhost:5003/disciplinas')
self.assertEqual(len(r_lista_depois.json()),0)
def test_204_adiciona_e_deleta(self):
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
r = requests.post('http://localhost:5003/disciplinas',json={'id':101,'nome':'distribuidos','status':12,'plano_ensino':'clientes e servidores','carga_horaria':10})
r_lista = requests.get('http://localhost:5003/disciplinas')
self.assertEqual(len(r_lista.json()),2)
requests.delete('http://localhost:5003/disciplinas/100')
r_lista = requests.get('http://localhost:5003/disciplinas')
self.assertEqual(len(r_lista.json()),1)
def test_205_edita(self):
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
r_antes = requests.get('http://localhost:5003/disciplinas/100')
self.assertEqual(r_antes.json()['nome'],'estruturas de dados')
requests.put('http://localhost:5003/disciplinas/100', json={'nome':'algoritmos'})
r_depois = requests.get('http://localhost:5003/disciplinas/100')
self.assertEqual(r_depois.json()['nome'],'algoritmos')
def test_206_id_inexistente(self):
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.put('http://localhost:5003/disciplinas/15',json={'nome':'bowser','id':15})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'disciplina nao encontrada')
r = requests.get('http://localhost:5003/disciplinas/15')
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'disciplina nao encontrada')
r = requests.delete('http://localhost:5003/disciplinas/15')
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'disciplina nao encontrada')
def test_207_criar_com_id_ja_existente(self):
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'distribuidos','status':12,'plano_ensino':'clientes e servidores','carga_horaria':10})
self.assertEqual(r.status_code,400)
self.assertEqual(r.json()['erro'],'id ja utilizada')
def test_208_post_com_campos_faltando(self):
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={ 'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
self.assertEqual(r.status_code,400)
self.assertTrue('erro' in r.json())
r = requests.post('http://localhost:5003/disciplinas',json={'id':101, 'status':12,'plano_ensino':'dados','carga_horaria':15})
self.assertEqual(r.status_code,400)
self.assertTrue('erro' in r.json())
r = requests.post('http://localhost:5003/disciplinas',json={'id':102,'nome':'estruturas de dados','status':12, 'carga_horaria':15})
self.assertEqual(r.status_code,400)
self.assertTrue('erro' in r.json())
r = requests.post('http://localhost:5003/disciplinas',json={'id':103,'nome':'estruturas de dados','status':12,'plano_ensino':'dados'})
self.assertEqual(r.status_code,400)
self.assertTrue('erro' in r.json())
def test_209_criar_com_campos_invalidos(self):
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':'banana','plano_ensino':'dados','carga_horaria':15})
self.assertEqual(r.status_code,400)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':'abacate'})
self.assertEqual(r.status_code,400)
r = requests.post('http://localhost:5003/disciplinas',json={'id':'orangotango','nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
self.assertEqual(r.status_code,400)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15})
self.assertEqual(r.status_code,200)
def test_300_inclui_coordenador(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'nome':'cicero','id':29})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15, 'id_coordenador':29})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'nome':'dai','id':28})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':101,'nome':'matemica','status':12,'plano_ensino':'sistemas lineares','carga_horaria':15, 'id_coordenador':28})
self.assertEqual(r.status_code,200)
def test_301_inclui_coordenador_invalido(self):
r_reset = requests.post('http://localhost:5002/reseta')
self.assertEqual(r_reset.status_code,200)
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
r = requests.post('http://localhost:5002/professores',json={'nome':'cicero','id':29})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5002/alunos',json={'nome':'lucas','id':28})
self.assertEqual(r.status_code,200)
r = requests.post('http://localhost:5003/disciplinas',json={'id':101,'nome':'matemica','status':12,'plano_ensino':'sistemas lineares','carga_horaria':15, 'id_coordenador':28})
self.assertEqual(r.status_code,400)
def test_400_db_existe(self):
import os
existe = os.path.exists('disciplina.db')
if not existe:
self.fail('arquivo db nao existe ou nao esta na mesma pasta que o runtests')
def test_401_disciplinas_com_db(self):
r_reset = requests.post('http://localhost:5003/reseta')
self.assertEqual(r_reset.status_code,200)
self.nao_devo_achar('estruturas de dados')
self.nao_devo_achar('distribuidos')
r = requests.post('http://localhost:5003/disciplinas',json={'id':100,'nome':'estruturas de dados','status':12,'plano_ensino':'dados','carga_horaria':15, 'id_coordenador':29})
self.assertEqual(r.status_code,200)
self.devo_achar('estruturas de dados')
self.nao_devo_achar('distribuidos')
r = requests.post('http://localhost:5003/disciplinas',json={'id':101,'nome':'distribuidos','status':10,'plano_ensino':'servidores','carga_horaria':15, 'id_coordenador':29})
self.assertEqual(r.status_code,200)
self.devo_achar('estruturas de dados')
self.devo_achar('distribuidos')
def sql_busca_tosca(self,procurando):
con = sqlite3.connect('disciplina.db')
cursorObj = con.cursor()
cursorObj.execute('SELECT name from sqlite_master where type= "table"')
tabelas = [a[0] for a in cursorObj.fetchall()]
dados = []
for tabela in tabelas:
cursorObj.execute('SELECT * from '+tabela)
dados.extend(cursorObj.fetchall())
con.close()
return procurando in str(dados)
def devo_achar(self,string):
if not self.sql_busca_tosca(string):
self.fail('procurei a string '+string+'''na sua base de dados
era para ela estar lá, mas não achei''')
def nao_devo_achar(self,string):
if self.sql_busca_tosca(string):
self.fail('procurei a string '+string+'''na sua base de dados
era para ela NAO estar lá, mas achei''')
def runTests():
suite = unittest.defaultTestLoader.loadTestsFromTestCase(TestStringMethods)
unittest.TextTestRunner(verbosity=2,failfast=True).run(suite)
if __name__ == '__main__':
runTests()
| 54.014019 | 183 | 0.658232 | 2,998 | 23,118 | 4.92962 | 0.072048 | 0.11787 | 0.105014 | 0.142094 | 0.883957 | 0.867041 | 0.824142 | 0.818391 | 0.797754 | 0.775289 | 0 | 0.059629 | 0.17229 | 23,118 | 427 | 184 | 54.140515 | 0.712725 | 0 | 0 | 0.560773 | 0 | 0 | 0.325071 | 0 | 0 | 0 | 0 | 0 | 0.334254 | 1 | 0.107735 | false | 0 | 0.01105 | 0 | 0.124309 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
27ecb47be225f9c2657e340f780db63fe49db388 | 86 | py | Python | prodapt_solutions/parser/xml_parser.py | DineshDevaraj/interview_answers | 8d3d631dc96dc97ebef80604d6455c2c57c8823d | [
"MIT"
] | null | null | null | prodapt_solutions/parser/xml_parser.py | DineshDevaraj/interview_answers | 8d3d631dc96dc97ebef80604d6455c2c57c8823d | [
"MIT"
] | null | null | null | prodapt_solutions/parser/xml_parser.py | DineshDevaraj/interview_answers | 8d3d631dc96dc97ebef80604d6455c2c57c8823d | [
"MIT"
] | null | null | null |
from parser.unified_parser import InputParser
class XmlParser(InputParser):
pass | 17.2 | 45 | 0.813953 | 10 | 86 | 6.9 | 0.8 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.139535 | 86 | 5 | 46 | 17.2 | 0.932432 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.333333 | 0.333333 | 0 | 0.666667 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
fd6945a8cb2800604bb2cdeb166dfc4e47496ff6 | 33 | py | Python | dataset/__init__.py | ResByte/aptos-blindness-pytorch | 7e0825336d1c1a82c8a4a405102df713580ec184 | [
"Apache-2.0"
] | null | null | null | dataset/__init__.py | ResByte/aptos-blindness-pytorch | 7e0825336d1c1a82c8a4a405102df713580ec184 | [
"Apache-2.0"
] | null | null | null | dataset/__init__.py | ResByte/aptos-blindness-pytorch | 7e0825336d1c1a82c8a4a405102df713580ec184 | [
"Apache-2.0"
] | null | null | null | from .dataset import AptosDataset | 33 | 33 | 0.878788 | 4 | 33 | 7.25 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.090909 | 33 | 1 | 33 | 33 | 0.966667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
fd9e6e116488d3d00923200df263b088f87457c6 | 14,198 | py | Python | nas_lib/params_nas.py | auroua/SSNENAS | 65bdece174f0da2f9a3c716b86859abba077d279 | [
"MIT"
] | 2 | 2020-12-29T06:33:22.000Z | 2022-02-19T22:21:05.000Z | nas_lib/params_nas.py | auroua/SSNENAS | 65bdece174f0da2f9a3c716b86859abba077d279 | [
"MIT"
] | null | null | null | nas_lib/params_nas.py | auroua/SSNENAS | 65bdece174f0da2f9a3c716b86859abba077d279 | [
"MIT"
] | null | null | null | import sys
def meta_neuralnet_params(param_str):
if param_str == 'nasbench_101':
params = {'search_space': 'nasbench_101', 'loss': 'mae', 'num_layers': 10, 'layer_width': 20,
'epochs': 150, 'batch_size': 32, 'lr': .01, 'regularization': 0, 'verbose': 0}
elif param_str == 'nasbench_201':
params = {'search_space': 'nasbench_201', 'loss': 'mae', 'num_layers': 10, 'layer_width': 200,
'epochs': 200, 'batch_size': 32, 'lr': .001, 'regularization': 0, 'verbose': 0}
else:
print('invalid meta neural net params')
sys.exit()
return params
def algo_params_close_domain(param_str, search_budget=100, dataname='cifar10'):
"""
Return params list based on param_str.
These are the parameters used to produce the figures in the paper
For AlphaX and Reinforcement Learning, we used the corresponding github repos:
https://github.com/linnanwang/AlphaX-NASBench101
https://github.com/automl/nas_benchmarks
"""
params = []
if dataname == 'cifar10-valid':
rate = 10.
elif dataname == 'cifar100':
rate = 30.
elif dataname == 'ImageNet16-120':
rate = 55
else:
raise NotImplementedError()
if param_str == 'nasbench_101':
params.append({'algo_name': 'random', 'total_queries': search_budget})
params.append({'algo_name': 'evolution', 'total_queries': search_budget, 'population_size': 30, 'num_init': 10, 'k': 10,
'tournament_size': 10, 'mutation_rate': 1.0})
params.append({'algo_name': 'bananas', 'total_queries': search_budget, 'num_ensemble': 5, 'allow_isomorphisms': False,
'acq_opt_type': 'mutation', 'candidate_nums': 100, 'num_init': 10, 'k': 10,
'encode_paths': True})
params.append({'algo_name': 'bananas_f', 'total_queries': search_budget, 'num_ensemble': 5,
'allow_isomorphisms': False, 'acq_opt_type': 'mutation', 'candidate_nums': 100, 'num_init': 10,
'k': 10, 'encode_paths': False})
params.append({'algo_name': 'bananas_context', 'total_queries': search_budget, 'num_ensemble': 5,
'allow_isomorphisms': False, 'acq_opt_type': 'mutation', 'candidate_nums': 100, 'num_init': 10,
'k': 10, 'encode_paths': False})
params.append({'algo_name': 'gin_predictor', 'total_queries': search_budget, 'agent': 'gin_predictor',
'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'candidate_nums': 100, 'epochs': 300})
params.append({'algo_name': 'gin_predictor_fixed_nums', 'total_queries': search_budget, 'agent': 'gin_predictor',
'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'candidate_nums': 100, 'epochs': 300,
'training_nums': 50})
params.append({'algo_name': 'gin_predictor_ss_rl', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl'})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 90})
params.append({'algo_name': 'gin_predictor_ss_ccl', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 200, 'predictor_type': 'ss_ccl'})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 200, 'predictor_type': 'ss_ccl', 'training_nums': 90})
elif param_str == 'nasbench_201':
params.append({'algo_name': 'random', 'total_queries': search_budget})
params.append({'algo_name': 'evolution', 'total_queries': search_budget, 'population_size': 30, 'num_init': 10,
'k': 10, 'tournament_size': 10, 'mutation_rate': 1.0, 'allow_isomorphisms': False,
'deterministic': True})
params.append({'algo_name': 'bananas', 'total_queries': search_budget, 'num_ensemble': 5,
'allow_isomorphisms': False, 'acq_opt_type': 'mutation', 'candidate_nums': 100, 'num_init': 10,
'k': 10, 'encode_paths': True, 'eva_new': False})
params.append({'algo_name': 'bananas_f', 'total_queries': search_budget, 'num_ensemble': 5,
'allow_isomorphisms': False, 'acq_opt_type': 'mutation', 'candidate_nums': 100, 'num_init': 10,
'k': 10, 'encode_paths': False})
params.append({'algo_name': 'bananas_context', 'total_queries': search_budget, 'num_ensemble': 5,
'allow_isomorphisms': False, 'acq_opt_type': 'mutation', 'candidate_nums': 100, 'num_init': 10,
'k': 10, 'encode_paths': False})
params.append({'algo_name': 'gin_predictor', 'total_queries': search_budget, 'agent': 'gin_predictor',
'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'candidate_nums': 100, 'epochs': 300,
'rate': rate})
params.append({'algo_name': 'gin_predictor_fixed_nums', 'total_queries': search_budget, 'agent': 'gin_predictor',
'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'candidate_nums': 100, 'epochs': 300,
'training_nums': 50, 'rate': rate})
params.append({'algo_name': 'gin_predictor_ss_rl', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'rate': rate})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 50})
params.append({'algo_name': 'gin_predictor_ss_ccl', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_ccl'})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_ccl', 'training_nums': 50})
elif param_str == 'nasbench_101_fixed':
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 20})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 50})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 80})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 110})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 150})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 200, 'predictor_type': 'ss_ccl', 'training_nums': 20})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 200, 'predictor_type': 'ss_ccl', 'training_nums': 50})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 200, 'predictor_type': 'ss_ccl', 'training_nums': 80})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 200, 'predictor_type': 'ss_ccl', 'training_nums': 110})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005,
'candidate_nums': 100, 'epochs': 200, 'predictor_type': 'ss_ccl', 'training_nums': 150})
elif param_str == 'nasbench_201_fixed':
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 20})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 50})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 80})
params.append({'algo_name': 'gin_predictor_ss_rl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_rl', 'training_nums': 100})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_ccl', 'training_nums': 20})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_ccl', 'training_nums': 50})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_ccl', 'training_nums': 80})
params.append({'algo_name': 'gin_predictor_ss_ccl_num_fixed', 'total_queries': search_budget, 'k': 10,
'agent': 'gin_predictor', 'num_init': 10, 'allow_isomorphisms': False, 'lr': 0.005, 'rate': rate,
'candidate_nums': 100, 'epochs': 150, 'predictor_type': 'ss_ccl', 'training_nums': 100})
elif param_str == 'experiment':
pass
else:
print('invalid algorithm params')
sys.exit()
print('* Running experiment: ' + param_str)
return params
def algo_params_open_domain(param_str):
if param_str == 'gin_predictor': # gin_predictor gin_predictor_fixed_num
param = {'algo_name': 'gin_predictor_fixed_num', 'total_queries': 30, 'agent': 'gin_predictor', 'num_init': 10,
'allow_isomorphisms': False, 'k': 10, 'epochs': 300, 'batch_size': 32, 'lr': 0.005,
'encode_path': True, 'candidate_nums': 100, 'mutate_rate': 2.0, 'filter_method': 'pape',
'fixed_num': 70}
else:
raise NotImplementedError("This algorithm have not implement!")
print('* Running experiment: ' + str(param))
return param | 81.131429 | 128 | 0.599662 | 1,695 | 14,198 | 4.691445 | 0.087316 | 0.098089 | 0.080483 | 0.100604 | 0.867329 | 0.851735 | 0.838028 | 0.830986 | 0.82998 | 0.823944 | 0 | 0.058378 | 0.237498 | 14,198 | 175 | 129 | 81.131429 | 0.67615 | 0.022116 | 0 | 0.605096 | 0 | 0 | 0.429026 | 0.052012 | 0 | 0 | 0 | 0 | 0 | 1 | 0.019108 | false | 0.006369 | 0.006369 | 0 | 0.044586 | 0.025478 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
fda5d899ee7641b030918c162e49d451ec8a4d62 | 22 | py | Python | pyalgo/__init__.py | ksks2211/pyalgo | e8f26361fc404324b267f3923f6a1a5183ba102e | [
"MIT"
] | null | null | null | pyalgo/__init__.py | ksks2211/pyalgo | e8f26361fc404324b267f3923f6a1a5183ba102e | [
"MIT"
] | null | null | null | pyalgo/__init__.py | ksks2211/pyalgo | e8f26361fc404324b267f3923f6a1a5183ba102e | [
"MIT"
] | null | null | null | from . import sorting
| 11 | 21 | 0.772727 | 3 | 22 | 5.666667 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.181818 | 22 | 1 | 22 | 22 | 0.944444 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
fdaee7e72697de590bf1e25412a7da67ca369ea3 | 31 | py | Python | sidebars/guidance/__init__.py | whytheplatypus/cmcs-eregulations | 010affdbefd8499ad9bed4d95275ccfd2ba9014f | [
"CC0-1.0"
] | null | null | null | sidebars/guidance/__init__.py | whytheplatypus/cmcs-eregulations | 010affdbefd8499ad9bed4d95275ccfd2ba9014f | [
"CC0-1.0"
] | null | null | null | sidebars/guidance/__init__.py | whytheplatypus/cmcs-eregulations | 010affdbefd8499ad9bed4d95275ccfd2ba9014f | [
"CC0-1.0"
] | null | null | null | from .guidance import Guidance
| 15.5 | 30 | 0.83871 | 4 | 31 | 6.5 | 0.75 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.129032 | 31 | 1 | 31 | 31 | 0.962963 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
fdcf0687815c431a6a2fb6cbd7bfca5dc21c28f1 | 325 | py | Python | reqlog/dbschema/__init__.py | JFF-Bohdan/reqlog | a7ba7b6e12609d736b3cd8cd8bc2913d511848ee | [
"MIT"
] | null | null | null | reqlog/dbschema/__init__.py | JFF-Bohdan/reqlog | a7ba7b6e12609d736b3cd8cd8bc2913d511848ee | [
"MIT"
] | null | null | null | reqlog/dbschema/__init__.py | JFF-Bohdan/reqlog | a7ba7b6e12609d736b3cd8cd8bc2913d511848ee | [
"MIT"
] | null | null | null | from .tbl_sys_users import * # noqa
from .tbl_logged_requests import * # noqa
from .tbl_request_parameters import * # noqa
from .tbl_data_collecting_nodes import * # noqa
from .tbl_data_collecting_device import * # noqa
from .tbl_dc_available_scopes import * # noqa
from .tbl_link_users_to_scopes import * # noqa | 46.428571 | 50 | 0.769231 | 47 | 325 | 4.914894 | 0.404255 | 0.212121 | 0.363636 | 0.441558 | 0.268398 | 0.268398 | 0 | 0 | 0 | 0 | 0 | 0 | 0.166154 | 325 | 7 | 51 | 46.428571 | 0.852399 | 0.104615 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
8b686750e96472a73cac5cdca5baa582e730ea0f | 145 | py | Python | thecreamind_frappe/the_crea_mind/doctype/crea_mind_kid/test_crea_mind_kid.py | FathimaSayeeda/creamindBackend | 7d94b08b1f1df5ab35a5b07a0d00d88bfaf1f90e | [
"MIT"
] | 2 | 2021-07-25T09:28:46.000Z | 2021-12-07T22:03:29.000Z | thecreamind_frappe/the_crea_mind/doctype/crea_mind_kid/test_crea_mind_kid.py | FathimaSayeeda/creamindBackend | 7d94b08b1f1df5ab35a5b07a0d00d88bfaf1f90e | [
"MIT"
] | null | null | null | thecreamind_frappe/the_crea_mind/doctype/crea_mind_kid/test_crea_mind_kid.py | FathimaSayeeda/creamindBackend | 7d94b08b1f1df5ab35a5b07a0d00d88bfaf1f90e | [
"MIT"
] | 3 | 2021-07-22T23:31:04.000Z | 2021-08-14T22:45:20.000Z | # Copyright (c) 2021, Fahim and Contributors
# See license.txt
# import frappe
import unittest
class TestCreaMindKid(unittest.TestCase):
pass
| 16.111111 | 44 | 0.77931 | 18 | 145 | 6.277778 | 0.888889 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.032258 | 0.144828 | 145 | 8 | 45 | 18.125 | 0.879032 | 0.496552 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0.333333 | 0.333333 | 0 | 0.666667 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 1 | 0 | 0 | 6 |
8ba160e85b1169541602c16f2804a26a2d5058b6 | 27 | py | Python | book-code/numpy-ml/numpy_ml/neural_nets/activations/__init__.py | yangninghua/code_library | b769abecb4e0cbdbbb5762949c91847a0f0b3c5a | [
"MIT"
] | 3 | 2021-07-07T13:28:01.000Z | 2021-11-12T06:32:49.000Z | book-code/numpy-ml/numpy_ml/neural_nets/activations/__init__.py | yangninghua/code_library | b769abecb4e0cbdbbb5762949c91847a0f0b3c5a | [
"MIT"
] | null | null | null | book-code/numpy-ml/numpy_ml/neural_nets/activations/__init__.py | yangninghua/code_library | b769abecb4e0cbdbbb5762949c91847a0f0b3c5a | [
"MIT"
] | 3 | 2021-11-17T08:46:37.000Z | 2022-03-04T16:35:36.000Z | from .activations import *
| 13.5 | 26 | 0.777778 | 3 | 27 | 7 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.148148 | 27 | 1 | 27 | 27 | 0.913043 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
47609f893d72b1fb1dabce0543ded32355768797 | 555 | py | Python | scripts/utils/__init__.py | kellisfm/deep-protein-generation | 0804aa5c8e48edeab0fe269e9129234f62558fc2 | [
"MIT"
] | 23 | 2020-04-08T07:49:17.000Z | 2022-03-30T06:02:35.000Z | scripts/utils/__init__.py | kellisfm/deep-protein-generation | 0804aa5c8e48edeab0fe269e9129234f62558fc2 | [
"MIT"
] | 4 | 2020-01-28T23:13:38.000Z | 2022-02-10T01:10:08.000Z | scripts/utils/__init__.py | kellisfm/deep-protein-generation | 0804aa5c8e48edeab0fe269e9129234f62558fc2 | [
"MIT"
] | 11 | 2020-05-13T15:18:04.000Z | 2022-03-23T08:12:58.000Z | aa_letters = ['-', 'A', 'C', 'D', 'E', 'F', 'G', 'H', 'I', 'K',
'L', 'M', 'N', 'P', 'Q', 'R', 'S', 'T', 'V', 'W', 'Y']
luxa_seq = 'MKFGNFLLTYQPPQFSQTEVMKRLVKLGRISEECGFDTVWLLEHHFTEFGLLGNPYVAAAYLLGATKKLNVGTAAIVLPTAHPVRQLEDVNLLDQMSK' \
'GRFRFGICRGLYNKDFRVFGTDMNNSRALAECWYGLIKNGMTEGYMEADNEHIKFHKVKVNPAAYSRGGAPVYVVAESASTTEWAAQFGLPMILSWIIN' \
'TNEKKAQLELYNEVAQEYGHDIHNIDHCLSYITSVDHDSIKAKEICRKFLGHWYDSYVNATTIFDDSDQTRGYDFNKGQWRDFVLKGHKDTNRRIDYSY' \
'EINPVGTPQECIDIIQKDIDATGISNICCGFEANGTVDEIIASMKLFQSDVMPFLKEKQRSLLY' | 79.285714 | 114 | 0.717117 | 28 | 555 | 14.142857 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.142342 | 555 | 7 | 115 | 79.285714 | 0.831933 | 0 | 0 | 0 | 0 | 0 | 0.685252 | 0.647482 | 0 | 1 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
476ba6db5517cc0cad4b40d95e400eeb5d2533e9 | 3,783 | py | Python | pyflux/var/tests/var_tests.py | ThomasHoppe/pyflux | 297f2afc2095acd97c12e827dd500e8ea5da0c0f | [
"BSD-3-Clause"
] | 2,091 | 2016-04-01T02:52:10.000Z | 2022-03-29T11:38:15.000Z | pyflux/var/tests/var_tests.py | EricSchles/pyflux | 297f2afc2095acd97c12e827dd500e8ea5da0c0f | [
"BSD-3-Clause"
] | 160 | 2016-04-26T14:52:18.000Z | 2022-03-15T02:09:07.000Z | pyflux/var/tests/var_tests.py | EricSchles/pyflux | 297f2afc2095acd97c12e827dd500e8ea5da0c0f | [
"BSD-3-Clause"
] | 264 | 2016-05-02T14:03:31.000Z | 2022-03-29T07:48:20.000Z | import numpy as np
import pyflux as pf
import pandas as pd
noise_1 = np.random.normal(0,1,350)
noise_2 = np.random.normal(0,1,350)
data_1 = np.zeros(350)
data_2 = np.zeros(350)
for i in range(1,len(data_1)):
data_1[i] = 0.9*data_1[i-1] + noise_1[i]
data_2[i] = 0.9*data_2[i-1] + noise_2[i]
data = pd.DataFrame([data_1,data_2]).T
data.columns = ['test1','test2']
# Uncomment once PML/Laplace approximation is more robust
def test_couple_terms():
"""
Tests an VAR model with 1 AR and 1 MA term and that
the latent variable list length is correct, and that the estimated
latent variables are not nan
"""
model = pf.VAR(data=data, lags=2)
x = model.fit()
assert(len(model.latent_variables.z_list) == 13)
lvs = np.array([i.value for i in model.latent_variables.z_list])
assert(len(lvs[np.isnan(lvs)]) == 0)
def test_couple_terms_integ():
"""
Tests an VAR model with 1 AR and 1 MA term, integrated once, and that
the latent variable list length is correct, and that the estimated
latent variables are not nan
"""
model = pf.VAR(data=data, lags=2, integ=1)
x = model.fit()
assert(len(model.latent_variables.z_list) == 13)
lvs = np.array([i.value for i in model.latent_variables.z_list])
assert(len(lvs[np.isnan(lvs)]) == 0)
def test_bbvi():
"""
Tests an VAR model estimated with BBVI and that the length of the latent variable
list is correct, and that the estimated latent variables are not nan
"""
model = pf.VAR(data=data, lags=2)
x = model.fit('BBVI',iterations=100)
assert(len(model.latent_variables.z_list) == 13)
lvs = np.array([i.value for i in model.latent_variables.z_list])
assert(len(lvs[np.isnan(lvs)]) == 0)
def test_mh():
"""
Tests an VAR model estimated with Metropolis-Hastings and that the length of the
latent variable list is correct, and that the estimated latent variables are not nan
"""
model = pf.VAR(data=data, lags=2)
x = model.fit('M-H',nsims=300)
assert(len(model.latent_variables.z_list) == 13)
lvs = np.array([i.value for i in model.latent_variables.z_list])
assert(len(lvs[np.isnan(lvs)]) == 0)
#def test_laplace():
# """
# Tests an VAR model estimated with Laplace approximation and that the length of the
# latent variable list is correct, and that the estimated latent variables are not nan
# """
# model = pf.VAR(data=data, lags=2)
# x = model.fit('Laplace')
# assert(len(model.latent_variables.z_list) == 13)
# lvs = np.array([i.value for i in model.latent_variables.z_list])
# assert(len(lvs[np.isnan(lvs)]) == 0)
#def test_pml():
# """
# Tests a PML model estimated with Laplace approximation and that the length of the
# latent variable list is correct, and that the estimated latent variables are not nan
# """
# model = pf.VAR(data=data, lags=2)
# x = model.fit('PML')
# assert(len(model.latent_variables.z_list) == 13)
# lvs = np.array([i.value for i in model.latent_variables.z_list])
# assert(len(lvs[np.isnan(lvs)]) == 0)
def test_predict_length():
"""
Tests that the prediction dataframe length is equal to the number of steps h
"""
model = pf.VAR(data=data, lags=2)
x = model.fit()
assert(model.predict(h=5).shape[0] == 5)
def test_predict_is_length():
"""
Tests that the prediction IS dataframe length is equal to the number of steps h
"""
model = pf.VAR(data=data, lags=2)
x = model.fit()
assert(model.predict_is(h=5).shape[0] == 5)
def test_predict_nans():
"""
Tests that the predictions are not nans
"""
model = pf.VAR(data=data, lags=2)
x = model.fit()
assert(len(model.predict(h=5).values[np.isnan(model.predict(h=5).values)]) == 0)
def test_predict_is_nans():
"""
Tests that the in-sample predictions are not nans
"""
model = pf.VAR(data=data, lags=2)
x = model.fit()
assert(len(model.predict_is(h=5).values[np.isnan(model.predict_is(h=5).values)]) == 0) | 32.333333 | 87 | 0.706318 | 673 | 3,783 | 3.882615 | 0.144131 | 0.10333 | 0.045924 | 0.096441 | 0.825871 | 0.800612 | 0.756219 | 0.735553 | 0.717949 | 0.717949 | 0 | 0.027657 | 0.149352 | 3,783 | 117 | 87 | 32.333333 | 0.784338 | 0.459424 | 0 | 0.480769 | 0 | 0 | 0.008731 | 0 | 0 | 0 | 0 | 0 | 0.230769 | 1 | 0.153846 | false | 0 | 0.057692 | 0 | 0.211538 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
7bd72088d4eefd46cd04b5ada1ac1cd20e8e2179 | 5,224 | py | Python | tests/test_contract_lima.py | isabella232/aepp-sdk-python | 58ac2d12e0062896a473c254781ee397e3da318e | [
"0BSD"
] | 22 | 2018-02-20T02:39:34.000Z | 2021-12-17T12:12:00.000Z | tests/test_contract_lima.py | aeternity/aepp-sdk-python | 58ac2d12e0062896a473c254781ee397e3da318e | [
"0BSD"
] | 284 | 2018-02-12T11:50:39.000Z | 2021-07-27T04:55:15.000Z | tests/test_contract_lima.py | isabella232/aepp-sdk-python | 58ac2d12e0062896a473c254781ee397e3da318e | [
"0BSD"
] | 17 | 2018-02-20T17:17:12.000Z | 2022-03-06T08:36:26.000Z | import pytest
def _sophia_contract_tx_create_online(node_cli, account):
tests = [
{
# init(42)
"name": "simplestorage.aes",
"sourcecode": "contract SimpleStorage =\n record state = { data : int }\n entrypoint init(value : int) : state = { data = value }\n entrypoint get() : int = state.data\n stateful entrypoint set(value : int) = put(state{data = value})\n",
"bytecode": "cb_+JFGA6CaF4v9syrdOevYZSWs8H6yoVk//r4Azu+V96W3B5CXFMC4YLg8/i+GW9kANwAHKCwAggD+RNZEHwA3AQc3AAwBACcMAhoCggEDP/7oxF62ADcBBzcADAEAJwwCGgKCAQM/ni8DES+GW9kNZ2V0EUTWRB8RaW5pdBHoxF62DXNldIIvAIk0LjAuMC1yYzUAYj/1oA==",
"calldata": "cb_KxFE1kQfG1TH2kjs",
},
{
"name": "identity.aes",
"sourcecode": "contract Identity =\n entrypoint main(x : int) = x",
"bytecode": "cb_+GpGA6Abk28ISckRxfWDHCo6FYfNzlAYCRW6TBDvQZ2BYQUmH8C4OZ7+RNZEHwA3ADcAGg6CPwEDP/64F37sADcBBwcBAQCWLwIRRNZEHxFpbml0EbgXfuwRbWFpboIvAIk0LjAuMC1yYzUAfpEWYw==",
"calldata": "cb_KxFE1kQfP4oEp9E=", # init()
}
]
for t in tests:
contract = node_cli.Contract()
tx = contract.create(account, t.get("bytecode"), calldata=t.get("calldata"), gas=100000)
c_id = tx.metadata.contract_id
deployed = node_cli.get_contract(pubkey=c_id)
assert deployed.active is True
assert deployed.owner_id == account.get_address()
def _sophia_contract_tx_call_online(node_cli, account):
tests = [
{
"name": "simplestorage.aes",
"sourcecode": "contract SimpleStorage =\n record state = { data : int }\n entrypoint init(value : int) : state = { data = value }\n entrypoint get() : int = state.data\n stateful entrypoint set(value : int) = put(state{data = value})\n",
"bytecode": "cb_+JFGA6CaF4v9syrdOevYZSWs8H6yoVk//r4Azu+V96W3B5CXFMC4YLg8/i+GW9kANwAHKCwAggD+RNZEHwA3AQc3AAwBACcMAhoCggEDP/7oxF62ADcBBzcADAEAJwwCGgKCAQM/ni8DES+GW9kNZ2V0EUTWRB8RaW5pdBHoxF62DXNldIIvAIk0LjAuMC1yYzUAYj/1oA==",
# init(42)
"init.calldata": "cb_KxFE1kQfG1TH2kjs",
"call.function": "set",
"call.arguments": [24],
"call.calldata": "cb_KxHoxF62GzAP+Odz",
"return.value": "cb_P4fvHVw=" # 0,
},
{
"name": "identity.aes",
"sourcecode": "contract Identity =\n entrypoint main(x : int) = x",
"bytecode": "cb_+GpGA6Abk28ISckRxfWDHCo6FYfNzlAYCRW6TBDvQZ2BYQUmH8C4OZ7+RNZEHwA3ADcAGg6CPwEDP/64F37sADcBBwcBAQCWLwIRRNZEHxFpbml0EbgXfuwRbWFpboIvAIk0LjAuMC1yYzUAfpEWYw==",
"init.calldata": "cb_KxFE1kQfP4oEp9E=",
"call.function": "main",
"call.arguments": [42],
"call.calldata": "cb_KxG4F37sG1Q/+F7e",
"return.value": "cb_VNLOFXc=" # 42
}
]
for t in tests:
print(f"call contract {t.get('name')}")
contract = node_cli.Contract()
tx = contract.create(account, t.get("bytecode"), calldata=t.get("init.calldata"))
c_id = tx.metadata.contract_id
deployed = node_cli.get_contract(pubkey=c_id)
assert deployed.active is True
assert deployed.owner_id == account.get_address()
tx = contract.call(c_id, account, t.get("call.function"), t.get("call.calldata"))
# retrieve the call object
call = contract.get_call_object(tx.hash)
assert call.return_value == t.get("return.value")
assert call.return_type == "ok"
def _sophia_contract_tx_call_static(node_cli, account):
tests = [
{
"name": "identity.aes",
"sourcecode": "contract Identity =\n entrypoint main(x : int) = x",
"bytecode": "cb_+GpGA6Abk28ISckRxfWDHCo6FYfNzlAYCRW6TBDvQZ2BYQUmH8C4OZ7+RNZEHwA3ADcAGg6CPwEDP/64F37sADcBBwcBAQCWLwIRRNZEHxFpbml0EbgXfuwRbWFpboIvAIk0LjAuMC1yYzUAfpEWYw==",
"init.calldata": "cb_KxFE1kQfP4oEp9E=",
"call.function": "main",
"call.arguments": [42],
"call.calldata": "cb_KxG4F37sG1Q/+F7e",
"return.value": "cb_VNLOFXc=" # 42
}
]
for t in tests:
contract = node_cli.Contract()
tx = contract.create(account, t.get("bytecode"), calldata=t.get("init.calldata"))
c_id = tx.metadata.contract_id
deployed = node_cli.get_contract(pubkey=c_id)
assert deployed.active is True
assert deployed.owner_id == account.get_address()
tx = contract.call_static(c_id, t.get("call.function"), t.get("call.calldata"), address=account.get_address())
assert tx.result == "ok"
def test_sophia_contract_tx_create_native_lima(chain_fixture):
# save settings and go online
_sophia_contract_tx_create_online(chain_fixture.NODE_CLI, chain_fixture.ALICE)
def test_sophia_contract_tx_call_native_lima(chain_fixture):
# save settings and go online
_sophia_contract_tx_call_online(chain_fixture.NODE_CLI, chain_fixture.ALICE)
# restore settings
def test_sophia_contract_tx_call_static_native_lima(chain_fixture):
# save settings and go online
_sophia_contract_tx_call_static(chain_fixture.NODE_CLI, chain_fixture.BOB)
# restore settings
| 47.490909 | 253 | 0.662711 | 542 | 5,224 | 6.180812 | 0.184502 | 0.035821 | 0.042985 | 0.035821 | 0.867761 | 0.812836 | 0.787463 | 0.787463 | 0.743284 | 0.743284 | 0 | 0.039529 | 0.220329 | 5,224 | 109 | 254 | 47.926606 | 0.782961 | 0.033691 | 0 | 0.55814 | 0 | 0.046512 | 0.441486 | 0.174647 | 0 | 0 | 0 | 0 | 0.104651 | 1 | 0.069767 | false | 0 | 0.011628 | 0 | 0.081395 | 0.011628 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
7be2d2b64f3512d94e59f3506bbed2cc20f5e171 | 94 | py | Python | structure/__init__.py | Jaidev810/Data-Structures-package | f651615275817f182662892b2b57b200310d3dba | [
"MIT"
] | 2 | 2021-02-27T06:13:11.000Z | 2021-02-27T06:15:03.000Z | structure/__init__.py | Jaidev810/Data-Structures-package | f651615275817f182662892b2b57b200310d3dba | [
"MIT"
] | null | null | null | structure/__init__.py | Jaidev810/Data-Structures-package | f651615275817f182662892b2b57b200310d3dba | [
"MIT"
] | null | null | null | from . BinaryTree import *
from . SinglyLinkedList import *
from . DoublyLinkedList import *
| 18.8 | 32 | 0.765957 | 9 | 94 | 8 | 0.555556 | 0.277778 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.170213 | 94 | 4 | 33 | 23.5 | 0.923077 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
7bf67171698a0944d4f320105ed0a0a9d01d1a8e | 45 | py | Python | orthogonal_table/__init__.py | CAgAG/OrthogonalArray_Flask | dba6d28cf7118ff7d3a0d7e21974a360599f6749 | [
"Apache-2.0"
] | 1 | 2021-06-21T03:28:55.000Z | 2021-06-21T03:28:55.000Z | orthogonal_table/__init__.py | CAgAG/OrthogonalArray_Flask | dba6d28cf7118ff7d3a0d7e21974a360599f6749 | [
"Apache-2.0"
] | null | null | null | orthogonal_table/__init__.py | CAgAG/OrthogonalArray_Flask | dba6d28cf7118ff7d3a0d7e21974a360599f6749 | [
"Apache-2.0"
] | null | null | null | from orthogonal_table.Query import QueryTable | 45 | 45 | 0.911111 | 6 | 45 | 6.666667 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.066667 | 45 | 1 | 45 | 45 | 0.952381 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
d01967ae30afad30e5e9adff8ab00f997d34a22a | 82 | py | Python | demo.py | zlqm/docx-equation | 52e4c8b021457425e9f975a68eaf7beb6ce9fa18 | [
"MIT"
] | 4 | 2020-05-18T18:48:09.000Z | 2022-01-16T13:33:37.000Z | demo.py | zlqm/docx-equation | 52e4c8b021457425e9f975a68eaf7beb6ce9fa18 | [
"MIT"
] | 1 | 2021-08-25T12:11:58.000Z | 2021-08-30T07:51:00.000Z | demo.py | zlqm/docx-equation | 52e4c8b021457425e9f975a68eaf7beb6ce9fa18 | [
"MIT"
] | 3 | 2021-02-08T12:57:47.000Z | 2021-11-06T14:18:28.000Z | from docx_equation.docx import convert_to_html
convert_to_html('equation.docx')
| 16.4 | 46 | 0.841463 | 13 | 82 | 4.923077 | 0.538462 | 0.375 | 0.40625 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.085366 | 82 | 4 | 47 | 20.5 | 0.853333 | 0 | 0 | 0 | 0 | 0 | 0.158537 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.5 | 0 | 0.5 | 0 | 1 | 0 | 0 | null | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 6 |
d02329291c94acf4820a1a1242ac7a39fe6ec96e | 49 | py | Python | Basic Text/GUI.py | PyHubs/Workspace-UX | 5f6829b7fa9039814266e403da476a612cd2e5ee | [
"MIT"
] | null | null | null | Basic Text/GUI.py | PyHubs/Workspace-UX | 5f6829b7fa9039814266e403da476a612cd2e5ee | [
"MIT"
] | null | null | null | Basic Text/GUI.py | PyHubs/Workspace-UX | 5f6829b7fa9039814266e403da476a612cd2e5ee | [
"MIT"
] | null | null | null | from tkinter import *
import tkinter.tkFileDialog | 24.5 | 27 | 0.857143 | 6 | 49 | 7 | 0.666667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.102041 | 49 | 2 | 27 | 24.5 | 0.954545 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
d04a6c2d5ca5ab189b9540049c1bd7899dc59bb9 | 481 | py | Python | libcluster/pvlib_cspopt/__init__.py | Matthew-Boyd/dao-tk | 2ab34425aeccbac2d08cf1b8fc262568ab8102eb | [
"MIT"
] | 2 | 2019-11-14T01:40:49.000Z | 2021-04-04T09:23:16.000Z | libcluster/pvlib_cspopt/__init__.py | Matthew-Boyd/dao-tk | 2ab34425aeccbac2d08cf1b8fc262568ab8102eb | [
"MIT"
] | 1 | 2019-01-07T22:05:36.000Z | 2019-01-07T22:07:02.000Z | libcluster/pvlib_cspopt/__init__.py | Matthew-Boyd/dao-tk | 2ab34425aeccbac2d08cf1b8fc262568ab8102eb | [
"MIT"
] | 4 | 2019-12-03T16:41:48.000Z | 2020-12-15T20:18:53.000Z | import logging
logging.basicConfig()
#from pvlib.version import __version__
from pvlib_cspopt import tools
from pvlib_cspopt import atmosphere
from pvlib_cspopt import clearsky
# from pvlib import forecast
from pvlib_cspopt import irradiance
from pvlib_cspopt import location
from pvlib_cspopt import solarposition
#from pvlib_cspopt import tmy
#from pvlib_cspopt import tracking
#rom pvlib_cspopt import pvsystem
#from pvlib_cspopt import spa
#from pvlib_cspopt import modelchain
| 30.0625 | 38 | 0.860707 | 68 | 481 | 5.867647 | 0.294118 | 0.270677 | 0.468672 | 0.526316 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.116424 | 481 | 15 | 39 | 32.066667 | 0.938824 | 0.45738 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.875 | 0 | 0.875 | 0 | 0 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
d0a6b3a7add4a0656978ded4d9ee6af419bbd9f0 | 6,346 | py | Python | scripts/qgis_import_bag_data.py | ElmarJ/Amsterdam.1892.GeoJSON | 483b1a42f406ae72a6149f36feeb90f39cd07a84 | [
"MIT"
] | null | null | null | scripts/qgis_import_bag_data.py | ElmarJ/Amsterdam.1892.GeoJSON | 483b1a42f406ae72a6149f36feeb90f39cd07a84 | [
"MIT"
] | 8 | 2020-05-01T08:42:00.000Z | 2022-01-02T19:43:04.000Z | scripts/qgis_import_bag_data.py | ElmarJ/Amsterdam.1892.GeoJSON | 483b1a42f406ae72a6149f36feeb90f39cd07a84 | [
"MIT"
] | null | null | null | processing.run("native:extractbylocation", {'INPUT':'WFS:// pagingEnabled=\'true\' restrictToRequestBBOX=\'1\' srsname=\'EPSG:28992\' typename=\'BAG3D:pand3d\' url=\'http://3dbag.bk.tudelft.nl/data/wfs\' url=\'http://3dbag.bk.tudelft.nl/data/wfs?request=getcapabilities\' version=\'auto\'','PREDICATE':[0],'INTERSECT':'https://maps.amsterdam.nl/open_geodata/geojson.php?KAARTLAAG=GEBIED_STADSDELEN&THEMA=gebiedsindeling|layername=OGRGeoJSON|subset=\"Stadsdeel_code\" = \'A\'','OUTPUT':'TEMPORARY_OUTPUT'})
processing.run("native:reprojectlayer", {'INPUT':'memory://Polygon?crs=EPSG:28992&field=gid:integer(0,0)&field=identificatie:string(0,0)&field=aanduidingrecordinactief:string(0,0)&field=aanduidingrecordcorrectie:integer(0,0)&field=officieel:string(0,0)&field=inonderzoek:string(0,0)&field=documentnummer:string(0,0)&field=documentdatum:string(0,0)&field=bouwjaar:string(0,0)&field=begindatumtijdvakgeldigheid:datetime(0,0)&field=einddatumtijdvakgeldigheid:datetime(0,0)&field=gemeentecode:string(0,0)&field=ground-0.00:double(0,0)&field=ground-0.10:double(0,0)&field=ground-0.20:double(0,0)&field=ground-0.30:double(0,0)&field=ground-0.40:double(0,0)&field=ground-0.50:double(0,0)&field=roof-0.25:double(0,0)&field=rmse-0.25:double(0,0)&field=roof-0.50:double(0,0)&field=rmse-0.50:double(0,0)&field=roof-0.75:double(0,0)&field=rmse-0.75:double(0,0)&field=roof-0.90:double(0,0)&field=rmse-0.90:double(0,0)&field=roof-0.95:double(0,0)&field=rmse-0.95:double(0,0)&field=roof-0.99:double(0,0)&field=rmse-0.99:double(0,0)&field=roof_flat:string(0,0)&field=nr_ground_pts:integer(0,0)&field=nr_roof_pts:integer(0,0)&field=ahn_file_date:datetime(0,0)&field=ahn_version:integer(0,0)&field=height_valid:string(0,0)&field=tile_id:string(0,0)&field=pand_h_75:double(0,0)&uid={3c158045-ada3-409f-ad3c-ecb02dc2efa8}','TARGET_CRS':QgsCoordinateReferenceSystem('EPSG:4326'),'OPERATION':'+proj=pipeline +step +inv +proj=sterea +lat_0=52.1561605555556 +lon_0=5.38763888888889 +k=0.9999079 +x_0=155000 +y_0=463000 +ellps=bessel +step +proj=push +v_3 +step +proj=cart +ellps=bessel +step +proj=helmert +x=565.2369 +y=50.0087 +z=465.658 +rx=0.406857330322398 +ry=-0.350732676542563 +rz=1.8703473836068 +s=4.0812 +convention=coordinate_frame +step +inv +proj=cart +ellps=WGS84 +step +proj=pop +v_3 +step +proj=unitconvert +xy_in=rad +xy_out=deg','OUTPUT':'C:/Users/elmar/repos/Amsterdam.1892.GeoJSON/bag_3d_centrum.gpkg'})
processing.run("native:refactorfields", {'INPUT':'C:/Users/elmar/repos/Amsterdam.1892.GeoJSON/3d_bag_centrum.gpkg','FIELDS_MAPPING':[{'expression': '\"fid\"','length': 0,'name': 'fid','precision': 0,'type': 4},{'expression': '\"gid\"','length': 0,'name': 'gid','precision': 0,'type': 2},{'expression': '\"identificatie\"','length': 0,'name': 'identificatie','precision': 0,'type': 10},{'expression': '\"aanduidingrecordinactief\"','length': 0,'name': 'aanduidingrecordinactief','precision': 0,'type': 10},{'expression': '\"aanduidingrecordcorrectie\"','length': 0,'name': 'aanduidingrecordcorrectie','precision': 0,'type': 2},{'expression': '\"officieel\"','length': 0,'name': 'officieel','precision': 0,'type': 10},{'expression': '\"inonderzoek\"','length': 0,'name': 'inonderzoek','precision': 0,'type': 10},{'expression': '\"documentnummer\"','length': 0,'name': 'documentnummer','precision': 0,'type': 10},{'expression': '\"documentdatum\"','length': 0,'name': 'documentdatum','precision': 0,'type': 10},{'expression': '\"bouwjaar\"','length': 0,'name': 'bouwjaar','precision': 0,'type': 10},{'expression': '\"begindatumtijdvakgeldigheid\"','length': 0,'name': 'begindatumtijdvakgeldigheid','precision': 0,'type': 16},{'expression': '\"einddatumtijdvakgeldigheid\"','length': 0,'name': 'einddatumtijdvakgeldigheid','precision': 0,'type': 16},{'expression': '\"gemeentecode\"','length': 0,'name': 'gemeentecode','precision': 0,'type': 10},{'expression': '\"ground-0.00\"','length': 0,'name': 'ground_0_00','precision': 0,'type': 6},{'expression': '\"ground-0.10\"','length': 0,'name': 'ground_0_10','precision': 0,'type': 6},{'expression': '\"ground-0.20\"','length': 0,'name': 'ground_0_20','precision': 0,'type': 6},{'expression': '\"ground-0.30\"','length': 0,'name': 'ground_0_30','precision': 0,'type': 6},{'expression': '\"ground-0.40\"','length': 0,'name': 'ground_0_40','precision': 0,'type': 6},{'expression': '\"ground-0.50\"','length': 0,'name': 'ground_0_50','precision': 0,'type': 6},{'expression': '\"roof-0.25\"','length': 0,'name': 'roof_0_25','precision': 0,'type': 6},{'expression': '\"rmse-0.25\"','length': 0,'name': 'rmse_0_25','precision': 0,'type': 6},{'expression': '\"roof-0.50\"','length': 0,'name': 'roof_0_50','precision': 0,'type': 6},{'expression': '\"rmse-0.50\"','length': 0,'name': 'rmse_0_50','precision': 0,'type': 6},{'expression': '\"roof-0.75\"','length': 0,'name': 'roof_0_75','precision': 0,'type': 6},{'expression': '\"rmse-0.75\"','length': 0,'name': 'rmse_0_75','precision': 0,'type': 6},{'expression': '\"roof-0.90\"','length': 0,'name': 'roof_0_90','precision': 0,'type': 6},{'expression': '\"rmse-0.90\"','length': 0,'name': 'rmse_0_90','precision': 0,'type': 6},{'expression': '\"roof-0.95\"','length': 0,'name': 'roof_0_95','precision': 0,'type': 6},{'expression': '\"rmse-0.95\"','length': 0,'name': 'rmse_0_95','precision': 0,'type': 6},{'expression': '\"roof-0.99\"','length': 0,'name': 'roof_0_99','precision': 0,'type': 6},{'expression': '\"rmse-0.99\"','length': 0,'name': 'rmse_0_99','precision': 0,'type': 6},{'expression': '\"roof_flat\"','length': 0,'name': 'roof_flat','precision': 0,'type': 10},{'expression': '\"nr_ground_pts\"','length': 0,'name': 'nr_ground_pts','precision': 0,'type': 2},{'expression': '\"nr_roof_pts\"','length': 0,'name': 'nr_roof_pts','precision': 0,'type': 2},{'expression': '\"ahn_file_date\"','length': 0,'name': 'ahn_file_date','precision': 0,'type': 16},{'expression': '\"ahn_version\"','length': 0,'name': 'ahn_version','precision': 0,'type': 2},{'expression': '\"height_valid\"','length': 0,'name': 'height_valid','precision': 0,'type': 10},{'expression': '\"tile_id\"','length': 0,'name': 'tile_id','precision': 0,'type': 10},{'expression': '\"pand_h_75\"','length': 0,'name': 'pand_h_75','precision': 0,'type': 6},{'expression': '\"bouwjaar_date\"','length': -1,'name': 'bouwjaar_date','precision': 0,'type': 14}],'OUTPUT':'TEMPORARY_OUTPUT'}) | 2,115.333333 | 3,939 | 0.679798 | 934 | 6,346 | 4.518201 | 0.191649 | 0.094787 | 0.132701 | 0.067536 | 0.472512 | 0.274408 | 0.179621 | 0.03981 | 0.01564 | 0 | 0 | 0.090715 | 0.039395 | 6,346 | 3 | 3,939 | 2,115.333333 | 0.601542 | 0 | 0 | 0 | 0 | 1 | 0.734048 | 0.284071 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
d0c21a24f09c6fa57bbbb5ea8bc831670710f235 | 113 | py | Python | mobula/glue/__init__.py | hustzxd/MobulaOP | 49e4062f6578b31918ddcc613e38e0fbb92bb015 | [
"MIT"
] | null | null | null | mobula/glue/__init__.py | hustzxd/MobulaOP | 49e4062f6578b31918ddcc613e38e0fbb92bb015 | [
"MIT"
] | null | null | null | mobula/glue/__init__.py | hustzxd/MobulaOP | 49e4062f6578b31918ddcc613e38e0fbb92bb015 | [
"MIT"
] | null | null | null | from . import backend
from .common import register, CUSTOM_OP_LIST
from . import common
common.backend = backend
| 22.6 | 44 | 0.80531 | 16 | 113 | 5.5625 | 0.5 | 0.224719 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.141593 | 113 | 4 | 45 | 28.25 | 0.917526 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0.75 | 0 | 0.75 | 0 | 1 | 0 | 0 | null | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
d0dccdcda5b3c340a9347de4563c54d4d53c2a89 | 52 | py | Python | test.py | renge080958/flask-2002 | a2df43666fa9d3158c8d9f597dc9b1210c7c21fa | [
"Apache-2.0"
] | null | null | null | test.py | renge080958/flask-2002 | a2df43666fa9d3158c8d9f597dc9b1210c7c21fa | [
"Apache-2.0"
] | null | null | null | test.py | renge080958/flask-2002 | a2df43666fa9d3158c8d9f597dc9b1210c7c21fa | [
"Apache-2.0"
] | null | null | null | class Person(object):
def haha():
pass | 13 | 21 | 0.538462 | 6 | 52 | 4.666667 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.346154 | 52 | 4 | 22 | 13 | 0.823529 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.333333 | true | 0.333333 | 0 | 0 | 0.666667 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 1 | 0 | 0 | 1 | 0 | 0 | 6 |
d0f93c6e96ef1c8441cd0a0982fa18535aac9419 | 4,434 | py | Python | abcdp/prob_flip.py | ParkLabML/ABCDP | a127cb43a7a045e24ad59b1e502574243ffc0d9e | [
"MIT"
] | 1 | 2021-09-08T09:06:15.000Z | 2021-09-08T09:06:15.000Z | abcdp/prob_flip.py | ParkLabML/ABCDP | a127cb43a7a045e24ad59b1e502574243ffc0d9e | [
"MIT"
] | null | null | null | abcdp/prob_flip.py | ParkLabML/ABCDP | a127cb43a7a045e24ad59b1e502574243ffc0d9e | [
"MIT"
] | null | null | null | # to plot the probability of flipping between ABC output and ABCDP output
import numpy as np
import matplotlib
import matplotlib.pyplot as plt
# font options
font = {
#'family' : 'normal',
#'weight' : 'bold',
'size' : 18
}
plt.rc('font', **font)
plt.rc('lines', linewidth=2)
matplotlib.rcParams['pdf.fonttype'] = 42
matplotlib.rcParams['ps.fonttype'] = 42
def prob_flip(rho, eps_abc, b):
if rho-eps_abc>0:
tmp = - (rho-eps_abc)/b
else:
tmp = (rho-eps_abc)/b
prob = 1/6*(4*np.exp(tmp/2) - np.exp(tmp))
return prob
def b_func(c, sensitivity, eps_tot):
return 2*c*sensitivity/eps_tot
#####################################################################
n = 10
sensitivity = 1/n
rho_samps = np.random.uniform(0,1,size=100)
eps_abc = 0.2
eps_tot_mat = [0.01, 0.1, 0.5, 1, 5, 10, 50, 100]
c_mat = [10, 100, 1000]
prob = np.zeros((len(rho_samps), len(eps_tot_mat), len(c_mat)))
for i in np.arange(0,len(rho_samps)):
rho = rho_samps[i]
for j in np.arange(0, len(eps_tot_mat)):
eps_tot = eps_tot_mat[j]
for k in np.arange(0, len(c_mat)):
c = c_mat[k]
b = b_func(c,sensitivity,eps_tot)
prob[i,j,k] = prob_flip(rho, eps_abc, b)
plt.figure(1)
plt.subplot(311)
plt.title('flipping probability (c=10)')
plt.boxplot([prob[:,0,0], prob[:,1,0], prob[:,2,0], prob[:,3,0], prob[:,4,0], prob[:,5,0], prob[:,6,0], prob[:,7,0]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
# plt.ylim(0, 0.6)
plt.subplot(312)
plt.title('(c=100)')
plt.boxplot([prob[:,0,1], prob[:,1,1], prob[:,2,1], prob[:,3,1], prob[:,4,1], prob[:,5,1], prob[:,6,1], prob[:,7,1]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
# plt.ylim(0, 0.6)
plt.subplot(313)
plt.title('(c=1000)')
plt.boxplot([prob[:,0,2], prob[:,1,2], prob[:,2,2], prob[:,3,2], prob[:,4,2], prob[:,5,2], prob[:,6,2], prob[:,7,2]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
plt.xlabel('total epsilons')
# plt.ylim(0, 0.6)
#####################################################################
n = 100
sensitivity = 1/n
prob = np.zeros((len(rho_samps), len(eps_tot_mat), len(c_mat)))
for i in np.arange(0,len(rho_samps)):
rho = rho_samps[i]
for j in np.arange(0, len(eps_tot_mat)):
eps_tot = eps_tot_mat[j]
for k in np.arange(0, len(c_mat)):
c = c_mat[k]
b = b_func(c,sensitivity,eps_tot)
prob[i,j,k] = prob_flip(rho, eps_abc, b)
plt.figure(2)
plt.subplot(311)
plt.title('flipping probability (c=10)')
plt.boxplot([prob[:,0,0], prob[:,1,0], prob[:,2,0], prob[:,3,0], prob[:,4,0], prob[:,5,0], prob[:,6,0], prob[:,7,0]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
# plt.ylim(0, 0.6)
plt.subplot(312)
plt.title('(c=100)')
plt.boxplot([prob[:,0,1], prob[:,1,1], prob[:,2,1], prob[:,3,1], prob[:,4,1], prob[:,5,1], prob[:,6,1], prob[:,7,1]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
# plt.ylim(0, 0.6)
plt.subplot(313)
plt.title('(c=1000)')
plt.boxplot([prob[:,0,2], prob[:,1,2], prob[:,2,2], prob[:,3,2], prob[:,4,2], prob[:,5,2], prob[:,6,2], prob[:,7,2]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
plt.xlabel('total epsilons')
# plt.ylim(0, 0.6)
#####################################################################
n = 1000
sensitivity = 1/n
prob = np.zeros((len(rho_samps), len(eps_tot_mat), len(c_mat)))
for i in np.arange(0,len(rho_samps)):
rho = rho_samps[i]
for j in np.arange(0, len(eps_tot_mat)):
eps_tot = eps_tot_mat[j]
for k in np.arange(0, len(c_mat)):
c = c_mat[k]
b = b_func(c,sensitivity,eps_tot)
prob[i,j,k] = prob_flip(rho, eps_abc, b)
plt.figure(3)
plt.subplot(311)
plt.title('flipping probability (c=10)')
plt.boxplot([prob[:,0,0], prob[:,1,0], prob[:,2,0], prob[:,3,0], prob[:,4,0], prob[:,5,0], prob[:,6,0], prob[:,7,0]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
# plt.ylim(0, 0.6)
plt.subplot(312)
plt.title('(c=100)')
plt.boxplot([prob[:,0,1], prob[:,1,1], prob[:,2,1], prob[:,3,1], prob[:,4,1], prob[:,5,1], prob[:,6,1], prob[:,7,1]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
# plt.ylim(0, 0.6)
plt.subplot(313)
plt.title('(c=1000)')
plt.boxplot([prob[:,0,2], prob[:,1,2], prob[:,2,2], prob[:,3,2], prob[:,4,2], prob[:,5,2], prob[:,6,2], prob[:,7,2]])
plt.xticks([1, 2, 3, 4, 5, 6, 7, 8], eps_tot_mat)
plt.xlabel('total epsilons')
# plt.ylim(0, 0.6)
plt.show() | 27.7125 | 117 | 0.550744 | 851 | 4,434 | 2.773208 | 0.104583 | 0.068644 | 0.072458 | 0.041949 | 0.811864 | 0.800847 | 0.782203 | 0.782203 | 0.782203 | 0.782203 | 0 | 0.098414 | 0.161254 | 4,434 | 160 | 118 | 27.7125 | 0.536166 | 0.062021 | 0 | 0.69697 | 0 | 0 | 0.05179 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.020202 | false | 0 | 0.030303 | 0.010101 | 0.070707 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
ef84fc3383041517fbe4b33a286b1256ef92fedf | 11,372 | py | Python | selfservice-api/tests/api/test_api_project.py | bcgov/BCSC-BPS | 3bfe09c100a0f5b98d61228324336d5f45ad93ad | [
"Apache-2.0"
] | 2 | 2020-07-03T18:18:34.000Z | 2021-03-08T10:25:50.000Z | selfservice-api/tests/api/test_api_project.py | bcgov/BCSC-BPS | 3bfe09c100a0f5b98d61228324336d5f45ad93ad | [
"Apache-2.0"
] | 312 | 2020-01-10T23:00:08.000Z | 2022-03-29T22:07:00.000Z | selfservice-api/tests/api/test_api_project.py | bcgov/BCSC-BPS | 3bfe09c100a0f5b98d61228324336d5f45ad93ad | [
"Apache-2.0"
] | 2 | 2020-03-26T05:10:20.000Z | 2021-02-05T19:22:56.000Z | # Copyright © 2019 Province of British Columbia
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at
#
# http://www.apache.org/licenses/LICENSE-2.0
#
# Unless required by applicable law or agreed to in writing, software
# distributed under the License is distributed on an "AS IS" BASIS,
# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
# See the License for the specific language governing permissions and
# limitations under the License.
"""Tests to assure the API endpoints for managing a project info resource is working as expected."""
import json
from http import HTTPStatus
from ..helper.api_create_data import (PROJECTINFO_API, # noqa: I001
_create_admin_user_, _create_project_, _get_project_, # noqa: I001
_get_all_project_, _update_technical_req_with_test_account_, # noqa: I001
create_project, create_technical_req_with_additional, create_user, # noqa: I001
get_project) # noqa: I001
from ..helper.auth import ss_admin_auth_header, ss_client_auth_header
from selfservice_api.models.enums import ProjectRoles, ProjectStatus
def test_post_project_as_analyst(client, jwt, session):
"""Assert that the endpoint returns the success status."""
response = _create_project_(client, jwt, None, is_analyst=True)
assert response.status_code == HTTPStatus.CREATED
def test_post_project_as_developer(client, jwt, session):
"""Assert that the endpoint returns the success status."""
create_user(client, jwt, project_role='manager')
response = _create_project_(client, jwt, ProjectRoles.Developer)
assert response.status_code == HTTPStatus.CREATED
def test_post_project_as_manager(client, jwt, session):
"""Assert that the endpoint returns the success status."""
create_user(client, jwt, project_role='cto')
response = _create_project_(client, jwt, ProjectRoles.Manager)
assert response.status_code == HTTPStatus.CREATED
def test_post_project_as_cto(client, jwt, session):
"""Assert that the endpoint returns the success status."""
create_user(client, jwt, project_role='developer')
response = _create_project_(client, jwt, ProjectRoles.Cto)
assert response.status_code == HTTPStatus.CREATED
def test_post_project_validation(client, jwt, session):
"""Assert that the endpoint returns the failure status."""
create_user(client, jwt)
headers = ss_client_auth_header(jwt)
req_data = {}
response = client.post(PROJECTINFO_API, data=json.dumps(req_data),
headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.BAD_REQUEST
def test_get_all_project(client, jwt, session):
"""Assert that the endpoint returns the success status."""
response = _get_all_project_(client, jwt)
assert response.status_code == HTTPStatus.OK
def test_get_all_project_analyst(client, jwt, session):
"""Assert that the endpoint returns the success status."""
_create_admin_user_(client, jwt)
response = _get_all_project_(client, jwt, True)
assert response.status_code == HTTPStatus.OK
def test_get_project(client, jwt, session):
"""Assert that the endpoint returns the success status."""
response = _get_project_(client, jwt)
assert response.status_code == HTTPStatus.OK
response = _get_project_(client, jwt, is_analyst=True)
assert response.status_code == HTTPStatus.OK
def test_delete_project(client, jwt, session):
"""Assert that the endpoint returns the success status."""
# Delete as admin
headers = ss_admin_auth_header(jwt)
project = get_project(client, jwt)
response = client.delete(PROJECTINFO_API + '/' + str(project['id']),
headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
# Delete as client
project = get_project(client, jwt)
response = client.delete(PROJECTINFO_API + '/' + str(project['id']),
headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
headers = ss_client_auth_header(jwt)
technical_req = create_technical_req_with_additional(client, jwt)
req_data = {'update': 'status', 'status': ProjectStatus.Dev}
project_id = str(technical_req['projectId'])
response = client.patch(PROJECTINFO_API + '/' + project_id,
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
req_data = {'update': 'status', 'status': ProjectStatus.DevComplete}
response = client.patch(PROJECTINFO_API + '/' + project_id,
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
response = client.delete(PROJECTINFO_API + '/' + project_id,
headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.BAD_REQUEST
def test_put_project(client, jwt, session):
"""Assert that the endpoint returns the success status."""
headers = ss_client_auth_header(jwt)
project = get_project(client, jwt)
response = client.put(PROJECTINFO_API + '/' + str(project['id']),
data=json.dumps(project), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
def test_put_project_validation(client, jwt, session):
"""Assert that the endpoint returns the failure status."""
headers = ss_client_auth_header(jwt)
project = get_project(client, jwt)
req_data = {}
response = client.put(PROJECTINFO_API + '/' + str(project['id']), data=json.dumps(req_data),
headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.BAD_REQUEST
def test_patch_project_status(client, jwt, session):
"""Assert that the endpoint returns the success status."""
headers = ss_client_auth_header(jwt)
technical_req = create_technical_req_with_additional(client, jwt)
req_data = {'update': 'status', 'status': ProjectStatus.Dev}
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
# check the update condition on test account
_update_technical_req_with_test_account_(client, jwt, str(technical_req['projectId']), 2)
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
_update_technical_req_with_test_account_(client, jwt, str(technical_req['projectId']), 5)
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
_update_technical_req_with_test_account_(client, jwt, str(technical_req['projectId']), 0)
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
req_data = {'update': 'status', 'status': ProjectStatus.DevComplete}
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
def test_patch_project_status_validation(client, jwt, session):
"""Assert that the endpoint returns the failure status."""
headers = ss_client_auth_header(jwt)
create_user(client, jwt)
req_data = {}
technical_req = create_technical_req_with_additional(client, jwt)
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.BAD_REQUEST
req_data = {'update': ''}
technical_req = create_technical_req_with_additional(client, jwt)
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.BAD_REQUEST
req_data = {'update': 'status'}
technical_req = create_technical_req_with_additional(client, jwt)
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.BAD_REQUEST
req_data = {'update': 'status', 'status': ProjectStatus.Dev}
project = create_project(client, jwt)
response = client.patch(PROJECTINFO_API + '/' + str(project['id']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.BAD_REQUEST
def test_patch_project_status_oidc_and_test_account(client, jwt, session, config):
"""Assert that the endpoint returns the failure status."""
headers = ss_client_auth_header(jwt)
technical_req = create_technical_req_with_additional(client, jwt)
# Dynamic OIDC None response: Start
config['dynamic_api_return_none'] = True
req_data = {'update': 'status', 'status': ProjectStatus.Dev}
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.INTERNAL_SERVER_ERROR
# call again to cover update api call
config.pop('dynamic_api_return_none')
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
config['dynamic_api_return_none'] = True
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.INTERNAL_SERVER_ERROR
config.pop('dynamic_api_return_none')
# Dynamic OIDC None response: End
config['LIMITED_TEST_ACCOUNT_TRIGGER_COUNT'] = 200
req_data = {'update': 'status', 'status': ProjectStatus.Dev}
response = client.patch(PROJECTINFO_API + '/' + str(technical_req['projectId']),
data=json.dumps(req_data), headers=headers, content_type='application/json')
assert response.status_code == HTTPStatus.OK
| 44.249027 | 116 | 0.699877 | 1,371 | 11,372 | 5.547775 | 0.118162 | 0.049698 | 0.076256 | 0.091507 | 0.833684 | 0.806469 | 0.76203 | 0.759926 | 0.74862 | 0.720878 | 0 | 0.003161 | 0.193282 | 11,372 | 256 | 117 | 44.421875 | 0.825812 | 0.144038 | 0 | 0.662162 | 0 | 0 | 0.082927 | 0.013077 | 0 | 0 | 0 | 0 | 0.195946 | 1 | 0.094595 | false | 0 | 0.033784 | 0 | 0.128378 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
efe7304f31d16d8ce1472c10b957c68ce3594137 | 145 | py | Python | config/config.py | neogeo/FirestoreLambdas | 1ecb807cd41538fcbd1e32631e06a5040d5eb725 | [
"MIT"
] | 2 | 2020-11-21T14:26:49.000Z | 2020-12-30T12:16:36.000Z | config/config.py | neogeo/firestore-lambdas | 1ecb807cd41538fcbd1e32631e06a5040d5eb725 | [
"MIT"
] | null | null | null | config/config.py | neogeo/firestore-lambdas | 1ecb807cd41538fcbd1e32631e06a5040d5eb725 | [
"MIT"
] | null | null | null |
# Firebase settings
# path to private key json file
FIRESTORE_SERVICE_ACCOUNT_PRIVATE_KEY = 'config/firestore_service_account_private_key.json'
| 29 | 91 | 0.855172 | 20 | 145 | 5.8 | 0.6 | 0.258621 | 0.241379 | 0.517241 | 0.568966 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.096552 | 145 | 4 | 92 | 36.25 | 0.885496 | 0.324138 | 0 | 0 | 0 | 0 | 0.521277 | 0.521277 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | false | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | null | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
ef19b8c1fda9ef091267c457dce759a551b4cc3b | 22 | py | Python | test_6.py | lianggk2018/Git_test | eed9c3d274c3d51f321c25ad03c32a3f8d3556e5 | [
"MIT"
] | null | null | null | test_6.py | lianggk2018/Git_test | eed9c3d274c3d51f321c25ad03c32a3f8d3556e5 | [
"MIT"
] | null | null | null | test_6.py | lianggk2018/Git_test | eed9c3d274c3d51f321c25ad03c32a3f8d3556e5 | [
"MIT"
] | null | null | null | 1
2
3
45
6
s
adwadwad
| 2.75 | 8 | 0.681818 | 7 | 22 | 2.142857 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.4 | 0.318182 | 22 | 7 | 9 | 3.142857 | 0.6 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 0 | 0 | 0 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
ef507cf744ec08fa4c375edacf515f99a712c801 | 23 | py | Python | whatsapp/__init__.py | DefCon-007/py-whatsapp | fc4db51136fb8331fa1077968ca9ecc2c60b6c8b | [
"MIT"
] | 2 | 2021-05-02T14:35:07.000Z | 2021-06-08T03:40:53.000Z | whatsapp/__init__.py | DefCon-007/py-whatsapp | fc4db51136fb8331fa1077968ca9ecc2c60b6c8b | [
"MIT"
] | null | null | null | whatsapp/__init__.py | DefCon-007/py-whatsapp | fc4db51136fb8331fa1077968ca9ecc2c60b6c8b | [
"MIT"
] | null | null | null | from .whatsapp import * | 23 | 23 | 0.782609 | 3 | 23 | 6 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.130435 | 23 | 1 | 23 | 23 | 0.9 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
323c5cb2493e1057e0b3ce180a384d8ee50a6091 | 34 | py | Python | utils/__init__.py | elviswf/pytorch_cv | a7f11f857a0c1d5e5a807aeed5e594659212fba0 | [
"Apache-2.0"
] | 29 | 2018-05-24T12:47:23.000Z | 2021-12-31T02:05:27.000Z | tools/__init__.py | mxguo/DriverPostureClassification | 44b22e98e8952f9846db73177874de5c332e5cf5 | [
"MIT"
] | null | null | null | tools/__init__.py | mxguo/DriverPostureClassification | 44b22e98e8952f9846db73177874de5c332e5cf5 | [
"MIT"
] | 9 | 2018-05-24T13:39:42.000Z | 2020-10-23T08:29:01.000Z | from .visualize import Visualizer
| 17 | 33 | 0.852941 | 4 | 34 | 7.25 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.117647 | 34 | 1 | 34 | 34 | 0.966667 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
323f12801fa0350971df6f895e04f14b2bd07e14 | 5,699 | py | Python | test/test_cam_v2.py | dondemonz/RestApi | 0459d2b8079b9f2abc50bf5e206625427c4a2dcf | [
"Apache-2.0"
] | null | null | null | test/test_cam_v2.py | dondemonz/RestApi | 0459d2b8079b9f2abc50bf5e206625427c4a2dcf | [
"Apache-2.0"
] | null | null | null | test/test_cam_v2.py | dondemonz/RestApi | 0459d2b8079b9f2abc50bf5e206625427c4a2dcf | [
"Apache-2.0"
] | null | null | null | import requests
from model.json_check import *
from model.input_data import *
# Запрос на получение настроек всех объектов CAM
def test_GetV2AllCamerasCode200():
data = "success"
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/", auth=auth)
user_resp_code = "200"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["status"]
assert data == n
def test_GetV2AllCamerasStatusCode401():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/", auth=("", ""))
user_resp_code = "401"
assert str(response.status_code) == user_resp_code
# Запрос на получение настроек объекта CAM
def test_GetV2CamerasByIdCode200():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId, auth=auth)
user_resp_code = "200"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["data"]["id"]
assert camId == n
def test_GetV2CamerasByIdCode401():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId, auth=("", ""))
user_resp_code = "401"
assert str(response.status_code) == user_resp_code
def test_GetV2CamerasByIdCode404():
data = "Unknown CAM id:0"
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/0", auth=auth)
user_resp_code = "404"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["message"]
assert data == n
#Запрос на получение поля status объекта CAM
def test_GetV2CameraStatusCode200():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/status", auth=auth)
user_resp_code = "200"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["data"]["id"]
assert camId == n
def test_GetV2CameraStatusCode401():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/status", auth=("", ""))
user_resp_code = "401"
assert str(response.status_code) == user_resp_code
def test_GetV2CameraStatusCode404():
data = "Unknown CAM id:0"
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/0/status", auth=auth)
user_resp_code = "404"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["message"]
assert data == n
# Запрос на получение поля rtsp объекта CAM
def test_GetV2CameraRtspCode200():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/rtsp", auth=auth)
user_resp_code = "200"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["data"]["id"]
assert camId == n
def test_GetV2CameraRtspCode401():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/rtsp", auth=("", ""))
user_resp_code = "401"
assert str(response.status_code) == user_resp_code
def test_GetV2CameraRtspCode404():
data = "Unknown CAM id:0"
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/0/rtsp", auth=auth)
user_resp_code = "404"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["message"]
assert data == n
# Запрос на получение поля rtsp/live объекта CAM
def test_GetV2CameraRtspLiveCode200():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/rtsp/live", auth=auth)
user_resp_code = "200"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["data"]["id"]
assert camId == n
def test_GetV2CameraRtspLiveCode401():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/rtsp/live", auth=("", ""))
user_resp_code = "401"
assert str(response.status_code) == user_resp_code
def test_GetV2CameraRtspLiveCode404():
data = "Unknown CAM id:0"
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/0/rtsp/live", auth=auth)
user_resp_code = "404"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["message"]
assert data == n
# Запрос на получение поля rtsp/archive объекта CAM
def test_GetV2CameraRtspArchiveCode200():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/rtsp/archive", auth=auth)
user_resp_code = "200"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["data"]["id"]
assert camId == n
def test_GetV2CameraRtspArchiveCode401():
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/"+camId+"/rtsp/archive", auth=("", ""))
user_resp_code = "401"
assert str(response.status_code) == user_resp_code
def test_GetV2CameraRtspArchiveCode404():
data = "Unknown CAM id:0"
response = requests.get(url="http://"+slave_ip+":"+restPort+"/api/v2/cameras/0/rtsp/archive", auth=auth)
user_resp_code = "404"
assert str(response.status_code) == user_resp_code
body = json.dumps(response.json())
data1 = json.loads(body)
n = data1["message"]
assert data == n
| 37.248366 | 120 | 0.676785 | 755 | 5,699 | 4.948344 | 0.092715 | 0.072805 | 0.109208 | 0.100107 | 0.814507 | 0.814507 | 0.812902 | 0.809957 | 0.809957 | 0.809957 | 0 | 0.034884 | 0.154939 | 5,699 | 152 | 121 | 37.493421 | 0.740864 | 0.047201 | 0 | 0.677686 | 0 | 0 | 0.134059 | 0.018993 | 0 | 0 | 0 | 0 | 0.231405 | 1 | 0.140496 | false | 0 | 0.024793 | 0 | 0.165289 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
324cd3b00266bda78e31d877322346bfee9bd5c1 | 169 | py | Python | lunchbox/views.py | tot0rokr/MyWeb | 18eea4fc02abcf7a28271904507c39d617036668 | [
"MIT"
] | null | null | null | lunchbox/views.py | tot0rokr/MyWeb | 18eea4fc02abcf7a28271904507c39d617036668 | [
"MIT"
] | null | null | null | lunchbox/views.py | tot0rokr/MyWeb | 18eea4fc02abcf7a28271904507c39d617036668 | [
"MIT"
] | null | null | null | from django.shortcuts import render
from django.http import HttpResponse
def index(request):
return HttpResponse("Lunch Box Application")
# Create your views here. | 24.142857 | 48 | 0.792899 | 22 | 169 | 6.090909 | 0.818182 | 0.149254 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.142012 | 169 | 7 | 49 | 24.142857 | 0.924138 | 0.136095 | 0 | 0 | 0 | 0 | 0.144828 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0.25 | false | 0 | 0.5 | 0.25 | 1 | 0 | 1 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 1 | 1 | 1 | 0 | 0 | 6 |
3277534f467165308c621cb0742e2d76f00db7b8 | 5,768 | py | Python | z2/part2/interactive/jm/random_normal_1/305084984.py | kozakusek/ipp-2020-testy | 09aa008fa53d159672cc7cbf969a6b237e15a7b8 | [
"MIT"
] | 1 | 2020-04-16T12:13:47.000Z | 2020-04-16T12:13:47.000Z | z2/part2/interactive/jm/random_normal_1/305084984.py | kozakusek/ipp-2020-testy | 09aa008fa53d159672cc7cbf969a6b237e15a7b8 | [
"MIT"
] | 18 | 2020-03-06T17:50:15.000Z | 2020-05-19T14:58:30.000Z | z2/part2/interactive/jm/random_normal_1/305084984.py | kozakusek/ipp-2020-testy | 09aa008fa53d159672cc7cbf969a6b237e15a7b8 | [
"MIT"
] | 18 | 2020-03-06T17:45:13.000Z | 2020-06-09T19:18:31.000Z | from part1 import (
gamma_board,
gamma_busy_fields,
gamma_delete,
gamma_free_fields,
gamma_golden_move,
gamma_golden_possible,
gamma_move,
gamma_new,
)
"""
scenario: test_random_actions
uuid: 305084984
"""
"""
random actions, total chaos
"""
board = gamma_new(5, 7, 6, 4)
assert board is not None
assert gamma_move(board, 1, 3, 4) == 1
assert gamma_move(board, 2, 0, 4) == 1
assert gamma_move(board, 2, 4, 5) == 1
assert gamma_move(board, 5, 0, 0) == 1
assert gamma_move(board, 6, 4, 6) == 1
assert gamma_move(board, 1, 0, 4) == 0
assert gamma_move(board, 1, 2, 5) == 1
assert gamma_move(board, 2, 4, 1) == 1
assert gamma_move(board, 2, 3, 2) == 1
assert gamma_move(board, 3, 1, 1) == 1
assert gamma_move(board, 4, 0, 4) == 0
assert gamma_move(board, 5, 4, 3) == 1
assert gamma_move(board, 6, 4, 4) == 1
assert gamma_move(board, 6, 3, 3) == 1
assert gamma_golden_possible(board, 6) == 1
assert gamma_move(board, 1, 2, 4) == 1
assert gamma_move(board, 1, 3, 4) == 0
assert gamma_move(board, 2, 6, 1) == 0
assert gamma_move(board, 3, 5, 1) == 0
assert gamma_move(board, 3, 2, 4) == 0
assert gamma_free_fields(board, 3) == 22
assert gamma_golden_possible(board, 3) == 1
assert gamma_move(board, 4, 2, 0) == 1
assert gamma_free_fields(board, 4) == 21
assert gamma_move(board, 5, 1, 6) == 1
assert gamma_move(board, 6, 0, 1) == 1
assert gamma_busy_fields(board, 6) == 4
assert gamma_move(board, 1, 2, 2) == 1
assert gamma_busy_fields(board, 1) == 4
assert gamma_busy_fields(board, 2) == 4
assert gamma_move(board, 3, 6, 3) == 0
assert gamma_busy_fields(board, 3) == 1
assert gamma_move(board, 4, 5, 0) == 0
assert gamma_move(board, 5, 0, 4) == 0
assert gamma_move(board, 6, 0, 3) == 0
board554887423 = gamma_board(board)
assert board554887423 is not None
assert board554887423 == (".5..6\n"
"..1.2\n"
"2.116\n"
"...65\n"
"..12.\n"
"63..2\n"
"5.4..\n")
del board554887423
board554887423 = None
assert gamma_move(board, 1, 4, 2) == 1
assert gamma_move(board, 2, 0, 3) == 1
assert gamma_move(board, 2, 1, 5) == 0
assert gamma_move(board, 3, 6, 3) == 0
assert gamma_move(board, 4, 3, 6) == 1
assert gamma_busy_fields(board, 4) == 2
assert gamma_free_fields(board, 4) == 15
assert gamma_move(board, 5, 0, 5) == 1
assert gamma_move(board, 6, 0, 4) == 0
assert gamma_golden_possible(board, 6) == 1
assert gamma_move(board, 1, 3, 3) == 0
assert gamma_move(board, 1, 4, 0) == 1
assert gamma_move(board, 3, 0, 3) == 0
assert gamma_move(board, 3, 2, 0) == 0
assert gamma_move(board, 4, 0, 0) == 0
assert gamma_move(board, 4, 4, 2) == 0
assert gamma_move(board, 5, 6, 2) == 0
assert gamma_move(board, 5, 1, 5) == 1
assert gamma_move(board, 6, 3, 0) == 0
assert gamma_move(board, 6, 4, 2) == 0
assert gamma_move(board, 1, 0, 3) == 0
assert gamma_move(board, 1, 3, 3) == 0
assert gamma_move(board, 2, 6, 0) == 0
assert gamma_move(board, 2, 1, 3) == 1
assert gamma_move(board, 3, 5, 3) == 0
assert gamma_move(board, 3, 3, 2) == 0
assert gamma_golden_possible(board, 3) == 1
assert gamma_move(board, 4, 1, 2) == 1
assert gamma_move(board, 4, 2, 1) == 1
assert gamma_busy_fields(board, 4) == 4
assert gamma_move(board, 5, 2, 0) == 0
assert gamma_move(board, 5, 1, 6) == 0
assert gamma_golden_possible(board, 5) == 1
assert gamma_move(board, 6, 0, 0) == 0
assert gamma_move(board, 1, 4, 1) == 0
assert gamma_move(board, 2, 3, 3) == 0
assert gamma_move(board, 3, 5, 3) == 0
assert gamma_move(board, 4, 6, 2) == 0
assert gamma_move(board, 4, 2, 5) == 0
assert gamma_move(board, 5, 6, 2) == 0
assert gamma_move(board, 6, 5, 3) == 0
assert gamma_move(board, 6, 3, 5) == 0
assert gamma_move(board, 1, 4, 1) == 0
assert gamma_golden_move(board, 2, 1, 0) == 0
assert gamma_move(board, 3, 0, 5) == 0
assert gamma_move(board, 4, 0, 1) == 0
assert gamma_move(board, 4, 4, 3) == 0
assert gamma_free_fields(board, 4) == 9
assert gamma_move(board, 5, 1, 3) == 0
assert gamma_move(board, 6, 6, 0) == 0
assert gamma_move(board, 6, 4, 3) == 0
assert gamma_move(board, 1, 0, 5) == 0
assert gamma_busy_fields(board, 1) == 6
board374933349 = gamma_board(board)
assert board374933349 is not None
assert board374933349 == (".5.46\n"
"551.2\n"
"2.116\n"
"22.65\n"
".4121\n"
"634.2\n"
"5.4.1\n")
del board374933349
board374933349 = None
assert gamma_move(board, 2, 1, 6) == 0
assert gamma_move(board, 2, 2, 0) == 0
assert gamma_move(board, 3, 5, 3) == 0
assert gamma_move(board, 3, 1, 5) == 0
assert gamma_golden_possible(board, 3) == 1
assert gamma_move(board, 4, 1, 3) == 0
assert gamma_move(board, 4, 2, 4) == 0
assert gamma_move(board, 5, 2, 0) == 0
board729753162 = gamma_board(board)
assert board729753162 is not None
assert board729753162 == (".5.46\n"
"551.2\n"
"2.116\n"
"22.65\n"
".4121\n"
"634.2\n"
"5.4.1\n")
del board729753162
board729753162 = None
assert gamma_move(board, 6, 0, 3) == 0
assert gamma_move(board, 1, 4, 1) == 0
assert gamma_free_fields(board, 1) == 5
assert gamma_golden_possible(board, 1) == 1
assert gamma_move(board, 2, 4, 1) == 0
assert gamma_move(board, 2, 4, 5) == 0
assert gamma_move(board, 3, 1, 3) == 0
assert gamma_move(board, 4, 1, 1) == 0
assert gamma_move(board, 4, 2, 6) == 1
assert gamma_move(board, 5, 4, 1) == 0
assert gamma_move(board, 5, 2, 2) == 0
assert gamma_move(board, 6, 0, 1) == 0
assert gamma_move(board, 6, 1, 6) == 0
assert gamma_free_fields(board, 6) == 2
assert gamma_move(board, 1, 0, 3) == 0
assert gamma_move(board, 1, 1, 3) == 0
assert gamma_golden_possible(board, 1) == 1
assert gamma_move(board, 2, 2, 0) == 0
assert gamma_free_fields(board, 2) == 5
assert gamma_move(board, 3, 0, 5) == 0
assert gamma_move(board, 4, 6, 0) == 0
assert gamma_move(board, 4, 0, 2) == 1
gamma_delete(board)
| 31.519126 | 46 | 0.655513 | 1,077 | 5,768 | 3.362117 | 0.046425 | 0.358465 | 0.393538 | 0.524717 | 0.83071 | 0.815797 | 0.665562 | 0.410936 | 0.30765 | 0.30765 | 0 | 0.137529 | 0.181865 | 5,768 | 182 | 47 | 31.692308 | 0.629794 | 0 | 0 | 0.256098 | 0 | 0 | 0.02588 | 0 | 0 | 0 | 0 | 0 | 0.762195 | 1 | 0 | false | 0 | 0.006098 | 0 | 0.006098 | 0 | 0 | 0 | 0 | null | 1 | 1 | 1 | 1 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 6 |
32bbd3aef73ad91f44e9c8a66532947d5e5698af | 28 | py | Python | regal/pnr/__init__.py | psurply/ReGAL | b0634a64b141ed34969d8e3c54073da2904bb345 | [
"MIT"
] | 43 | 2018-06-03T12:40:43.000Z | 2022-01-31T07:55:54.000Z | regal/pnr/__init__.py | psurply/ReGAL | b0634a64b141ed34969d8e3c54073da2904bb345 | [
"MIT"
] | 4 | 2019-12-26T10:01:21.000Z | 2020-08-17T02:56:20.000Z | regal/pnr/__init__.py | psurply/ReGAL | b0634a64b141ed34969d8e3c54073da2904bb345 | [
"MIT"
] | 5 | 2021-05-27T00:26:11.000Z | 2022-01-01T12:25:12.000Z | from regal.pnr.pnr import *
| 14 | 27 | 0.75 | 5 | 28 | 4.2 | 0.8 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0.142857 | 28 | 1 | 28 | 28 | 0.875 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | true | 0 | 1 | 0 | 1 | 0 | 1 | 1 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | null | 0 | 0 | 0 | 0 | 0 | 0 | 1 | 0 | 1 | 0 | 1 | 0 | 0 | 6 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.