xszheng2020/the_stack_dedup_python_hits_7 · Datasets at Hugging Face

957d13445558ff15b8bc5d86f2288d452fe80cad

103

py

Python

tethys_data_models/__init__.py

tethys-ts/tethys-data-models

2b051c71eeed8493c0f160f369884bd069437f67

[ "Apache-2.0" ]

null

tethys_data_models/__init__.py

tethys-ts/tethys-data-models

2b051c71eeed8493c0f160f369884bd069437f67

[ "Apache-2.0" ]

null

tethys_data_models/__init__.py

tethys-ts/tethys-data-models

2b051c71eeed8493c0f160f369884bd069437f67

[ "Apache-2.0" ]

null

from tethys_data_models import permit, dataset, base from tethys_data_models.utils import key_patterns

34.333333

52

0.873786

16

103

5.3125

0.6875

0.235294

0.329412

0.470588

0

0.097087

103

2

53

51.5

0.913978

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

8

95f565bbe3416e15371eb10ee9503573f63688fd

166

py

Python

kombu_stomp/utils.py

sp4x/kombu-stomp

1d821d19cf0e303e5f6bc873b753b11a58d4c2ec

[ "BSD-3-Clause" ]

null

kombu_stomp/utils.py

sp4x/kombu-stomp

1d821d19cf0e303e5f6bc873b753b11a58d4c2ec

[ "BSD-3-Clause" ]

null

kombu_stomp/utils.py

sp4x/kombu-stomp

1d821d19cf0e303e5f6bc873b753b11a58d4c2ec

[ "BSD-3-Clause" ]

1

2021-10-05T07:59:52.000Z

try: import unittest2 as unittest except ImportError: import unittest # noqa try: from unittest import mock except ImportError: import mock # noqa

16.6

32

0.716867

20

166

5.95

0.5

0.285714

0.386555

0

0.008

0.246988

166

9

33

18.444444

0.944

0.054217

0

0.5

0

1

0

true

0

0.75

0

0.75

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

25028770fe7d3062da0e3d81b0a925c45b4d550d

11,612

py

Python

tests/endpoints/test_event_definition_endpoint.py

zconnect-iot/zconnect-django

5c569f54f100e23d72e2ac4de795739ea461a431

[ "MIT" ]

2

2018-08-19T16:16:39.000Z

2019-06-11T02:23:50.000Z

tests/endpoints/test_event_definition_endpoint.py

zconnect-iot/zconnect-django

5c569f54f100e23d72e2ac4de795739ea461a431

[ "MIT" ]

2

2018-07-05T09:51:54.000Z

2018-07-06T13:12:04.000Z

tests/endpoints/test_event_definition_endpoint.py

zconnect-iot/zconnect-django

5c569f54f100e23d72e2ac4de795739ea461a431

[ "MIT" ]

null

import pytest from zconnect.models import EventDefinition from zconnect.serializers import EventDefinitionSerializer from zconnect.testutils.factories import ( DeviceEventDefinitionFactory, DeviceFactory, OrganizationFactory) from zconnect.testutils.helpers import expect_detail, expect_list, expect_model from zconnect.testutils.util import assert_successful_edit class TestEventDefinitionEndpoint: route = "/api/v3/devices/{device_id}/event_defs/{event_def_id}/" def test_get_no_auth(self, testclient, fake_device_event_definition): exp = expect_detail(401,"Authentication credentials were not provided.") pp = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } testclient.get_request_test_helper(exp, path_params=pp) @pytest.mark.usefixtures("joeseed_login") def test_get_authenticated(self, testclient, fake_device_event_definition): expected = expect_model(200, fake_device_event_definition, serializer=EventDefinitionSerializer) pp = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } testclient.get_request_test_helper(expected, path_params=pp) @pytest.mark.usefixtures("joeseed_login") def test_get_deleted(self, testclient, fake_device_event_definition): fake_device_event_definition.deleted = True fake_device_event_definition.save() expected = expect_detail(404, "Not found.") pp = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } testclient.get_request_test_helper(expected, path_params=pp) # Make sure it's still there, just marked as deleted event_defs = EventDefinition.objects.all() assert event_defs assert event_defs[0].deleted == True @pytest.mark.usefixtures("fredbloggs_login") def test_get_wrong_user(self, testclient, fake_device_event_definition): expected = expect_detail(404, "Not found.") pp = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } testclient.get_request_test_helper(expected, path_params=pp) @pytest.mark.usefixtures("admin_login") def test_get_admin(self, testclient, fake_device_event_definition): expected = expect_model(200, fake_device_event_definition, serializer=EventDefinitionSerializer) pp = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.device.id } testclient.get_request_test_helper(expected, path_params=pp) @pytest.mark.usefixtures("admin_login") def test_get_wrong_id(self, testclient, fake_device_event_definition): expected = expect_detail(404, "Not found.") pp = { "device_id": fake_device_event_definition.device.id, "event_def_id": 123456 } testclient.get_request_test_helper(expected, path_params=pp) @pytest.mark.usefixtures("admin_login") def test_update_admin(self, testclient, fake_device_event_definition): params = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } assert_successful_edit(testclient, fake_device_event_definition, params, "condition", "a<b", serializer=EventDefinitionSerializer) @pytest.mark.usefixtures("joeseed_login") def test_update(self, testclient, fake_device_event_definition): params = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } assert_successful_edit(testclient, fake_device_event_definition, params, "ref", "newref", serializer=EventDefinitionSerializer) @pytest.mark.usefixtures("admin_login") def test_delete_admin(self, testclient, fake_device_event_definition): params = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } testclient.delete_request_test_helper(path_params=params) ed = EventDefinition.objects.get(id=fake_device_event_definition.id) assert ed.deleted == True @pytest.mark.usefixtures("joeseed_login") def test_delete(self, testclient, fake_device_event_definition): params = { "device_id": fake_device_event_definition.device.id, "event_def_id": fake_device_event_definition.id } testclient.delete_request_test_helper(path_params=params) ed = EventDefinition.objects.get(id=fake_device_event_definition.id) assert ed.deleted == True @pytest.mark.usefixtures("joeseed_login") def test_put(self, testclient, fakedevice, fake_device_event_definition): pp = { "device_id": fakedevice.id, "event_def_id": fake_device_event_definition.id } post_body = { "enabled": False, "ref": "test_email_ev_def:company", "condition": "another_variable_2<another_value_2", "actions": {"email": {"alert_text": "There is a problem again!"}}, "debounce_window": 300, "scheduled": True, "single_trigger": True, } expected = { "status_code": 200, "body": {**post_body, **{ "id": 1, "created_at": None, "updated_at": None, "product": None, }}, } testclient.put_request_test_helper(post_body, expected, path_params=pp) @pytest.mark.usefixtures("joeseed_login") def test_patch(self, testclient, fakedevice, fake_device_event_definition): pp = { "device_id": fakedevice.id, "event_def_id": fake_device_event_definition.id } post_body = { "enabled": False, "ref": "test_email_ev_def:company", "condition": "another_variable_2<another_value_2", "actions": {"email": {"alert_text": "There is a problem again!"}}, "debounce_window": 300, "scheduled": True, } expected = { "status_code": 200, "body": {**post_body, **{ "id": 1, "created_at": None, "updated_at": None, "product": None, "single_trigger": False, }}, } testclient.patch_request_test_helper(post_body, expected, path_params=pp) class TestEventDefinitionsEndpoint: route = "/api/v3/devices/{device_id}/event_defs/" def test_get_no_auth(self, testclient, fake_device_event_definition): expected = expect_detail(401, "Authentication credentials were not provided.") pp = { "device_id": fake_device_event_definition.device.id } testclient.get_request_test_helper(expected, path_params=pp) @pytest.mark.usefixtures("joeseed_login") def test_get_list(self, testclient, fake_device_event_definition): expected = { "status_code": 200, "body": { "count": 1, "next": None, "previous": None, "results": [ EventDefinitionSerializer(fake_device_event_definition).data ] } } pp = { "device_id": fake_device_event_definition.device.id } testclient.get_request_test_helper(expected, path_params=pp) @pytest.mark.usefixtures("joeseed_login") def test_get_deleted(self, testclient, fake_device_event_definition): fake_device_event_definition.deleted = True fake_device_event_definition.save() expected = { "status_code": 200, "body": { "count": 0, "next": None, "previous": None, "results": [] } } pp = { "device_id": fake_device_event_definition.device.id } testclient.get_request_test_helper(expected, path_params=pp) @pytest.mark.usefixtures("fredbloggs_login") def test_get_by_reference(self, testclient, fredbloggs): device = DeviceFactory() event_def_1 = DeviceEventDefinitionFactory(device=device, product=None, ref="abcde") event_def_2 = DeviceEventDefinitionFactory(device=device, product=None, ref="bcdef") expected = expect_detail(404, "Not found.") pp = {"device_id": device.id} qp = {"ref": "abcde"} testclient.get_request_test_helper(expected, path_params=pp, query_params=qp) group = OrganizationFactory() device.orgs.add(group) device.save() # fredbloggs.orgs.add(group) fredbloggs.add_org(group) fredbloggs.save() data_1 = EventDefinitionSerializer(event_def_1).data data_2 = EventDefinitionSerializer(event_def_2).data expected = expect_list(200, [data_1]) pp = {"device_id": device.id} qp = {"ref": "abcde"} testclient.get_request_test_helper(expected, path_params=pp, query_params=qp) expected = expect_list(200, [data_2]) qp = {"ref": "*ef"} testclient.get_request_test_helper(expected, path_params=pp, query_params=qp) expected = expect_list(200, [data_2]) qp = {"ref": "bcdef"} testclient.get_request_test_helper(expected, path_params=pp, query_params=qp) expected = expect_list(200, [data_1, data_2]) qp = {"ref": "*cd*"} testclient.get_request_test_helper(expected, path_params=pp, query_params=qp) expected = expect_list(200, []) qp = {"ref": "xyz"} testclient.get_request_test_helper(expected, path_params=pp, query_params=qp) def test_post_event_definition(self, testclient, fakedevice, joeseed_login): pp = {"device_id": fakedevice.id} post_body = { "enabled": True, "ref": "test_email_ev_def:site", "condition": "another_variable<another_value", "actions": {"email": {"alert_text": "There is a problem!"}}, "debounce_window": 600, "scheduled": False, "single_trigger": False, } expected = { "status_code": 201, "body": { **post_body, "id": 1, "created_at": None, "updated_at": None, "product": None, }, } testclient.post_request_test_helper(post_body, expected, path_params=pp)

38.197368

92

0.597658

1,184

11,612

5.503378

0.124155

0.117403

0.115101

0.191835

0.817373

0.789134

0.761664

0.741713

0.714856

0.691222

0

0.011429

0.306752

11,612

303

93

38.323432

0.798012

0.006631

0

0.621622

0

0.127385

0.022806

0

0.027027

1

0.065637

false

0

0.023166

0

0.104247

0

null

0

1

0

null

0

7

2520dd7788e3d94c4a70786fcb533cc50c99f357

339

py

Python

exercicios praticos/aula007.py

joseangelooliveira-br/Python3

c0ba39768706f84f26b0616b75dd8c7971145b0e

[ "MIT" ]

null

exercicios praticos/aula007.py

joseangelooliveira-br/Python3

c0ba39768706f84f26b0616b75dd8c7971145b0e

[ "MIT" ]

null

exercicios praticos/aula007.py

joseangelooliveira-br/Python3

c0ba39768706f84f26b0616b75dd8c7971145b0e

[ "MIT" ]

null

nome = input('Digite seu nome:') print('Prazer em conhece-lo {}!'.format(nome)) print('Prazer em conhece-lo {:20} !'.format(nome)) print('Prazer em conhece-lo {:>20} !'.format(nome)) print('Prazer em conhece-lo {:<20} !'.format(nome)) print('Prazer em conhece-lo {:^20} !'.format(nome)) print('Prazer em conhece-lo {:=^20} !'.format(nome))

48.428571

52

0.660767

52

339

4.307692

0.211538

0.241071

0.401786

0.455357

0.919643

0.803571

0

0.03268

0.097345

339

7

52

48.428571

0.699346

0

0.544118

0

1

0

false

0

0.857143

0

null

1

0

1

0

null

0

1

0

11

2538ea559af5987a8bf004971d40d3cf86e86c10

33

py

Python

Aulas de Python Mundo 1/Curso Python #11 - Cores no terminal - Part 3.py

ErikDMCosta/Meu-Reposit-rio-do-Curso-de-Python-Mundo-1

085662603d1fc1963ea25e4b08ba887adc59fecd

[ "MIT" ]

null

Aulas de Python Mundo 1/Curso Python #11 - Cores no terminal - Part 3.py

ErikDMCosta/Meu-Reposit-rio-do-Curso-de-Python-Mundo-1

085662603d1fc1963ea25e4b08ba887adc59fecd

[ "MIT" ]

null

Aulas de Python Mundo 1/Curso Python #11 - Cores no terminal - Part 3.py

ErikDMCosta/Meu-Reposit-rio-do-Curso-de-Python-Mundo-1

085662603d1fc1963ea25e4b08ba887adc59fecd

[ "MIT" ]

null

print('\033[1;31;43mOlá, Mundo!')

33

0.666667

6

33

3.666667

1

0

0.25

0.030303

33

1

33

0.4375

0

0.705882

0

1

0

true

0

1

0

null

0

1

0

1

0

1

0

1

0

null

0

1

0

1

0

8

25596ace90cfb2635a4c02cec3964a30bc606d41

92

py

Python

recstudio/model/module/__init__.py

ustc-recsys/Torchrec

4d62ee42018c12961850936cfd8f4f8d3c6a8dbc

[ "MIT" ]

1

2021-11-13T12:12:54.000Z

recstudio/model/module/__init__.py

ustc-recsys/Torchrec

4d62ee42018c12961850936cfd8f4f8d3c6a8dbc

[ "MIT" ]

null

recstudio/model/module/__init__.py

ustc-recsys/Torchrec

4d62ee42018c12961850936cfd8f4f8d3c6a8dbc

[ "MIT" ]

null

from recstudio.model.module.layers import * from recstudio.model.module.aggregator import *

30.666667

47

0.826087

12

92

6.333333

0.583333

0.342105

0.473684

0.631579

0

0.086957

92

2

48

46

0.904762

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

8

2562752c938684676f8ab410292e9a29eafbf313

37,909

py

Python

wflow/wflow/reservoir_Sa.py

quanpands/wflow

b454a55e4a63556eaac3fbabd97f8a0b80901e5a

[ "MIT" ]

null

wflow/wflow/reservoir_Sa.py

quanpands/wflow

b454a55e4a63556eaac3fbabd97f8a0b80901e5a

[ "MIT" ]

null

wflow/wflow/reservoir_Sa.py

quanpands/wflow

b454a55e4a63556eaac3fbabd97f8a0b80901e5a

[ "MIT" ]

null

# -*- coding: utf-8 -*- """ Created on Wed Feb 04 14:52:30 2015 @author: teuser """ # -*- coding: utf-8 -*- """ Created on Thu Apr 03 16:31:35 2014 @author: TEuser List all function versions """ import pcraster as pcr try: from wflow.wf_DynamicFramework import * except ImportError: from .wf_DynamicFramework import * from . import JarvisCoefficients def selectSaR(i): """ not all functions are still in this file, the older functions can be found (with the same numbering) in h:\My Documents\memo's\python scripts\wflow\ """ if i == 1: name = "agriZone_Jarvis" elif i == 2: name = "agriZone_Ep" elif i == 3: name = "agriZone_Ep_Sa" elif i == 4: name = "agriZone_Ep_Sa_cropG" elif i == 5: name = "agriZone_Ep_Sa_cropG_beta" elif i == 6: name = "agriZone_Ep_Sa_beta" elif i == 7: name = "agriZone_Ep_Sa_beta_frost" elif i == 8: name = "agriZone_Ep_Sa_beta_Fvar" elif i == 9: name = "agriZone_hourlyEp_Sa_beta_Fvar" elif i == 10: name = "agriZone_hourlyEp_Sa_beta_frost" elif i == 11: name = "agriZone_hourlyEp_Sa_beta_frostSamax" elif i == 12: name = "agriZone_Ep_Sa_beta_frostSamax" elif i == 13: name = "agriZone_Ep_Sa_beta_frostSamax_surfTemp" return name def agriZone_no_reservoir(self, k): """ This function is used when no unsaturated zone reservoir is used and only passes fluxes from the upper reservoirs to the lower self.Qa_[k] = 0. self.Ea_[k] = 0. self.Sa[k] = 0. self.Fa_[k] = Pe Storage in unsaturated zone = 0. """ self.Qa_[k] = 0.0 self.Ea_[k] = 0.0 self.Sa[k] = 0.0 self.Fa_[k] = pcr.max(self.Pe_[k], 0) self.wbSa_[k] = ( self.Pe_[k] - self.Ea_[k] - self.Qa_[k] - self.Fa_[k] - self.Sa[k] + self.Sa_t[k] ) def agriZone_Jarvis(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on Jarvis stress functions - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa - Code for ini-file: 1 """ self.Qa = pcr.max(self.Pe - (self.samax[k] - self.Sa_t[k]), 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] JarvisCoefficients.calcEu( self, k, 1 ) # calculation of Ea based on Jarvis stress functions self.Ea1 = self.Eu self.Fa1 = self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** ( -self.decF[k] * self.SuN ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Fa = ( self.Fa1 + (self.Fa1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Ea = ( self.Ea1 + (self.Ea1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Ea - self.Fa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = self.Pe - self.Ea - self.Qa - self.Fa - self.Sa[k] + self.Sa_t[k] self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa self.Fa_[k] = self.Fa def agriZone_Ep(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa - Code for ini-file: 2 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = pcr.cover(pcr.ifthenelse(self.EpHour >= 0, self.EpHour, 0), 0) self.Qa = pcr.max(self.Pe - (self.samax[k] - self.Sa_t[k]), 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax[k] * self.LP[k]), 1 ) self.Fa1 = self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** ( -self.decF[k] * self.SuN ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Fa = ( self.Fa1 + (self.Fa1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Ea = ( self.Ea1 + (self.Ea1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Ea - self.Fa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = self.Pe - self.Ea - self.Qa - self.Fa - self.Sa[k] + self.Sa_t[k] self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa self.Fa_[k] = self.Fa def agriZone_Ep_Sa(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa - Fa is based on storage in Sa - Code for ini-file: 3 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = pcr.cover(pcr.ifthenelse(self.EpHour >= 0, self.EpHour, 0), 0) self.Qa = pcr.max(self.Pe - (self.samax[k] - self.Sa_t[k]), 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax[k] * self.LP[k]), 1 ) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Fa = ( self.Fa1 + (self.Fa1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Ea = ( self.Ea1 + (self.Ea1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Ea - self.Fa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = self.Pe - self.Ea - self.Qa - self.Fa - self.Sa[k] + self.Sa_t[k] self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa self.Fa_[k] = self.Fa def agriZone_Ep_Sa_cropG(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa - Fa is based on storage in Sa - Code for ini-file: 4 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = pcr.cover(pcr.ifthenelse(self.EpHour >= 0, self.EpHour, 0), 0) self.samax2 = self.samax[k] * self.cropG self.Qaadd = pcr.max(self.Sa_t[k] - self.samax2, 0) self.Qa = pcr.max(self.Pe - (self.samax2 - self.Sa_t[k]), 0) + self.Qaadd self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Fa = ( self.Fa1 + (self.Fa1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Ea = ( self.Ea1 + (self.Ea1 / pcr.ifthenelse(self.Fa1 + self.Ea1 > 0, self.Fa1 + self.Ea1, 1)) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qa) - self.Ea - self.Fa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = self.Pe - self.Ea - self.Qa - self.Fa - self.Sa[k] + self.Sa_t[k] self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa self.Fa_[k] = self.Fa def agriZone_Ep_Sa_cropG_beta(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Code for ini-file: 5 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = pcr.cover(pcr.ifthenelse(self.EpHour >= 0, self.EpHour, 0), 0) self.samax2 = self.samax[k] * self.cropG self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa def agriZone_Ep_Sa_beta(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Code for ini-file: 6 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = pcr.cover(pcr.ifthenelse(self.EpHour >= 0, self.EpHour, 0), 0) self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(pcr.max(self.Sa[k] / self.samax2, 0), 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa def agriZone_hourlyEp_Sa_beta(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Code for ini-file: """ # JarvisCoefficients.calcEp(self,k) # self.PotEvaporation = pcr.cover(pcr.ifthenelse(self.EpHour >= 0, self.EpHour, 0),0) self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(pcr.max(self.Sa[k] / self.samax2, 0), 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa def agriZone_Ep_Sa_beta_frost(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Fa is decreased in case of frozen soil - Code for ini-file: 7 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = self.EpHour self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.FrDur[k] = pcr.min( self.FrDur[k] + (self.Tmean - 273.15) / 86400 * self.timestepsecs * self.dayDeg[k], 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Ft = pcr.min( pcr.max( self.FrDur[k] / (self.FrDur1[k] - self.FrDur0[k]) - self.FrDur0[k] / (self.FrDur1[k] - self.FrDur0[k]), 0, ), 1, ) self.Fa1 = self.Ft * pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa self.Ft_[k] = self.Ft def agriZone_hourlyEp_Sa_beta_frost(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Fa is decreased in case of frozen soil - Code for ini-file: 10 """ # JarvisCoefficients.calcEp(self,k) # self.PotEvaporation = self.EpHour self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.FrDur[k] = pcr.min( self.FrDur[k] + (self.Temperature) / 86400 * self.timestepsecs * self.dayDeg[k], 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Ft = pcr.min( pcr.max( self.FrDur[k] / (self.FrDur1[k] - self.FrDur0[k]) - self.FrDur0[k] / (self.FrDur1[k] - self.FrDur0[k]), 0, ), 1, ) self.Fa1 = self.Ft * pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa self.Ft_[k] = self.Ft def agriZone_hourlyEp_Sa_beta_frostSamax(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Fa is decreased in case of frozen soil - Code for ini-file: 11 """ # JarvisCoefficients.calcEp(self,k) # self.PotEvaporation = self.EpHour self.FrDur[k] = pcr.min(self.FrDur[k] + (self.Temperature) * self.dayDeg[k], 0) self.Ft = pcr.min( pcr.max( self.FrDur[k] / (self.FrDur1[k] - self.FrDur0[k]) - self.FrDur0[k] / (self.FrDur1[k] - self.FrDur0[k]), 0.1, ), 1, ) self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) * self.Ft self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * pcr.exp((-self.decF[k] * (1 - self.SaN))), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa self.Ft_[k] = self.Ft def agriZone_Ep_Sa_beta_frostSamax(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Fa is decreased in case of frozen soil - Code for ini-file: 12 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = pcr.cover(pcr.ifthenelse(self.EpHour >= 0, self.EpHour, 0), 0) self.FrDur[k] = pcr.min( self.FrDur[k] + pcr.ifthenelse( self.Temperature > 0, self.ratFT[k] * self.Temperature, self.Temperature ) * self.dayDeg[k], 0, ) self.Ft = pcr.min( pcr.max( self.FrDur[k] / (self.FrDur1[k] - self.FrDur0[k]) - self.FrDur0[k] / (self.FrDur1[k] - self.FrDur0[k]), self.samin[k], ), 1, ) self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) * self.Ft self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa self.Ft_[k] = self.Ft def agriZone_Ep_Sa_beta_frostSamax_surfTemp(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Fa is decreased in case of frozen soil - Code for ini-file: 13 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = self.EpHour self.FrDur[k] = pcr.min( self.FrDur[k] + pcr.ifthenelse( self.TempSurf > 0, self.ratFT[k] * self.TempSurf, self.TempSurf ) * self.dayDeg[k], 0, ) self.Ft = pcr.min( pcr.max( self.FrDur[k] / (self.FrDur1[k] - self.FrDur0[k]) - self.FrDur0[k] / (self.FrDur1[k] - self.FrDur0[k]), self.samin[k], ), 1, ) self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) * self.Ft self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa self.Ft_[k] = self.Ft def agriZone_Ep_Sa_beta_Fvar(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Code for ini-file: 8 """ JarvisCoefficients.calcEp(self, k) self.PotEvaporation = self.EpHour self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = self.cropG * pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa def agriZone_hourlyEp_Sa_beta_Fvar(self, k): """ - Potential evaporation is decreased by energy used for interception evaporation - Formula for evaporation based on LP - Outgoing fluxes are determined based on (value in previous timestep + inflow) and if this leads to negative storage, the outgoing fluxes are corrected to rato --> Eu is no longer taken into account for this correction - Qa u is determined from overflow from Sa --> incorporation of beta function - Fa is based on storage in Sa - Code for ini-file: 9 """ # JarvisCoefficients.calcEp(self,k) # self.PotEvaporation = self.EpHour self.samax2 = self.samax[k] * pcr.scalar(self.catchArea) self.Qaadd = pcr.max(self.Sa_t[k] + self.Pe - self.samax2, 0) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) self.SaN = pcr.min(self.Sa[k] / self.samax2, 1) self.SuN = self.Su[k] / self.sumax[k] self.Ea1 = pcr.max((self.PotEvaporation - self.Ei), 0) * pcr.min( self.Sa[k] / (self.samax2 * self.LP[k]), 1 ) self.Qa1 = (self.Pe - self.Qaadd) * (1 - (1 - self.SaN) ** self.beta[k]) self.Fa1 = self.cropG * pcr.ifthenelse( self.SaN > 0, self.Fmin[k] + (self.Fmax[k] - self.Fmin[k]) * e ** (-self.decF[k] * (1 - self.SaN)), 0, ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Qa1 - self.Fa1 - self.Ea1 self.Sa_diff = pcr.ifthenelse(self.Sa[k] < 0, self.Sa[k], 0) self.Qa = ( self.Qa1 + ( self.Qa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Fa = ( self.Fa1 + ( self.Fa1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Ea = ( self.Ea1 + ( self.Ea1 / pcr.ifthenelse( self.Fa1 + self.Ea1 + self.Qa1 > 0, self.Fa1 + self.Ea1 + self.Qa1, 1 ) ) * self.Sa_diff ) self.Sa[k] = self.Sa_t[k] + (self.Pe - self.Qaadd) - self.Ea - self.Fa - self.Qa self.Sa[k] = pcr.ifthenelse(self.Sa[k] < 0, 0, self.Sa[k]) self.Sa_diff2 = pcr.ifthen(self.Sa[k] < 0, self.Sa[k]) self.wbSa_[k] = ( self.Pe - self.Ea - self.Qa - self.Qaadd - self.Fa - self.Sa[k] + self.Sa_t[k] ) self.Ea_[k] = self.Ea self.Qa_[k] = self.Qa + self.Qaadd self.Fa_[k] = self.Fa

32.907118

95

0.553589

5,737

37,909

3.60502

0.033816

0.087999

0.062276

0.059569

0.960062

0.940721

0.935645

0.934919

0.933034

0

0.031262

0.296262

37,909

1,151

96

32.935708

0.743984

0.199399

0

0.737725

0

0.010786

0.008115

0

1

0.019162

false

0

0.005988

0

0.026347

0

null

0

1

0

1

0

null

0

7

25666c86e7814ef0d37390ae24705de687bbc212

4,188

py

Python

movies/tests/mock_data.py

avirepo/sendder_assignment

0033b00e091c860e196851dbf925c820ec7ba0f0

[ "Unlicense" ]

null

movies/tests/mock_data.py

avirepo/sendder_assignment

0033b00e091c860e196851dbf925c820ec7ba0f0

[ "Unlicense" ]

null

movies/tests/mock_data.py

avirepo/sendder_assignment

0033b00e091c860e196851dbf925c820ec7ba0f0

[ "Unlicense" ]

null

FILMS = [ { "id": "2baf70d1-42bb-4437-b551-e5fed5a87abe", "title": "Castle in the Sky", "description": "The orphan Sheeta inherited a mysterious ", "director": "Hayao Miyazaki", "producer": "Isao Takahata", "release_date": "1986", "rt_score": "95", "people": [ "https://ghibliapi.herokuapp.com/people/" ], "species": [ "https://ghibliapi.herokuapp.com/species/af3910a6-429f" "-4c74-9ad5-dfe1c4aa04f2" ], "locations": [ "https://ghibliapi.herokuapp.com/locations/" ], "vehicles": [ "https://ghibliapi.herokuapp.com/vehicles/" ], "url": "https://ghibliapi.herokuapp.com/films/2baf70d1-42bb" "-4437-b551-e5fed5a87abe" } ] PEOPLE = [ { "id": "fe93adf2-2f3a-4ec4-9f68-5422f1b87c01", "name": "Pazu", "gender": "Male", "age": "13", "eye_color": "Black", "hair_color": "Brown", "films": [ "https://ghibliapi.herokuapp.com/films/2baf70d1-42bb" "-4437-b551-e5fed5a87abe", "https://ghibliapi.herokuapp.com/films/2baf70d1-42bb" "-4437-b551-e5fed5a87abe" ], "species": "https://ghibliapi.herokuapp.com/species" "/af3910a6-429f-4c74-9ad5-dfe1c4aa04f2", "url": "https://ghibliapi.herokuapp.com/people/fe93adf2" "-2f3a-4ec4-9f68-5422f1b87c01" }, { "id": "598f7048-74ff-41e0-92ef-87dc1ad980a9", "name": "Lusheeta Toel Ul Laputa", "gender": "Female", "age": "13", "eye_color": "Black", "hair_color": "Black", "films": [ "https://ghibliapi.herokuapp.com/films/2baf70d1-42bb" "-4437-b551-e5fed5a87abe" ], "species": "https://ghibliapi.herokuapp.com/species" "/af3910a6-429f-4c74-9ad5-dfe1c4aa04f2", "url": "https://ghibliapi.herokuapp.com/people/598f7048" "-74ff-41e0-92ef-87dc1ad980a9" } ] PEOPLE_FILM_MAP = { '2baf70d1-42bb-4437-b551-e5fed5a87abe': [{ "people_id": "598f7048-74ff-41e0-92ef-87dc1ad980a9", "name": "Lusheeta " "Toel Ul " "Laputa", "gender": "Female", "age": "13", "hair_color": "Black", "species": "https://ghibliapi.herokuapp.com/species" "/af3910a6-429f-4c74-9ad5-dfe1c4aa04f2" }, { "people_id": "fe93adf2-2f3a-4ec4-9f68-5422f1b87c01", "name": "Pazu", "gender": "Male", "age": "13", "hair_color": "Brown", "species": "https://ghibliapi.herokuapp.com/species" "/af3910a6-429f-4c74-9ad5-dfe1c4aa04f2" } ] } MOVIE_DATA = [ { 'id': '2baf70d1-42bb-4437-b551-e5fed5a87abe', 'title': 'Castle in the Sky', 'description': 'The orphan Sheeta inherited a ' 'mysterious ', 'director': 'Hayao Miyazaki', 'producer': 'Isao Takahata', 'release_date': '1986', 'rt_score': '95', 'people': [ "{'people_id': '598f7048-74ff-41e0-92ef-87dc1ad980a9', " "'name': 'Lusheeta Toel Ul Laputa', 'gender': 'Female', " "'age': '13', 'hair_color': 'Black', 'species': " "'https://ghibliapi.herokuapp.com/species/af3910a6-429f" "-4c74-9ad5-dfe1c4aa04f2'}", "{'people_id': 'fe93adf2-2f3a-4ec4-9f68-5422f1b87c01', " "'name': 'Pazu', 'gender': 'Male', 'age': '13', " "'hair_color': 'Brown', 'species': " "'https://ghibliapi.herokuapp.com/species/af3910a6-429f" "-4c74-9ad5-dfe1c4aa04f2'}" ], 'species': [ 'https://ghibliapi.herokuapp.com/species' '/af3910a6-429f-4c74-9ad5-dfe1c4aa04f2'], 'locations': [ 'https://ghibliapi.herokuapp.com/locations/'], 'vehicles': [ 'https://ghibliapi.herokuapp.com/vehicles/'], 'url': 'https://ghibliapi.herokuapp.com/films/2baf70d1-42bb' '-4437-b551-e5fed5a87abe' } ]

34.61157

68

0.525072

376

4,188

5.797872

0.196809

0.12844

0.211009

0.238532

0.983028

0.938991

0.904128

0

0.158254

0.299904

4,188

120

69

34.9

0.585266

0

0.350427

0

0.603152

0.181232

0

1

0

false

0

null

0

1

0

1

0

null

0

9

c2526832d8df44d37510fbde3b652ba322ab6cee

2,599

py

Python

tests/test_mmlab_jwt_vc.py

BasileiosKal/py-verifier

6614bdc515f823245762c0250de429a27c39e203

[ "MIT" ]

null

tests/test_mmlab_jwt_vc.py

BasileiosKal/py-verifier

6614bdc515f823245762c0250de429a27c39e203

[ "MIT" ]

null

tests/test_mmlab_jwt_vc.py

BasileiosKal/py-verifier

6614bdc515f823245762c0250de429a27c39e203

[ "MIT" ]

2

2022-01-17T11:08:27.000Z

2022-01-28T09:50:10.000Z

import pytest import requests import json ''' Tests VCs issued by https://issuer.mmlab.edu.gr ''' class TestJWT: def test_valid_authorization_get(self): token = "eyJhbGciOiJFUzI1NiIsInR5cCI6IkpXVCJ9.eyJpc3MiOiJodHRwczovL2lzc3Vlci5tbWxhYi5lZHUuZ3IiLCJ2YyI6eyJAY29udGV4dCI6WyJodHRwczovL3d3dy53My5vcmcvMjAxOC9jcmVkZW50aWFscy92MSIsImh0dHBzOi8vbW0uYXVlYi5nci9jb250ZXh0cy9jYXBhYmlsaXRpZXMvdjEiXSwidHlwZSI6WyJWZXJpZmlhYmxlQ3JlZGVudGlhbCIsIkNhcGFiaWxpdGllc0NyZWRlbnRpYWwiXSwiY3JlZGVudGlhbFN1YmplY3QiOnsiY2FwYWJpbGl0aWVzIjp7IkNsb3VkIHN0b3JhZ2UiOlsiRkxfUkVBRCJdfX19fQ.wlgCx4P3bhrJqBeV5e186kdfFwWCRR5goo5GRdJxSF1ui5vlEW60FedJHV_PY4SBBn3RS63-yeyfPuOuj1j9lw" headers = {'Authorization':'Bearer ' + token, 'Accept': 'application/json'} response = requests.get("http://localhost:9000/mmlab/jwt-vc", headers = headers) print(response.text) assert(response.status_code == 200) def test_valid_authorization_with_pem_get(self): token = "eyJhbGciOiJFUzI1NiIsInR5cCI6IkpXVCJ9.eyJpc3MiOiJodHRwczovL2lzc3Vlci5tbWxhYi5lZHUuZ3IiLCJ2YyI6eyJAY29udGV4dCI6WyJodHRwczovL3d3dy53My5vcmcvMjAxOC9jcmVkZW50aWFscy92MSIsImh0dHBzOi8vbW0uYXVlYi5nci9jb250ZXh0cy9jYXBhYmlsaXRpZXMvdjEiXSwidHlwZSI6WyJWZXJpZmlhYmxlQ3JlZGVudGlhbCIsIkNhcGFiaWxpdGllc0NyZWRlbnRpYWwiXSwiY3JlZGVudGlhbFN1YmplY3QiOnsiY2FwYWJpbGl0aWVzIjp7IkNsb3VkIHN0b3JhZ2UiOlsiRkxfUkVBRCJdfX19fQ.wlgCx4P3bhrJqBeV5e186kdfFwWCRR5goo5GRdJxSF1ui5vlEW60FedJHV_PY4SBBn3RS63-yeyfPuOuj1j9lw" headers = {'Authorization':'Bearer ' + token, 'Accept': 'application/json'} response = requests.get("http://localhost:9000/mmlab/jwt-vc-pem", headers = headers) print(response.text) assert(response.status_code == 200) def test_valid_authorization_post(self): token = "eyJhbGciOiJFUzI1NiIsInR5cCI6IkpXVCJ9.eyJpc3MiOiJodHRwczovL2lzc3Vlci5tbWxhYi5lZHUuZ3IiLCJ2YyI6eyJAY29udGV4dCI6WyJodHRwczovL3d3dy53My5vcmcvMjAxOC9jcmVkZW50aWFscy92MSIsImh0dHBzOi8vbW0uYXVlYi5nci9jb250ZXh0cy9jYXBhYmlsaXRpZXMvdjEiXSwidHlwZSI6WyJWZXJpZmlhYmxlQ3JlZGVudGlhbCIsIkNhcGFiaWxpdGllc0NyZWRlbnRpYWwiXSwiY3JlZGVudGlhbFN1YmplY3QiOnsiY2FwYWJpbGl0aWVzIjp7IkNsb3VkIHN0b3JhZ2UiOlsiRkxfUkVBRCJdfX19fQ.wlgCx4P3bhrJqBeV5e186kdfFwWCRR5goo5GRdJxSF1ui5vlEW60FedJHV_PY4SBBn3RS63-yeyfPuOuj1j9lw" headers = {'Authorization':'Bearer ' + token, 'Accept': 'application/json', 'Content-Type': 'application/json'} data = {'on': False} response = requests.post("http://localhost:9000/mmlab/jwt-vc", headers = headers, data = json.dumps(data)) print(response.text) assert(response.status_code == 200)

83.83871

500

0.839169

145

2,599

14.924138

0.358621

0.027726

0.016636

0.034658

0.908503

0.869224

0

0.096692

0.092728

2,599

30

501

86.633333

0.821035

0

0.478261

0

0.671384

0.568396

0

0.130435

1

0.130435

false

0

0.130435

0

0.304348

0.130435

0

1

null

0

1

0

1

null

0

9

c295effa0ca4ed68686d46a935f2624a53f59e17

2,699

py

Python

scraper/src/tests/default_strategy/get_anchor_test.py

mikiec84/docsearch-scraper

08aa90ee9bf91b3e5e3e0d383e4d1b4d284c56b8

[ "MIT" ]

1

2020-11-09T21:06:27.000Z

scraper/src/tests/default_strategy/get_anchor_test.py

mikiec84/docsearch-scraper

08aa90ee9bf91b3e5e3e0d383e4d1b4d284c56b8

[ "MIT" ]

4

2021-03-31T19:59:26.000Z

2022-03-02T15:02:55.000Z

scraper/src/tests/default_strategy/get_anchor_test.py

gaybro8777/docsearch-scraper

08aa90ee9bf91b3e5e3e0d383e4d1b4d284c56b8

[ "MIT" ]

null

# -*- coding: utf-8 -*- import lxml.html from .abstract import get_strategy from ...strategies.anchor import Anchor class TestGetAnchor: def test_name_on_heading(self): # Given strategy = get_strategy() strategy.dom = lxml.html.fromstring(""" <html><body> <h1>Foo</h1> <h2 name="bar">Bar</h2> <h3>Baz</h3> </body></html> """) level = 'lvl1' element = strategy.select(strategy.config.selectors['default'][level]['selector'])[0] # When actual = Anchor.get_anchor(element) # Then assert actual == 'bar' def test_id_not_in_a_direct_parent(self): strategy = get_strategy() strategy.dom = lxml.html.fromstring(""" <div> <a id="bar"></a> <div> <div> <h2>Bar</h2> </div> </div> </div> """) level = 'lvl1' element = strategy.select(strategy.config.selectors['default'][level]['selector'])[0] # When actual = Anchor.get_anchor(element) # Then assert actual == 'bar' def test_id_on_heading(self): # Given strategy = get_strategy() strategy.dom = lxml.html.fromstring(""" <html><body> <h1>Foo</h1> <h2 id="bar">Bar</h2> <h3>Baz</h3> </body></html> """) level = 'lvl1' element = strategy.select(strategy.config.selectors['default'][level]['selector'])[0] # When actual = Anchor.get_anchor(element) # Then assert actual == 'bar' def test_anchor_in_subelement(self): # Given strategy = get_strategy() strategy.dom = lxml.html.fromstring(""" <html><body> <h1>Foo</h1> <h2><a href="#" name="bar">Bar</a><span></span></h2> <h3>Baz</h3> </body></html> """) level = 'lvl1' element = strategy.select(strategy.config.selectors['default'][level]['selector'])[0] # When actual = Anchor.get_anchor(element) # Then assert actual == 'bar' def test_no_anchor(self): # Given strategy = get_strategy() strategy.dom = lxml.html.fromstring(""" <html><body> <h1>Foo</h1> <h2>Bar</h2> <h3>Baz</h3> </body></html> """) level = 'lvl2' element = strategy.select(strategy.config.selectors['default'][level]['selector'])[0] # When actual = Anchor.get_anchor(element) # Then assert actual is None

25.462264

93

0.502779

281

2,699

4.729537

0.202847

0.036117

0.071482

0.10158

0.823928

0.768999

0

0.020916

0.344572

2,699

105

94

25.704762

0.730356

0.035198

0

0.791667

0

0.332689

0.01391

0

0.069444

1

0.069444

false

0

0.041667

0

0.125

0

null

0

1

0

1

0

null

0

7

6c2a058326fe621dc5e18f3e86770d0b27c1aa28

5,754

py

Python

test/test_load.py

absperf/python-req

b003f36eff3c940ec0e3d30c823508db6ea106d7

[ "MIT" ]

null

test/test_load.py

absperf/python-req

b003f36eff3c940ec0e3d30c823508db6ea106d7

[ "MIT" ]

null

test/test_load.py

absperf/python-req

b003f36eff3c940ec0e3d30c823508db6ea106d7

[ "MIT" ]

null

import unittest import ucbreq from collections import OrderedDict class LoadTest(unittest.TestCase): def test_loads_default(self): d = OrderedDict() d['foo'] = 'bar' d['baz'] = ['alpha', 'beta', 'gamma'] d['delta'] = 'eins' d['zwei'] = ['drei', 'vier'] self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz_5|alpha\nbaz_6|beta\nbaz_7|gamma\ndelta|eins\nzwei_5|drei\nzwei_6|vier\n", cls=OrderedDict, )) self.assertEqual( d, ucbreq.loads( "foo=bar\nbaz_1=alpha\nbaz_2=beta\nbaz_3=gamma\ndelta=eins\nzwei_1=drei\nzwei_2=vier\n", cls=OrderedDict, separator='=', )) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz,1|alpha\nbaz,2|beta\nbaz,3|gamma\ndelta|eins\nzwei,1|drei\nzwei,2|vier\n", cls=OrderedDict, index_separator=',', )) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz_1|alpha\ndelta|eins\nbaz_3|gamma\nzwei_1|vier\nbaz_2|beta\nzwei|drei\n", cls=OrderedDict, )) def test_loads_tuple(self): d = OrderedDict() d['foo'] = 'bar' d['baz'] = ('alpha', 'beta', 'gamma') d['delta'] = 'eins' d['zwei'] = ('drei', 'vier') self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz_5|alpha\nbaz_6|beta\nbaz_7|gamma\ndelta|eins\nzwei_5|drei\nzwei_6|vier\n", cls=OrderedDict, list_cls=tuple, )) self.assertEqual( d, ucbreq.loads( "foo=bar\nbaz_1=alpha\nbaz_2=beta\nbaz_3=gamma\ndelta=eins\nzwei_1=drei\nzwei_2=vier\n", cls=OrderedDict, list_cls=tuple, separator='=', )) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz,1|alpha\nbaz,2|beta\nbaz,3|gamma\ndelta|eins\nzwei,1|drei\nzwei,2|vier\n", cls=OrderedDict, list_cls=tuple, index_separator=',', )) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz_1|alpha\ndelta|eins\nbaz_3|gamma\nzwei_1|vier\nbaz_2|beta\nzwei|drei\n", cls=OrderedDict, list_cls=tuple, )) def test_loads_set(self): d = OrderedDict() d['foo'] = 'bar' d['baz'] = frozenset({'alpha', 'beta', 'gamma'}) d['delta'] = 'eins' d['zwei'] = frozenset({'drei', 'vier'}) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz_5|alpha\nbaz_6|beta\nbaz_7|gamma\ndelta|eins\nzwei_5|drei\nzwei_6|vier\n", cls=OrderedDict, list_cls=frozenset, )) self.assertEqual( d, ucbreq.loads( "foo=bar\nbaz_1=alpha\nbaz_2=beta\nbaz_3=gamma\ndelta=eins\nzwei_1=drei\nzwei_2=vier\n", cls=OrderedDict, list_cls=frozenset, separator='=', )) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz,1|alpha\nbaz,2|beta\nbaz,3|gamma\ndelta|eins\nzwei,1|drei\nzwei,2|vier\n", cls=OrderedDict, list_cls=frozenset, index_separator=',', )) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz_1|alpha\ndelta|eins\nbaz_3|gamma\nzwei_1|vier\nbaz_2|beta\nzwei|drei\n", cls=OrderedDict, list_cls=frozenset, )) def test_loads_bytes(self): d = OrderedDict() d[b'foo'] = b'bar' d[b'baz'] = [b'alpha', b'beta', b'gamma'] d[b'delta'] = b'eins' d[b'zwei'] = [b'drei', b'vier'] self.assertEqual( d, ucbreq.loads( b"foo|bar\nbaz_5|alpha\nbaz_6|beta\nbaz_7|gamma\ndelta|eins\nzwei_5|drei\nzwei_6|vier\n", cls=OrderedDict, )) self.assertEqual( d, ucbreq.loads( b"foo=bar\nbaz_1=alpha\nbaz_2=beta\nbaz_3=gamma\ndelta=eins\nzwei_1=drei\nzwei_2=vier\n", cls=OrderedDict, separator=b'=', )) self.assertEqual( d, ucbreq.loads( b"foo|bar\nbaz,1|alpha\nbaz,2|beta\nbaz,3|gamma\ndelta|eins\nzwei,1|drei\nzwei,2|vier\n", cls=OrderedDict, index_separator=b',', )) def test_loads_unicode(self): d = OrderedDict() d['foo'] = 'bar' d['baz'] = ['alpha', 'beta', 'gamma'] d['delta'] = 'eins' d['zwei'] = ['drei', 'vier'] self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz_5|alpha\nbaz_6|beta\nbaz_7|gamma\ndelta|eins\nzwei_5|drei\nzwei_6|vier\n", cls=OrderedDict, )) self.assertEqual( d, ucbreq.loads( "foo=bar\nbaz_1=alpha\nbaz_2=beta\nbaz_3=gamma\ndelta=eins\nzwei_1=drei\nzwei_2=vier\n", cls=OrderedDict, separator='=', )) self.assertEqual( d, ucbreq.loads( "foo|bar\nbaz,1|alpha\nbaz,2|beta\nbaz,3|gamma\ndelta|eins\nzwei,1|drei\nzwei,2|vier\n", cls=OrderedDict, index_separator=',', ))

34.662651

105

0.480188

662

5,754

4.045317

0.070997

0.049291

0.107543

0.147872

0.901046

0.894324

0.889096

0.868185

0.85773

0

0.024404

0.380431

5,754

165

106

34.872727

0.726788

0

0.8625

0

0.1125

0.304831

0.264859

0

0.1125

1

0.03125

false

0

0.01875

0

0.05625

0

null

0

1

0

1

0

null

0

7

6c81f4568ea1cba06574b9888b42a2d8afcaef18

7,456

py

Python

todoes/forms.py

Ishayahu/MJCC-tasks

68ea00dab543e6e4e0f6cf6b6683f3719bb6f3c0

[ "MIT" ]

1

2017-09-25T09:36:46.000Z

todoes/forms.py

Ishayahu/MJCC-tasks

68ea00dab543e6e4e0f6cf6b6683f3719bb6f3c0

[ "MIT" ]

40

2015-05-29T11:25:15.000Z

2015-08-13T10:28:17.000Z

todoes/forms.py

Ishayahu/MJCC-tasks

68ea00dab543e6e4e0f6cf6b6683f3719bb6f3c0

[ "MIT" ]

null

# -*- coding:utf-8 -*- # coding=<utf8> #TODO: сделать английские формы from django import forms from todoes.models import Note, Resource, File, Person, Task, ProblemByWorker, ProblemByUser, Categories # from tasks.todoes.models import Worker, Client from django.contrib.auth.forms import UserCreationForm from django.contrib.admin import widgets RUS_PRIORITY_CHOICES = ( ('1','Лазар/Борода/Мотя'), ('2','Если не сделать сейчас - огребём проблем потом'), ('3','Всё остальное'), ('4','В ближайшем будущем'), ('5','Когда время будет') ) ENG_PRIORITY_CHOICES = ( ('1','Lazar/Boroda/Motya'), ('2','Если не сделать сейчас - огребём проблем потом'), ('3','Всё остальное'), ('4','В ближайшем будущем'), ('5','Когда время будет') ) inp_f=( '%d-%m-%Y %H:%M:%S', # '2006-10-25 14:30:59' '%d-%m-%Y %H:%M', # '2006-10-25 14:30' '%Y-%m-%d %H:%M:%S', # '2006-10-25 14:30' '%d-%m-%Y', # '2006-10-25' '%d/%m/%Y %H:%M:%S', # '10/25/2006 14:30:59' '%d/%m/%Y %H:%M', # '10/25/2006 14:30' '%d/%m/%Y', # '10/25/2006' '%d.%m.%Y %H:%M:%S', # '10/25/2006 14:30:59' '%Y.%m.%d %H:%M:%S', # '2010/01/26 14:30:59' '%d/%m/%y %H:%M:%S', # '10/25/06 14:30:59' '%d/%m/%y %H:%M', # '10/25/06 14:30' '%d/%m/%y', ) class NewTicketForm(forms.Form): name = forms.CharField(max_length=140, label='Название заявки') pbus = forms.ModelChoiceField(queryset = ProblemByUser.objects.all(), label='Проблема со слов пользователя') description = forms.CharField(widget=forms.Textarea, label='Описание') clients = forms.ModelChoiceField(queryset = Person.objects.all(), label='Заявитель') priority = forms.ChoiceField(widget=forms.RadioSelect,choices = PRIORITY_CHOICES, label='Приоритет') category = forms.ModelChoiceField(queryset = Categories.objects.all(), label='Категория') start_date = forms.DateTimeField(label='Дата создания заявки') due_date = forms.DateTimeField(label='Предполагаемая дата завершения',input_formats=inp_f) workers = forms.ModelChoiceField(queryset = Person.objects.all(), label='Исполнитель') percentage = forms.DecimalField(min_value=0, max_value=100, label='Процент выполнения') class TicketEditForm(forms.Form): name = forms.CharField(max_length=140, label='Название заявки') pbus = forms.ModelChoiceField(queryset = ProblemByUser.objects.all(), label='Проблема со слов пользователя') description = forms.CharField(widget=forms.Textarea, label='Описание') clients = forms.ModelChoiceField(queryset = Person.objects.all(), label='Заявитель') priority = forms.ChoiceField(choices = PRIORITY_CHOICES, label='Приоритет') category = forms.ModelChoiceField(queryset = Categories.objects.all(), label='Категория') start_date = forms.DateTimeField(label='Дата создания заявки',input_formats=inp_f) when_to_reminder = forms.DateTimeField(label='Установить напоминание',input_formats=inp_f,required=False) due_date = forms.DateTimeField(label='Предполагаемая дата завершения',input_formats=inp_f) workers = forms.ModelChoiceField(queryset = Person.objects.all(), label='Исполнитель') percentage = forms.DecimalField(min_value=0, max_value=100, label='Процент выполнения') class NewRegularTicketForm(forms.Form): name = forms.CharField(max_length=140, label='Название заявки') description = forms.CharField(widget=forms.Textarea, label='Описание',required=False) clients = forms.ModelChoiceField(queryset = Person.objects.all(), label='Заявитель') priority = forms.ChoiceField(widget=forms.RadioSelect,choices = PRIORITY_CHOICES, label='Приоритет') category = forms.ModelChoiceField(queryset = Categories.objects.all(), label='Категория') start_date = forms.DateTimeField(label='Дата создания заявки',input_formats=inp_f) stop_date = forms.DateTimeField(label='Дата завершения',input_formats=inp_f,required=False) workers = forms.ModelChoiceField(queryset = Person.objects.all(), label='Исполнитель') class EditRegularTicketForm(forms.Form): name = forms.CharField(max_length=140, label='Название заявки') description = forms.CharField(widget=forms.Textarea, label='Описание',required=False) clients = forms.ModelChoiceField(queryset = Person.objects.all(), label='Заявитель') priority = forms.ChoiceField(widget=forms.RadioSelect,choices = PRIORITY_CHOICES, label='Приоритет') category = forms.ModelChoiceField(queryset = Categories.objects.all(), label='Категория') start_date = forms.DateTimeField(label='Дата создания заявки',input_formats=inp_f) when_to_reminder = forms.DateTimeField(label='Установить напоминание',input_formats=inp_f,required=False) stop_date = forms.DateTimeField(label='Дата завершения',input_formats=inp_f,required=False) workers = forms.ModelChoiceField(queryset = Person.objects.all(), label='Исполнитель') class TicketClosingForm(forms.Form): done_date = forms.DateTimeField(label='Дата закрытия заявки',input_formats=inp_f) pbw = forms.ModelChoiceField(queryset = ProblemByWorker.objects.all(), label='Выявленная проблема') class TicketConfirmingForm(forms.Form): confirmed = forms.BooleanField(required=False) confirmed_date = forms.DateTimeField(label='Дата подтверждения закрытия заявки',input_formats=inp_f) # class NoteToTicketAddForm(forms.Form): # note = forms.CharField(widget=forms.Textarea, label='Комментарий',required=False ) # workers = forms.ModelMultipleChoiceField(queryset = Person.objects.all(), label='Кого ещё уведомить о комментарии?',required=False) class UserCreationFormMY(UserCreationForm): fio = forms.CharField(label='ФИО') mail = forms.EmailField(label = 'Мыло') tel = forms.CharField(label='Телефон', max_length=10, min_length=10) class TicketSearchForm(forms.Form): name = forms.CharField(max_length=140, label='Текст для поиска') class NoteToTicketAddForm(forms.Form): def __init__(self, *args, **kwargs): self.defaults = kwargs.pop('defaults','') self.exclude = kwargs.pop('exclude','') super(NoteToTicketAddForm, self).__init__(*args, **kwargs) self.fields['workers'].queryset = Person.objects.exclude(fio__in = [person.fio for person in self.exclude ]) self.fields['workers'].initial = Person.objects.filter(fio__in = self.defaults) note = forms.CharField(widget=forms.Textarea, label='Комментарий',required=False ) workers = forms.ModelMultipleChoiceField(queryset = Person.objects.all(), label='Кого ещё уведомить о комментарии?',required=False,) class File_and_NoteToTicketAddForm(forms.Form): def __init__(self, *args, **kwargs): self.defaults = kwargs.pop('defaults','') self.exclude = kwargs.pop('exclude','') super(File_and_NoteToTicketAddForm, self).__init__(*args, **kwargs) self.fields['workers'].queryset = Person.objects.exclude(fio__in = [person.fio for person in self.exclude ]) self.fields['workers'].initial = Person.objects.filter(fio__in = self.defaults) note = forms.CharField(widget=forms.Textarea, label='Комментарий',required=False ) file = forms.FileField() workers = forms.ModelMultipleChoiceField(queryset = Person.objects.all(), label='Кого ещё уведомить о комментарии?',required=False,)

60.129032

138

0.70346

898

7,456

5.747216

0.203786

0.034877

0.052315

0.051153

0.826972

0.807789

0.793838

0.783569

0.775044

0

0.02666

0.149812

7,456

123

139

60.617886

0.787506

0.076985

0

0.563107

0

0.175433

0

0.00813

0

1

0.019417

false

0

0.038835

0

0.650485

0

null

0

1

0

null

0

1

0

7

66e741279035c9216e7b6d9eb130526f280160e0

3,543

py

Python

graphtheory/hamiltonian/tsprnn.py

gitter-badger/graphs-dict

2be1a5b140feb050eec799d6cadf6de5eef01745

[ "BSD-3-Clause" ]

36

2015-09-20T20:55:39.000Z

2021-09-20T05:49:03.000Z

graphtheory/hamiltonian/tsprnn.py

gitter-badger/graphs-dict

2be1a5b140feb050eec799d6cadf6de5eef01745

[ "BSD-3-Clause" ]

6

2016-03-25T21:41:46.000Z

2020-02-12T03:18:59.000Z

graphtheory/hamiltonian/tsprnn.py

gitter-badger/graphs-dict

2be1a5b140feb050eec799d6cadf6de5eef01745

[ "BSD-3-Clause" ]

9

2016-09-12T07:57:27.000Z

2022-03-21T16:15:39.000Z

#!/usr/bin/python try: integer_types = (int, long) except NameError: # Python 3 integer_types = (int,) xrange = range class RepeatedNearestNeighborTSPWithEdges: """The repeated nearest neighbor algorithm for TSP. Attributes ---------- graph : input weighted complete graph hamiltonian_cycle : list of edges best_weight : number _used : dict with nodes, private """ def __init__(self, graph): """The algorithm initialization.""" if graph.is_directed(): raise ValueError("the graph is directed") self.graph = graph self.hamiltonian_cycle = None self.best_weight = float("inf") self._used = None def run(self, source=None): """Executable pseudocode.""" for source in self.graph.iternodes(): start_node = source cycle = list() self._used = dict((node, False) for node in self.graph.iternodes()) self._used[source] = True # Szukamy n-1 kolejnych krawedzi. Unikamy tworzenia cyklu. for step in xrange(self.graph.v()-1): edge = min(edge for edge in self.graph.iteroutedges(source) if not self._used[edge.target]) cycle.append(edge) self._used[edge.target] = True source = edge.target # We have to close the cycle. for edge in self.graph.iteroutedges(source): if edge.target == start_node: cycle.append(edge) break weight = sum(edge.weight for edge in cycle) if weight < self.best_weight: self.best_weight = weight self.hamiltonian_cycle = cycle class RepeatedNearestNeighborTSPWithGraph: """The repeated nearest neighbor algorithm for TSP. Attributes ---------- graph : input weighted complete graph hamiltonian_cycle : cycle graph best_weight : number _used : dict with nodes, private """ def __init__(self, graph): """The algorithm initialization.""" if graph.is_directed(): raise ValueError("the graph is directed") self.graph = graph self.hamiltonian_cycle = None self.best_weight = float("inf") self._used = None def run(self, source=None): """Executable pseudocode.""" for source in self.graph.iternodes(): start_node = source cycle = self.graph.__class__(self.graph.v()) for node in self.graph.iternodes(): cycle.add_node(node) self._used = dict((node, False) for node in self.graph.iternodes()) self._used[source] = True # Szukamy n-1 kolejnych krawedzi. Unikamy tworzenia cyklu. for step in xrange(self.graph.v()-1): edge = min(edge for edge in self.graph.iteroutedges(source) if not self._used[edge.target]) cycle.add_edge(edge) self._used[edge.target] = True source = edge.target # We have to close the cycle. for edge in self.graph.iteroutedges(source): if edge.target == start_node: cycle.add_edge(edge) break weight = sum(edge.weight for edge in cycle.iteredges()) if weight < self.best_weight: self.best_weight = weight self.hamiltonian_cycle = cycle # EOF

34.735294

79

0.569856

393

3,543

5.012723

0.223919

0.077665

0.050254

0.050761

0.865482

0.851777

0

0.002128

0.33672

3,543

101

80

35.079208

0.83617

0.19729

0

0.793651

0

0.017512

0

1

0.063492

false

0

0.095238

0

null

0

1

0

1

0

null

0

7

dd451efd7241cdc08054a792bf3de0179e82d7e6

5,656

py

Python

hive/server/bridge_api/methods.py

blocktradesdevs/hivemind

0c05fbced6edcbf754093dd1109381cc36bac2d1

[ "MIT" ]

1

2019-06-28T03:20:59.000Z

hive/server/bridge_api/methods.py

blocktradesdevs/hivemind

0c05fbced6edcbf754093dd1109381cc36bac2d1

[ "MIT" ]

6

2019-04-22T11:11:26.000Z

2019-06-30T19:47:34.000Z

hive/server/bridge_api/methods.py

blocktradesdevs/hivemind

0c05fbced6edcbf754093dd1109381cc36bac2d1

[ "MIT" ]

1

2019-03-19T12:48:55.000Z

"""Steemd/condenser_api compatibility layer API methods.""" # pylint: disable=duplicate-code,too-many-arguments,invalid-name import hive.server.condenser_api.cursor as cursor from hive.server.bridge_api.objects import load_posts, load_posts_reblogs from hive.server.condenser_api.common import ( return_error_info, valid_account, valid_permlink, valid_tag, valid_limit) @return_error_info async def get_discussions_by_trending(context, start_author='', start_permlink='', limit=20, tag=None): """Query posts, sorted by trending score.""" ids = await cursor.pids_by_query( context['db'], 'trending', valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100), valid_tag(tag, allow_empty=True)) return await load_posts(context['db'], ids) @return_error_info async def get_discussions_by_hot(context, start_author='', start_permlink='', limit=20, tag=None): """Query posts, sorted by hot score.""" ids = await cursor.pids_by_query( context['db'], 'hot', valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100), valid_tag(tag, allow_empty=True)) return await load_posts(context['db'], ids) @return_error_info async def get_discussions_by_promoted(context, start_author='', start_permlink='', limit=20, tag=None): """Query posts, sorted by promoted amount.""" ids = await cursor.pids_by_query( context['db'], 'promoted', valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100), valid_tag(tag, allow_empty=True)) return await load_posts(context['db'], ids) @return_error_info async def get_discussions_by_created(context, start_author='', start_permlink='', limit=20, tag=None): """Query posts, sorted by creation date.""" ids = await cursor.pids_by_query( context['db'], 'created', valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100), valid_tag(tag, allow_empty=True)) return await load_posts(context['db'], ids) @return_error_info async def get_discussions_by_blog(context, tag=None, start_author='', start_permlink='', limit=20): """Retrieve account's blog posts, including reblogs.""" assert tag, '`tag` cannot be blank' ids = await cursor.pids_by_blog( context['db'], valid_account(tag), valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100)) return await load_posts(context['db'], ids) @return_error_info async def get_discussions_by_feed(context, tag=None, start_author='', start_permlink='', limit=20): """Retrieve account's personalized feed.""" assert tag, '`tag` cannot be blank' res = await cursor.pids_by_feed_with_reblog( context['db'], valid_account(tag), valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100)) return await load_posts_reblogs(context['db'], res) @return_error_info async def get_discussions_by_comments(context, start_author=None, start_permlink='', limit=20): """Get comments by made by author.""" assert start_author, '`start_author` cannot be blank' ids = await cursor.pids_by_account_comments( context['db'], valid_account(start_author), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100)) return await load_posts(context['db'], ids) @return_error_info async def get_replies_by_last_update(context, start_author=None, start_permlink='', limit=20): """Get all replies made to any of author's posts.""" assert start_author, '`start_author` cannot be blank' ids = await cursor.pids_by_replies_to_account( context['db'], valid_account(start_author), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100)) return await load_posts(context['db'], ids) @return_error_info async def get_post_discussions_by_payout(context, start_author='', start_permlink='', limit=20, tag=None): """Query top-level posts, sorted by payout.""" ids = await cursor.pids_by_query( context['db'], 'payout', valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100), valid_tag(tag, allow_empty=True)) return await load_posts(context['db'], ids) @return_error_info async def get_comment_discussions_by_payout(context, start_author='', start_permlink='', limit=20, tag=None): """Query comments, sorted by payout.""" ids = await cursor.pids_by_query( context['db'], 'payout_comments', valid_account(start_author, allow_empty=True), valid_permlink(start_permlink, allow_empty=True), valid_limit(limit, 100), valid_tag(tag, allow_empty=True)) return await load_posts(context['db'], ids)

40.113475

88

0.654173

706

5,656

4.944759

0.127479

0.075623

0.096247

0.097966

0.814953

0.804354

0.753079

0.704956

0

0.011558

0.235149

5,656

140

89

40.4

0.795423

0.020686

0

0.75

0

0.037132

0

0.034483

1

0

false

0

0.025862

0

0.112069

0

null

0

1

0

1

0

null

0

7

dd992c510161f9e70aefca741f0f7bb80df0a7fe

118

py

Python

platform/hwconf_data/efr32mg12p/PythonSnippet/__init__.py

lenloe1/v2.7

9ac9c4a7bb37987af382c80647f42d84db5f2e1d

[ "Zlib" ]

null

platform/hwconf_data/efr32mg12p/PythonSnippet/__init__.py

lenloe1/v2.7

9ac9c4a7bb37987af382c80647f42d84db5f2e1d

[ "Zlib" ]

1

2020-08-25T02:36:22.000Z

platform/hwconf_data/efr32mg12p/PythonSnippet/__init__.py

lenloe1/v2.7

9ac9c4a7bb37987af382c80647f42d84db5f2e1d

[ "Zlib" ]

1

2020-08-25T01:56:04.000Z

from efr32mg12p.halconfig import halconfig_types as types from efr32mg12p.halconfig import halconfig_dependency as dep

59

60

0.889831

16

118

6.4375

0.5

0.271845

0.446602

0.563107

0.737864

0

0.074766

0.09322

118

2

60

59

0.88785

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

8

b07d431d617852bd73715162ce5869c19a0aa875

69

py

Python

text2qdmr/datasets/__init__.py

guoyi118/sparqling-queries

8c9b9f517d6e05ac465a84df79f40484bc852c26

[ "MIT" ]

21

2021-09-14T11:33:05.000Z

2022-03-29T13:22:19.000Z

text2qdmr/datasets/__init__.py

guoyi118/sparqling-queries

8c9b9f517d6e05ac465a84df79f40484bc852c26

[ "MIT" ]

1

2022-02-14T21:13:15.000Z

2022-02-18T20:23:36.000Z

text2qdmr/datasets/__init__.py

guoyi118/sparqling-queries

8c9b9f517d6e05ac465a84df79f40484bc852c26

[ "MIT" ]

5

2021-09-20T08:54:55.000Z

2022-02-10T00:59:54.000Z

from . import qdmr from . import qdmr_full_break from . import utils

17.25

29

0.782609

11

69

4.727273

0.545455

0.576923

0.538462

0

0.173913

69

3

30

23

0.912281

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

b0941bb5d4bc2d524ea3c8dc791ca983698e613d

15,974

py

Python

python/dlxapi/api/resource_pools_api.py

dlens/dlxapi

189a6519240ce625d7a9cdb89e305a335d2aa045

[ "MIT" ]

null

python/dlxapi/api/resource_pools_api.py

dlens/dlxapi

189a6519240ce625d7a9cdb89e305a335d2aa045

[ "MIT" ]

1

2020-08-20T17:31:43.000Z

python/dlxapi/api/resource_pools_api.py

dlens/dlxapi

189a6519240ce625d7a9cdb89e305a335d2aa045

[ "MIT" ]

null

# coding: utf-8 """ Decision Lens API No description provided (generated by Swagger Codegen https://github.com/swagger-api/swagger-codegen) # noqa: E501 OpenAPI spec version: 1.0 Generated by: https://github.com/swagger-api/swagger-codegen.git """ from __future__ import absolute_import import re # noqa: F401 # python 2 and python 3 compatibility library import six from dlxapi.api_client import ApiClient class ResourcePoolsApi(object): """NOTE: This class is auto generated by the swagger code generator program. Do not edit the class manually. Ref: https://github.com/swagger-api/swagger-codegen """ def __init__(self, api_client=None): if api_client is None: api_client = ApiClient() self.api_client = api_client def get_resource_pool(self, id, **kwargs): # noqa: E501 """Retrieves a resource pool. # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_pool(id, async_req=True) >>> result = thread.get() :param async_req bool :param str id: Resource Pool id (required) :param str portfolio_plan_id: Portfolio Plan id :return: ResourcePool If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_resource_pool_with_http_info(id, **kwargs) # noqa: E501 else: (data) = self.get_resource_pool_with_http_info(id, **kwargs) # noqa: E501 return data def get_resource_pool_with_http_info(self, id, **kwargs): # noqa: E501 """Retrieves a resource pool. # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_pool_with_http_info(id, async_req=True) >>> result = thread.get() :param async_req bool :param str id: Resource Pool id (required) :param str portfolio_plan_id: Portfolio Plan id :return: ResourcePool If the method is called asynchronously, returns the request thread. """ all_params = ['id', 'portfolio_plan_id'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_resource_pool" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if self.api_client.client_side_validation and ('id' not in params or params['id'] is None): # noqa: E501 raise ValueError("Missing the required parameter `id` when calling `get_resource_pool`") # noqa: E501 collection_formats = {} path_params = {} if 'id' in params: path_params['id'] = params['id'] # noqa: E501 query_params = [] if 'portfolio_plan_id' in params: query_params.append(('portfolioPlanId', params['portfolio_plan_id'])) # noqa: E501 header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json']) # noqa: E501 # Authentication setting auth_settings = ['OAuth2'] # noqa: E501 return self.api_client.call_api( '/resourcePools/{id}', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='ResourcePool', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_resource_pools_for_portfolio_plan(self, portfolio_plan_id, **kwargs): # noqa: E501 """Fetch resource pools for portfolio plan # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_pools_for_portfolio_plan(portfolio_plan_id, async_req=True) >>> result = thread.get() :param async_req bool :param str portfolio_plan_id: Portfolio Plan id (required) :param bool plan_overrides_only: Returns only plan overrides. default is false. :param str expand: JSON string containing an array expand specifications for fields. An expand specification must have a path and includes optional properties match, unique, allPossible, limit, offset, orderBy. :param int limit: Pagination limit :param int offset: Pagination offset :param str order_by: Comma delimited list of order by expressions. Use '-' in front of expression for reverse order. :param str match: Semi-colon delimited list of expressions to include in the response only the items in a collections that satisfy the expression(s). All other items should be exluded. :return: ResourcePools If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_resource_pools_for_portfolio_plan_with_http_info(portfolio_plan_id, **kwargs) # noqa: E501 else: (data) = self.get_resource_pools_for_portfolio_plan_with_http_info(portfolio_plan_id, **kwargs) # noqa: E501 return data def get_resource_pools_for_portfolio_plan_with_http_info(self, portfolio_plan_id, **kwargs): # noqa: E501 """Fetch resource pools for portfolio plan # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_pools_for_portfolio_plan_with_http_info(portfolio_plan_id, async_req=True) >>> result = thread.get() :param async_req bool :param str portfolio_plan_id: Portfolio Plan id (required) :param bool plan_overrides_only: Returns only plan overrides. default is false. :param str expand: JSON string containing an array expand specifications for fields. An expand specification must have a path and includes optional properties match, unique, allPossible, limit, offset, orderBy. :param int limit: Pagination limit :param int offset: Pagination offset :param str order_by: Comma delimited list of order by expressions. Use '-' in front of expression for reverse order. :param str match: Semi-colon delimited list of expressions to include in the response only the items in a collections that satisfy the expression(s). All other items should be exluded. :return: ResourcePools If the method is called asynchronously, returns the request thread. """ all_params = ['portfolio_plan_id', 'plan_overrides_only', 'expand', 'limit', 'offset', 'order_by', 'match'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_resource_pools_for_portfolio_plan" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'portfolio_plan_id' is set if self.api_client.client_side_validation and ('portfolio_plan_id' not in params or params['portfolio_plan_id'] is None): # noqa: E501 raise ValueError("Missing the required parameter `portfolio_plan_id` when calling `get_resource_pools_for_portfolio_plan`") # noqa: E501 collection_formats = {} path_params = {} query_params = [] if 'portfolio_plan_id' in params: query_params.append(('portfolioPlanId', params['portfolio_plan_id'])) # noqa: E501 if 'plan_overrides_only' in params: query_params.append(('planOverridesOnly', params['plan_overrides_only'])) # noqa: E501 if 'expand' in params: query_params.append(('expand', params['expand'])) # noqa: E501 if 'limit' in params: query_params.append(('limit', params['limit'])) # noqa: E501 if 'offset' in params: query_params.append(('offset', params['offset'])) # noqa: E501 if 'order_by' in params: query_params.append(('orderBy', params['order_by'])) # noqa: E501 if 'match' in params: query_params.append(('match', params['match'])) # noqa: E501 header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json']) # noqa: E501 # Authentication setting auth_settings = ['OAuth2'] # noqa: E501 return self.api_client.call_api( '/resourcePools', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='ResourcePools', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def update_resource_pool_budget_amounts_for_portfolio_plan(self, portfolio_plan_id, body, **kwargs): # noqa: E501 """Update resource pool budget amounts in a portfolio plan # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.update_resource_pool_budget_amounts_for_portfolio_plan(portfolio_plan_id, body, async_req=True) >>> result = thread.get() :param async_req bool :param str portfolio_plan_id: Portfolio Plan id (required) :param list[ResourcePoolBudgetAmountPatchItem] body: JSON Patch Operations to update multiple resource pool budget amounts (required) :return: list[ResourcePool] If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.update_resource_pool_budget_amounts_for_portfolio_plan_with_http_info(portfolio_plan_id, body, **kwargs) # noqa: E501 else: (data) = self.update_resource_pool_budget_amounts_for_portfolio_plan_with_http_info(portfolio_plan_id, body, **kwargs) # noqa: E501 return data def update_resource_pool_budget_amounts_for_portfolio_plan_with_http_info(self, portfolio_plan_id, body, **kwargs): # noqa: E501 """Update resource pool budget amounts in a portfolio plan # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.update_resource_pool_budget_amounts_for_portfolio_plan_with_http_info(portfolio_plan_id, body, async_req=True) >>> result = thread.get() :param async_req bool :param str portfolio_plan_id: Portfolio Plan id (required) :param list[ResourcePoolBudgetAmountPatchItem] body: JSON Patch Operations to update multiple resource pool budget amounts (required) :return: list[ResourcePool] If the method is called asynchronously, returns the request thread. """ all_params = ['portfolio_plan_id', 'body'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method update_resource_pool_budget_amounts_for_portfolio_plan" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'portfolio_plan_id' is set if self.api_client.client_side_validation and ('portfolio_plan_id' not in params or params['portfolio_plan_id'] is None): # noqa: E501 raise ValueError("Missing the required parameter `portfolio_plan_id` when calling `update_resource_pool_budget_amounts_for_portfolio_plan`") # noqa: E501 # verify the required parameter 'body' is set if self.api_client.client_side_validation and ('body' not in params or params['body'] is None): # noqa: E501 raise ValueError("Missing the required parameter `body` when calling `update_resource_pool_budget_amounts_for_portfolio_plan`") # noqa: E501 collection_formats = {} path_params = {} query_params = [] if 'portfolio_plan_id' in params: query_params.append(('portfolioPlanId', params['portfolio_plan_id'])) # noqa: E501 header_params = {} form_params = [] local_var_files = {} body_params = None if 'body' in params: body_params = params['body'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json-patch+json']) # noqa: E501 # Authentication setting auth_settings = ['OAuth2'] # noqa: E501 return self.api_client.call_api( '/resourcePools', 'PATCH', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='list[ResourcePool]', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats)

45.124294

219

0.640979

1,902

15,974

5.120925

0.109884

0.082752

0.063142

0.033368

0.901232

0.87731

0.867248

0.849692

0.846509

0.834292

0

0.014166

0.27526

15,974

353

220

45.252125

0.827157

0.369475

0

0.666667

1

0

0.201394

0.05008

0

1

0.037634

false

0

0.021505

0

0.112903

0

null

0

1

0

1

0

null

0

7

9fef8150fcbf221b127ad6da6196a6c0150a5bb6

8,551

py

Python

scrapy_random_fake_ua/middleware.py

zs527523251/scrapy-random-fake-ua

03862d6ee51361aa331579311aee4dc5ae893b06

[ "MIT" ]

1

2020-04-27T09:01:58.000Z

scrapy_random_fake_ua/middleware.py

zs527523251/scrapy-random-fake-ua

03862d6ee51361aa331579311aee4dc5ae893b06

[ "MIT" ]

null

scrapy_random_fake_ua/middleware.py

zs527523251/scrapy-random-fake-ua

03862d6ee51361aa331579311aee4dc5ae893b06

[ "MIT" ]

null

import logging from fake_useragent import UserAgent import random from scrapy.downloadermiddlewares.retry import RetryMiddleware from scrapy.utils.response import response_status_message logger = logging.getLogger(__name__) class RandomUserAgentMiddleware(object): def __init__(self, crawler): super(RandomUserAgentMiddleware, self).__init__() fallback = crawler.settings.get('FAKEUSERAGENT_FALLBACK', None) self.per_proxy = crawler.settings.get('RANDOM_UA_PER_PROXY', False) self.proxy2ua = {} self.user_agent_list = [ "Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2228.0 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_10_1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2227.1 Safari/537.36", "Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2227.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2227.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.3; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2226.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.4; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2225.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.3; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2225.0 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/41.0.2224.3 Safari/537.36", "Mozilla/5.0 (Windows NT 10.0) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/40.0.2214.93 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_10_1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/37.0.2062.124 Safari/537.36", "Mozilla/5.0 (Windows NT 6.3; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/37.0.2049.0 Safari/537.36", "Mozilla/5.0 (Windows NT 4.0; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/37.0.2049.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/36.0.1985.67 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/36.0.1985.67 Safari/537.36", "Mozilla/5.0 (X11; OpenBSD i386) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/36.0.1985.125 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_9_2) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/36.0.1944.0 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/35.0.3319.102 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/35.0.2309.372 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/35.0.2117.157 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_9_3) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/35.0.1916.47 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/34.0.1866.237 Safari/537.36", "Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/34.0.1847.137 Safari/4E423F", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/34.0.1847.116 Safari/537.36 Mozilla/5.0 (iPad; U; CPU OS 3_2 like Mac OS X; en-us) AppleWebKit/531.21.10 (KHTML, like Gecko) Version/4.0.4 Mobile/7B334b Safari/531.21.10", "Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/33.0.1750.517 Safari/537.36", "Mozilla/5.0 (Windows NT 6.2; Win64; x64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/32.0.1667.0 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_9_0) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/32.0.1664.3 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_8_0) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/32.0.1664.3 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/31.0.1650.16 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/31.0.1623.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.2; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/30.0.1599.17 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/29.0.1547.62 Safari/537.36", "Mozilla/5.0 (X11; CrOS i686 4319.74.0) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/29.0.1547.57 Safari/537.36", "Mozilla/5.0 (Windows NT 6.2; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/29.0.1547.2 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/28.0.1468.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.2) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/28.0.1467.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.2) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/28.0.1464.0 Safari/537.36", "Mozilla/5.0 (Windows NT 6.2; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1500.55 Safari/537.36", "Mozilla/5.0 (Windows NT 6.2; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.93 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.93 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.93 Safari/537.36", "Mozilla/5.0 (Windows NT 5.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.93 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_8_3) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.93 Safari/537.36", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_7_5) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.93 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.90 Safari/537.36", "Mozilla/5.0 (X11; NetBSD) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.116 Safari/537.36", "Mozilla/5.0 (X11; CrOS i686 3912.101.0) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/27.0.1453.116 Safari/537.36", "Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/537.17 (KHTML, like Gecko) Chrome/24.0.1312.60 Safari/537.17", "Mozilla/5.0 (Macintosh; Intel Mac OS X 10_8_2) AppleWebKit/537.17 (KHTML, like Gecko) Chrome/24.0.1309.0 Safari/537.17", "Mozilla/5.0 (Windows NT 6.2; WOW64) AppleWebKit/537.15 (KHTML, like Gecko) Chrome/24.0.1295.0 Safari/537.15", "Mozilla/5.0 (Windows NT 6.2; WOW64) AppleWebKit/537.14 (KHTML, like Gecko) Chrome/24.0.1292.0 Safari/537.14" ] @classmethod def from_crawler(cls, crawler): return cls(crawler) def process_request(self, request, spider): def get_ua(): """Gets random UA based on the type setting (random, firefox…)""" return random.choice(self.user_agent_list) request.headers.setdefault('User-Agent', get_ua()) class RetryUserAgentMiddleware(RetryMiddleware): """ Get random User-Agent set on request retry. Use this middleware in place of the built-in RetryMiddleware. """ def __init__(self, settings): super(RetryUserAgentMiddleware, self).__init__(settings) fallback = settings.get('FAKEUSERAGENT_FALLBACK', None) self.ua = UserAgent(fallback=fallback) self.ua_type = settings.get('RANDOM_UA_TYPE', 'random') def get_ua(self): """Gets random UA based on the type setting (random, firefox…)""" return random.choice(self.user_agent_list) def process_response(self, request, response, spider): if request.meta.get('dont_retry', False): return response if response.status in self.retry_http_codes: reason = response_status_message(response.status) request.headers['User-Agent'] = self.get_ua() return self._retry(request, reason, spider) or response return response def process_exception(self, request, exception, spider): if isinstance(exception, self.EXCEPTIONS_TO_RETRY) \ and not request.meta.get('dont_retry', False): request.headers['User-Agent'] = self.get_ua() return self._retry(request, exception, spider)

72.466102

259

0.664133

1,397

8,551

4.012885

0.141016

0.081163

0.081877

0.17838

0.7533

0.71691

0.70817

0.699786

0.649661

0

0.183045

0.194363

8,551

118

260

72.466102

0.629845

0.026313

0

0.065217

0

0.543478

0.680366

0.007834

0

1

0.086957

false

0

0.054348

0.01087

0.23913

0

null

0

1

0

1

0

1

0

1

0

null

0

7

b0016dec0dd77b42e44faa9d26826068995e147e

3,886

py

Python

module/util/Exceptions.py

btr1975/SimpleCliTools

dc4c9e114487e68e6b8d7380bdbbb0130a95885e

[ "MIT" ]

1

2018-12-20T07:12:52.000Z

module/util/Exceptions.py

btr1975/SimpleCliTools

dc4c9e114487e68e6b8d7380bdbbb0130a95885e

[ "MIT" ]

null

module/util/Exceptions.py

btr1975/SimpleCliTools

dc4c9e114487e68e6b8d7380bdbbb0130a95885e

[ "MIT" ]

1

2019-09-05T06:44:48.000Z

#!/usr/bin/env python3 __author__ = 'Benjamin P. Trachtenberg' __copyright__ = "Copyright (c) 2016, Benjamin P. Trachtenberg" __credits__ = None __license__ = 'The MIT License (MIT)' __status__ = 'prod' __version_info__ = (1, 0, 1, __status__) __version__ = '.'.join(map(str, __version_info__)) __maintainer__ = 'Benjamin P. Trachtenberg' __email__ = 'e_ben_75-python@yahoo.com' class BadUniCastIP(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadUniCastIpNetwork(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadMultiCastIpNetwork(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadMultiCastIp(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadBgpCommunity(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadBgpAsNumber(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadEigrpAsNumber(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadVlanNumber(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BadDeviceType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class SequenceError(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidNatType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidNatArguments(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidLeGeType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidCidrValue(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidPermitOrDenyType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidMatchOrSetType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidMatchType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidSetType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class RequiredEigrpProcessName(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class NotNumber(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidSwitchPortType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class InvalidInterfaceType(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value) class BgpAsRequiredForMpls(Exception): def __init__(self, value): self.value = value def __str__(self): return repr(self.value)

18.074419

62

0.65054

438

3,886

5.242009

0.146119

0.27047

0.160279

0.200348

0.729094

0

0.00342

0.247555

3,886

215

63

18.074419

0.781806

0.005404

0

0.741935

0

0.036999

0.006468

0

1

0.370968

false

0

0.185484

0.741935

0

null

1

0

1

0

1

0

1

0

null

0

1

0

1

0

11

b06be25a00f6356dbfff958cce112cea87b5fd84

13

py

Python

tests/syntax/invalid_octal.py

matan-h/friendly

3ab0fc6541c837271e8865e247750007acdd18fb

[ "MIT" ]

287

2019-04-08T13:18:29.000Z

2021-03-14T19:10:21.000Z

tests/syntax/invalid_octal.py

matan-h/friendly

3ab0fc6541c837271e8865e247750007acdd18fb

[ "MIT" ]

191

2019-04-08T14:39:18.000Z

2021-03-14T22:14:56.000Z

tests/syntax/invalid_octal.py

matan-h/friendly

3ab0fc6541c837271e8865e247750007acdd18fb

[ "MIT" ]

9

2019-04-08T12:54:08.000Z

2020-11-20T02:26:27.000Z

b = 0O1876

3.25

10

0.538462

2

13

3.5

1

0

0.625

0.384615

13

3

11

4.333333

0.25

0

null

0

null

0

1

0

null

0

1

0

1

0

1

0

null

0

1

0

7

c682389146fc8e5bc50013e729df6855a664bbd8

9,360

py

Python

Protheus_WebApp/Modules/SIGACTB/CTBA355TESTCASE.py

98llm/tir-script-samples

0bff8393b79356aa562e9e6512c11ee6e039b177

[ "MIT" ]

17

2018-09-24T17:27:08.000Z

2021-09-16T19:09:46.000Z

Protheus_WebApp/Modules/SIGACTB/CTBA355TESTCASE.py

98llm/tir-script-samples

0bff8393b79356aa562e9e6512c11ee6e039b177

[ "MIT" ]

4

2018-09-24T17:30:32.000Z

2022-01-03T11:39:30.000Z

Protheus_WebApp/Modules/SIGACTB/CTBA355TESTCASE.py

98llm/tir-script-samples

0bff8393b79356aa562e9e6512c11ee6e039b177

[ "MIT" ]

18

2019-06-07T17:41:34.000Z

2022-01-31T18:17:31.000Z

from tir import Webapp import unittest class CTBA355(unittest.TestCase): @classmethod def setUpClass(inst): inst.oHelper = Webapp() inst.oHelper.Setup("SIGACTB", "01/02/2016", "T1", "D MG 01 ", "34") inst.oHelper.Program("CTBA355") # ================================================================== # Conferir não conferidos. # ================================================================== def test_CTBA355_001(self): self.oHelper.SetButton("Conferir") #Re-analise self.oHelper.SetBranch("D MG 01 ") self.oHelper.SetValue("Conferir ?", "Nao conferidos") self.oHelper.SetValue("Da Data ?", "01/02/2016") self.oHelper.SetValue("Ate a Data ?", "01/02/2016") self.oHelper.SetValue("Valor minimo ?", "0,00") self.oHelper.SetValue("Valor maximo ?", "999.999.999.999,99") self.oHelper.SetValue("Do Lote ?", "") self.oHelper.SetValue("Ate o Lote ?", "ZZZZZZ") self.oHelper.SetValue("Do SubLote ?", "") self.oHelper.SetValue("Ate o Sublote ?", "ZZZ") self.oHelper.SetValue("Do Documento ?", "") self.oHelper.SetValue("Ate o Documento ?", "ZZZZZZ") self.oHelper.SetValue("Moeda ?", "01") self.oHelper.SetValue("Tipo de saldo ?", "1") self.oHelper.SetValue("Conta ?", "101020") self.oHelper.SetValue("Centro de custo ?", "") self.oHelper.SetValue("Item contabil ?", "") self.oHelper.SetValue("Classe de valor ?", "") self.oHelper.SetValue("Acao do clique ?", "Conferir") self.oHelper.SetButton("OK") self.oHelper.WaitShow("Conferencia de lancamentos - CONFERIR") self.oHelper.ClickBox("Data Lcto","01/02/2016" ,grid_number=1) self.oHelper.SetButton("Salvar") #self.oHelper.WaitShow("Deseja confirmar os registros marcados?") #self.oHelper.SetButton("Sim") self.oHelper.SetButton("Cancelar") self.oHelper.AssertTrue() # ================================================================== # Estornar conferidos. # ================================================================== def test_CTBA355_002(self): self.oHelper.SetButton("Outras Ações","Estornar") #Estornar #self.oHelper.SetBranch("D MG 01 ") self.oHelper.SetValue("Estornar ?", "Conferidos") self.oHelper.SetValue("Da Data ?", "01/02/2016") self.oHelper.SetValue("Ate a Data ?", "01/02/2016") self.oHelper.SetValue("Valor minimo ?", "0,00") self.oHelper.SetValue("Valor maximo ?", "999.999.999.999,99") self.oHelper.SetValue("Do Lote ?", "") self.oHelper.SetValue("Ate o Lote ?", "ZZZZZZ") self.oHelper.SetValue("Do SubLote ?", "") self.oHelper.SetValue("Ate o Sublote ?", "ZZZ") self.oHelper.SetValue("Do Documento ?", "") self.oHelper.SetValue("Ate o Documento ?", "ZZZZZZ") self.oHelper.SetValue("Moeda ?", "01") self.oHelper.SetValue("Tipo de saldo ?", "1") self.oHelper.SetValue("Conta ?", "101030") self.oHelper.SetValue("Centro de custo ?", "") self.oHelper.SetValue("Item contabil ?", "") self.oHelper.SetValue("Classe de valor ?", "") self.oHelper.SetValue("Acao do clique ?", "Estornar") self.oHelper.SetButton("OK") self.oHelper.WaitShow("Conferencia de lancamentos - ESTORNAR") self.oHelper.ClickBox("Data Lcto","01/02/2016" ,grid_number=1) self.oHelper.SetButton("Confirmar") #self.oHelper.WaitShow("Deseja confirmar os registros marcados?") #self.oHelper.SetButton("Sim") #self.oHelper.SetButton("Cancelar") self.oHelper.AssertTrue() # ================================================================== # Re-analise náo conferidos # ================================================================== def test_CTBA355_003(self): self.oHelper.SetButton("Conferir") #Re-analise self.oHelper.SetBranch("D MG 01 ") self.oHelper.SetValue("Conferir ?", "Nao conferidos") self.oHelper.SetValue("Da Data ?", "01/02/2016") self.oHelper.SetValue("Ate a Data ?", "01/02/2016") self.oHelper.SetValue("Valor minimo ?", "0,00") self.oHelper.SetValue("Valor maximo ?", "999.999.999.999,99") self.oHelper.SetValue("Do Lote ?", "") self.oHelper.SetValue("Ate o Lote ?", "ZZZZZZ") self.oHelper.SetValue("Do SubLote ?", "") self.oHelper.SetValue("Ate o Sublote ?", "ZZZ") self.oHelper.SetValue("Do Documento ?", "") self.oHelper.SetValue("Ate o Documento ?", "ZZZZZZ") self.oHelper.SetValue("Moeda ?", "01") self.oHelper.SetValue("Tipo de saldo ?", "1") self.oHelper.SetValue("Conta ?", "101010") self.oHelper.SetValue("Centro de custo ?", "") self.oHelper.SetValue("Item contabil ?", "") self.oHelper.SetValue("Classe de valor ?", "") self.oHelper.SetValue("Acao do clique ?", "Re-analise") self.oHelper.SetButton("OK") self.oHelper.WaitShow("Conferencia de lancamentos - CONFERIR") self.oHelper.ClickBox("Data Lcto","01/02/2016" ,grid_number=1) self.oHelper.SetButton("Salvar") self.oHelper.CheckHelp("Deseja confirmar os registros marcados?","Sim") self.oHelper.SetButton("Cancelar") self.oHelper.AssertTrue() # ================================================================== # Tela de visualizar, teste abertura,caso tela, REGISTRO CORRENTE # ================================================================== def test_CTBA355_004(self): self.oHelper.SetButton("Vis. Lancamento") self.oHelper.SetButton("Cancelar") self.oHelper.AssertTrue() # ================================================================== # Tela detalhes, localizar, teste abertura, caso tela # ================================================================== def test_CTBA355_005(self): self.oHelper.SetButton("Conferir") #Re-analise self.oHelper.SetBranch("D MG 01 ") self.oHelper.SetValue("Conferir ?", "Nao conferidos") self.oHelper.SetValue("Da Data ?", "01/02/2016") self.oHelper.SetValue("Ate a Data ?", "01/02/2016") self.oHelper.SetValue("Valor minimo ?", "0,00") self.oHelper.SetValue("Valor maximo ?", "999.999.999.999,99") self.oHelper.SetValue("Do Lote ?", "") self.oHelper.SetValue("Ate o Lote ?", "ZZZZZZ") self.oHelper.SetValue("Do SubLote ?", "") self.oHelper.SetValue("Ate o Sublote ?", "ZZZ") self.oHelper.SetValue("Do Documento ?", "") self.oHelper.SetValue("Ate o Documento ?", "ZZZZZZ") self.oHelper.SetValue("Moeda ?", "01") self.oHelper.SetValue("Tipo de saldo ?", "1") self.oHelper.SetValue("Conta ?", "101040") self.oHelper.SetValue("Centro de custo ?", "") self.oHelper.SetValue("Item contabil ?", "") self.oHelper.SetValue("Classe de valor ?", "") self.oHelper.SetValue("Acao do clique ?", "Conferir") self.oHelper.SetButton("OK") ##Detalhes teste de abertura da tela self.oHelper.SetButton("Outras Ações","Detalhes") self.oHelper.SetButton("Confirmar") #Localizar teste de abertura de tela self.oHelper.SetButton("Outras Ações","Localizar") self.oHelper.SetValue("Campo:","Data Lcto") self.oHelper.SetValue("Operador:","Igual a") self.oHelper.SetValue("cExpr","01/02/2016",name_attr=True) self.oHelper.SetButton("Adiciona") self.oHelper.SetButton("Avançar") #self.oHelper.WaitShow("Conferencia de lancamentos - CONFERIR") #self.oHelper.ClickBox("Data Lcto","01/02/2016" ,grid_number=1) ##self.oHelper.ClickBox("Data Lcto","01/02/2016" ,grid_number=1) self.oHelper.SetButton("Salvar") #self.oHelper.WaitShow("Deseja confirmar os registros marcados?") #self.oHelper.SetButton("Sim") self.oHelper.SetButton("Cancelar") self.oHelper.AssertTrue() @classmethod def tearDownClass(inst): inst.oHelper.TearDown() if __name__ == '__main__': unittest.main()

49.005236

100

0.499893

870

9,360

5.350575

0.137931

0.290655

0.306122

0.075618

0.813319

0.799356

0.784318

0.760902

0.75145

0

0.042262

0.297222

9,360

190

101

49.263158

0.6654

0.176816

0

0.738462

0

0.233768

0

0.038462

1

0.053846

false

0

0.015385

0

0.076923

0

null

1

0

1

0

1

0

null

0

9

05e2142137c1cf695d250de660b58d42cc5af9d9

13,576

py

Python

tests/test_routes.py

AmazingJinwei/recommendations

409b3bb9012fdfb9e93dd339507318d8b9cee375

[ "Apache-2.0" ]

null

tests/test_routes.py

AmazingJinwei/recommendations

409b3bb9012fdfb9e93dd339507318d8b9cee375

[ "Apache-2.0" ]

null

tests/test_routes.py

AmazingJinwei/recommendations

409b3bb9012fdfb9e93dd339507318d8b9cee375

[ "Apache-2.0" ]

null

""" TestYourResourceModel API Service Test Suite Test cases can be run with the following: nosetests -v --with-spec --spec-color coverage report -m """ import os import logging from unittest import TestCase from unittest.mock import MagicMock, patch from flask import json from service import status # HTTP Status Codes from service.models import db from service.routes import app, init_db from service.models import Recommendations # Product_id PO = 3 PT = 5 RL = 1 ###################################################################### # T E S T C A S E S ###################################################################### class TestYourResourceServer(TestCase): """ REST API Server Tests """ @classmethod def setUpClass(cls): """ This runs once before the entire test suite """ app.debug = False # global app Recommendations.init_db(app) # pass @classmethod def tearDownClass(cls): """ This runs once after the entire test suite """ pass def setUp(self): """ This runs before each test """ db.drop_all() db.create_all() self.app = app.test_client() def tearDown(self): """ This runs after each test """ db.session.remove() db.drop_all() # pass ###################################################################### # P L A C E T E S T C A S E S H E R E ###################################################################### def test_index(self): """ Test index call """ resp = self.app.get("/") self.assertEqual(resp.status_code, status.HTTP_200_OK) def test_add_a_recommendation(self): """ Create a recommendation and add it to the database """ recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_201_CREATED) self.assertEqual(resp_data['product_origin'], 2) self.assertEqual(resp_data['product_target'], 3) self.assertEqual(resp_data['relation'], 1) self.assertEqual(resp_data['dislike'], 0) self.assertEqual(resp_data['is_deleted'], 0) def test_add_a_recommendation_includes_bad_data(self): """ Create a recommendation includes bad data """ recommendation_rawdata = {'product_origin': "bad data", 'product_target': 3, 'relation': 1, 'dislike': 0} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_400_BAD_REQUEST) recommendation_rawdata = {'product_origin': 1, 'product_target': "bad data", 'relation': 1, 'dislike': 0} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_400_BAD_REQUEST) recommendation_rawdata = {'product_origin': 1, 'product_target': 3, 'relation': "bad data", 'dislike': 0} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_400_BAD_REQUEST) recommendation_rawdata = {'product_origin': 1, 'product_target': 3, 'relation': 1, 'dislike': "bad data"} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_400_BAD_REQUEST) def test_add_a_had_deleted_recommendation(self): """ Create a same recommendations and add it to the database """ # post the same data recommendation_rawdata = {'product_origin': 3, 'product_target': 4, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_201_CREATED) self.assertEqual(resp_data['product_origin'], 3) self.assertEqual(resp_data['product_target'], 4) self.assertEqual(resp_data['relation'], 1) self.assertEqual(resp_data['dislike'], 0) self.assertEqual(resp_data['is_deleted'], 0) resp_delete = self.app.delete('/recommendations/1') self.assertEqual(resp_delete.status_code, status.HTTP_204_NO_CONTENT) self.assertEqual(len(resp_delete.data), 0) resp = self.app.get('/recommendations/1') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_200_OK) self.assertTrue(resp is not None) self.assertEqual(resp_data['product_origin'], 3) self.assertEqual(resp_data['product_target'], 4) self.assertEqual(resp_data['relation'], 1) self.assertEqual(resp_data['dislike'], 0) self.assertEqual(resp_data['is_deleted'], 1) recommendation_rawdata = {'product_origin': 3, 'product_target': 4, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_201_CREATED) self.assertEqual(resp_data['product_origin'], 3) self.assertEqual(resp_data['product_target'], 4) self.assertEqual(resp_data['relation'], 1) self.assertEqual(resp_data['dislike'], 0) self.assertEqual(resp_data['is_deleted'], 0) def test_retrieve_a_reconmmendation(self): """ Read a Recommendation """ recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) resp = self.app.get('/recommendations/1') self.assertEqual(resp.status_code, status.HTTP_200_OK) self.assertTrue(resp is not None) resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_200_OK) self.assertEqual(resp_data['product_origin'], 2) self.assertEqual(resp_data['product_target'], 3) self.assertEqual(resp_data['relation'], 1) self.assertEqual(resp_data['dislike'], 0) self.assertEqual(resp_data['is_deleted'], 0) def test_retrieve_a_reconmmendation_on_product_originrelation(self): """Read a Recommendation based on product_origin and relation""" recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) resp = self.app.get('/recommendations?product-id=2&relation=1') resp_data = resp.get_json() # self.assertEqual(resp.status_code, status.HTTP_405_METHOD_NOT_ALLOWED) self.assertEqual(resp.status_code, status.HTTP_200_OK) self.assertTrue(resp is not None) self.assertEqual(resp_data[0]['product_origin'], 2) self.assertEqual(resp_data[0]['product_target'], 3) self.assertEqual(resp_data[0]['relation'], 1) self.assertEqual(resp_data[0]['dislike'], 0) self.assertEqual(resp_data[0]['is_deleted'], 0) # test for no result resp = self.app.get('/recommendations?product-id=2&relation=2') resp_data = resp.get_json() self.assertEqual(resp.status_code, status.HTTP_200_OK) self.assertEqual(resp_data, []) def test_not_find_a_reconmmendation(self): """ Not found a Recommendation """ # not found resp = self.app.get('/recommendations/99') resp_data = json.loads(resp.data) self.assertTrue(resp is not None) recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/txt') self.assertEqual(resp.status_code, status.HTTP_415_UNSUPPORTED_MEDIA_TYPE) def test_delete_a_recommendation(self): """ Delete a Recommendation """ # delete a recommendation recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) self.assertEqual(resp.status_code, status.HTTP_201_CREATED) resp = self.app.delete('/recommendations/1') self.assertEqual(resp.status_code, status.HTTP_204_NO_CONTENT) self.assertEqual(len(resp.data), 0) def test_update_a_recommendation(self): """ Update a Recommendation """ recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) self.assertEqual(resp.status_code, status.HTTP_201_CREATED) new_date = {'product_origin': 3, 'product_target': 4, 'dislike': 0, 'relation': 1} data_json = json.dumps(new_date) resp = self.app.put('/recommendations/1', data=data_json, content_type='application/json') self.assertEqual(resp.status_code, status.HTTP_200_OK) resp_data = json.loads(resp.data) self.assertEqual(resp_data['product_origin'], 3) self.assertEqual(resp_data['product_target'], 4) self.assertEqual(resp_data['relation'], 1) self.assertEqual(resp_data['dislike'], 0) self.assertEqual(resp_data['is_deleted'], 0) resp = self.app.put('/recommendations/2', data=data_json, content_type='application/json') self.assertEqual(resp.status_code, status.HTTP_404_NOT_FOUND) def test_dislike_recommendations(self): """ Dislike the Recommendations""" recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) self.assertEqual(resp.status_code, status.HTTP_201_CREATED) resp_data = json.loads(resp.data) self.assertEqual(resp_data['product_origin'], 2) self.assertEqual(resp_data['product_target'], 3) self.assertEqual(resp_data['relation'], 1) self.assertEqual(resp_data['dislike'], 0) self.assertEqual(resp_data['is_deleted'], 0) resp = self.app.put('/recommendations/1/dislike', data=data_json, content_type='application/json') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_200_OK) self.assertEqual(resp_data['dislike'], 1) resp = self.app.put('/recommendations/2/dislike', data=data_json, content_type='application/json') self.assertEqual(resp.status_code, status.HTTP_404_NOT_FOUND) def test_reset_recommendations(self): """ Reset the Recommendations""" recommendation_rawdata = {'product_origin': 2, 'product_target': 3, 'dislike': 0, 'relation': 1} data_json = json.dumps(recommendation_rawdata) resp = self.app.post("/recommendations", data=data_json, content_type='application/json') location = resp.headers.get('Location', None) self.assertTrue(location is not None) self.assertEqual(resp.status_code, status.HTTP_201_CREATED) resp = self.app.delete('/recommendations/reset') self.assertEqual(resp.status_code, status.HTTP_204_NO_CONTENT) self.assertEqual(len(resp.data), 0) resp = self.app.get('/recommendations') resp_data = json.loads(resp.data) self.assertEqual(resp.status_code, status.HTTP_200_OK) self.assertEqual(resp_data, []) def test_method_not_supported(self): """ Method not supported """ resp = self.app.trace('/recommendations') self.assertEqual(resp.status_code, status.HTTP_405_METHOD_NOT_ALLOWED)

46.020339

113

0.663524

1,673

13,576

5.176928

0.095637

0.069276

0.155756

0.11419

0.838471

0.81942

0.794596

0.770927

0.758111

0.743217

0

0.018751

0.194682

13,576

295

114

46.020339

0.773438

0.072113

0

0.676329

0

0.163142

0.012625

0

0.410628

1

0.077295

false

0.004831

0.043478

0

0.125604

0

null

0

1

0

null

0

1

0

7

05fb1b7f2aaca140dad4e4c99c26296b08356cf5

17,038

py

Python

scripts/simulateFragmentMatrix.py

gbotev1/haplotype-phasing

2bf7586733b65818b7a2931bac046f6307575af2

[ "MIT" ]

null

scripts/simulateFragmentMatrix.py

gbotev1/haplotype-phasing

2bf7586733b65818b7a2931bac046f6307575af2

[ "MIT" ]

null

scripts/simulateFragmentMatrix.py

gbotev1/haplotype-phasing

2bf7586733b65818b7a2931bac046f6307575af2

[ "MIT" ]

null

#Charlotte Darby cdarby@jhu.edu #updated 11-16-17 import argparse import random,numpy,math def diploidPairedend(fragmentlength,insertlength,height, width, gaprate, errorrate,k,outLong,out): n_gaps = 0 n_errors = 0 haplotype = numpy.random.choice([0,1],width) #generate a random haplotype if outLong != None: outLong = open(outLong,"w") with open(args.matrixout,"w") as out: if args.longfmt: outLong.write(str(height) + "\n" + str(width) + "\n") if insertlength == None: insertlength = 0 else: insertlength = int(insertlength) if fragmentlength == None: fragmentlength = (width-insertlength)/2 else: fragmentlength = int(fragmentlength) span=2*fragmentlength+insertlength #assert span <= width end = width-span+1 #index where rightmost fragment could start +1 [OR] number of fragment starting points startpoints = [] persite = height/end #rounds down for _ in xrange(persite): startpoints += range(0,end) remaining = height - persite * end #assert remaining < end if remaining > 0: if 1.0*end/remaining < 2: #choose places where fragments won't start instead of places where they will step = end/(end-remaining) #number of places to choose A = range(0,end,step) startpoints += [i for i in xrange(end) if i not in A][:remaining] #"complement" of the sequence else: #choose places where fragments will start step = end/remaining startpoints += range(0,end,step)[:remaining] #assert len(startpoints) == height == remaining + persite * end random.shuffle(startpoints) if len(startpoints) < remaining: for sp in xrange(remaining-len(startpoints)): startpoints.append(sp) H0 = startpoints[0::2] H1 = startpoints[1::2] for i in H0: #number of gaps to put in front prefix = ["-" for _ in xrange(i)] suffix = ["-" for _ in xrange(i+span,width)] insert = ["-" for _ in xrange(insertlength)] fragment1 = [haplotype[q] for q in xrange(i,i+fragmentlength)] #ints fragment2 = [haplotype[q] for q in xrange(i+fragmentlength+insertlength,i+span)] #ints for f in xrange(len(fragment1)): if random.random() < gaprate: fragment1[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment1[f] = str(abs(1-fragment1[f])) n_errors += 1 else: fragment1[f] = str(fragment1[f]) for f in xrange(len(fragment2)): if random.random() < gaprate: fragment2[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment2[f] = str(abs(1-fragment2[f])) n_errors += 1 else: fragment2[f] = str(fragment2[f]) if args.longfmt: outLong.write("".join(prefix) + "".join(fragment1) + "".join(insert) + "".join(fragment2) + "".join(suffix) + "\n") out.write(str(i) + "\t" + "".join(fragment1) + "".join(insert) + "".join(fragment2) + "\n") for i in H1: #number of gaps to put in front prefix = ["-" for _ in xrange(i)] suffix = ["-" for _ in xrange(i+span,width)] insert = ["-" for _ in xrange(insertlength)] fragment1 = [abs(1-haplotype[q]) for q in xrange(i,i+fragmentlength)] #ints fragment2 = [abs(1-haplotype[q]) for q in xrange(i+fragmentlength+insertlength,i+span)] #ints for f in xrange(len(fragment1)): if random.random() < gaprate: fragment1[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment1[f] = str(abs(1-fragment1[f])) n_errors += 1 else: fragment1[f] = str(fragment1[f]) for f in xrange(len(fragment2)): if random.random() < gaprate: fragment2[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment2[f] = str(abs(1-fragment2[f])) n_errors += 1 else: fragment2[f] = str(fragment2[f]) if args.longfmt: outLong.write("".join(prefix) + "".join(fragment1) + "".join(insert) + "".join(fragment2) + "".join(suffix) + "\n") out.write(str(i) + "\t" + "".join(fragment1) + "".join(insert) + "".join(fragment2) + "\n") if outLong != None: out.close() print str(n_gaps) + " gaps" print str(n_errors) + " errors" return [haplotype] def kploidPairedend(fragmentlength,insertlength,height, width, gaprate, errorrate,k,outLong,out): n_gaps = 0 n_errors = 0 haplotypes = [] for _ in xrange(k): haplotypes.append([]) for _ in xrange(width): #for each site, there is at least one 0 and at least one 1, but others are randomly selected alleles = numpy.ndarray.tolist(numpy.random.choice([0,1],k-2)) + [0,1] random.shuffle(alleles) for i in xrange(len(haplotypes)): haplotypes[i].append(alleles[i]) if outLong != None: outLong = open(outLong,"w") with open(args.matrixout,"w") as out: if args.longfmt: outLong.write(str(height) + "\n" + str(width) + "\n") if insertlength == None: insertlength = 0 else: insertlength = int(insertlength) if fragmentlength == None: fragmentlength = (width-insertlength)/2 else: fragmentlength = int(fragmentlength) span=2*fragmentlength+insertlength #assert span <= width end = width-span+1 #index where rightmost fragment could start +1 [OR] number of fragment starting points startpoints = [] persite = height/end #rounds down for _ in xrange(persite): startpoints += range(0,end) remaining = height - persite * end #assert remaining < end if remaining > 0: if 1.0*end/remaining < 2: #choose places where fragments won't start instead of places where they will step = end/(end-remaining) #number of places to choose A = range(0,end,step) startpoints += [i for i in xrange(end) if i not in A][:remaining] #"complement" of the sequence else: #choose places where fragments will start step = end/remaining startpoints += range(0,end,step)[:remaining] #assert len(startpoints) == height == remaining + persite * end random.shuffle(startpoints) if len(startpoints) < remaining: for sp in xrange(remaining-len(startpoints)): startpoints.append(sp) #assign start points to haplotypes allH = [] for h in xrange(k): allH.append(startpoints[h::k]) for h,H in enumerate(allH): for i in H: #number of gaps to put in front prefix = ["-" for _ in xrange(i)] suffix = ["-" for _ in xrange(i+span,width)] insert = ["-" for _ in xrange(insertlength)] fragment1 = [haplotypes[h][q] for q in xrange(i,i+fragmentlength)] #ints fragment2 = [haplotypes[h][q] for q in xrange(i+fragmentlength+insertlength,i+span)] #ints for f in xrange(len(fragment1)): if random.random() < gaprate: fragment1[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment1[f] = str(abs(1-fragment1[f])) n_errors += 1 else: fragment1[f] = str(fragment1[f]) for f in xrange(len(fragment2)): if random.random() < gaprate: fragment2[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment2[f] = str(abs(1-fragment2[f])) n_errors += 1 else: fragment2[f] = str(fragment2[f]) if args.longfmt: outLong.write("".join(prefix) + "".join(fragment1) + "".join(insert) + "".join(fragment2) + "".join(suffix) + "\n") out.write(str(i) + "\t" + "".join(fragment1) + "".join(insert) + "".join(fragment2) + "\n") if outLong != None: out.close() print str(n_gaps) + " gaps" print str(n_errors) + " errors" return haplotypes def diploid(fragmentlength,height, width, gaprate, errorrate,k,outLong,out): n_gaps = 0 n_errors = 0 haplotype = numpy.random.choice([0,1],width) #generate a random haplotype if outLong != None: outLong = open(outLong,"w") with open(args.matrixout,"w") as out: if args.longfmt: outLong.write(str(height) + "\n" + str(width) + "\n") if fragmentlength == None: fragmentlength = width else: fragmentlength = int(fragmentlength) end = width-fragmentlength+1 #index where rightmost fragment could start +1 [OR] number of fragment starting points startpoints = [] persite = height/end #rounds down for _ in xrange(persite): startpoints += range(0,end) remaining = height - persite * end #assert remaining < end if remaining > 0: if 1.0*end/remaining < 2: #choose places where fragments won't start instead of places where they will step = end/(end-remaining) #number of places to choose A = range(0,end,step) startpoints += [i for i in xrange(end) if i not in A][:remaining] #"complement" of the sequence else: #choose places where fragments will start step = end/remaining startpoints += range(0,end,step)[:remaining] #assert len(startpoints) == height == remaining + persite * end random.shuffle(startpoints) if len(startpoints) < remaining: for sp in xrange(remaining-len(startpoints)): startpoints.append(sp) H0 = startpoints[0::2] H1 = startpoints[1::2] for i in H0: #number of gaps to put in front prefix = ["-" for _ in xrange(i)] #fragment = [ "-" if random.random() < gaprate else str(haplotype[ch]) if random.random() > errorrate else str(abs(1-haplotype[ch])) for ch in xrange(i,i+fragmentlength)] suffix = ["-" for _ in xrange(i+fragmentlength,width)] fragment = [haplotype[q] for q in xrange(i,i+fragmentlength)] #ints for f in xrange(len(fragment)): if random.random() < gaprate: fragment[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment[f] = str(abs(1-fragment[f])) n_errors += 1 else: fragment[f] = str(fragment[f]) if args.longfmt: outLong.write("".join(prefix) + "".join(fragment) + "".join(suffix) + "\n") out.write(str(i) + "\t" + "".join(fragment) + "\n") for i in H1: #number of gaps to put in front prefix = ["-" for _ in xrange(i)] #fragment = [ "-" if random.random() < gaprate else str(haplotype[ch]) if random.random() < errorrate else str(abs(1-haplotype[ch])) for ch in xrange(i,i+fragmentlength)] #h1 = opposite of h0; change to < errorrate suffix = ["-" for _ in xrange(i+fragmentlength,width)] fragment = [abs(1-haplotype[q]) for q in xrange(i,i+fragmentlength)] #ints for f in xrange(len(fragment)): if random.random() < gaprate: fragment[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment[f] = str(abs(1-fragment[f])) n_errors += 1 else: fragment[f] = str(fragment[f]) if args.longfmt: outLong.write("".join(prefix) + "".join(fragment) + "".join(suffix) + "\n") out.write(str(i) + "\t" + "".join(fragment) + "\n") if outLong != None: out.close() print str(n_gaps) + " gaps" print str(n_errors) + " errors" return [haplotype] def kploid(fragmentlength,height, width, gaprate, errorrate,k,outLong,out): n_gaps = 0 n_errors = 0 haplotypes = [] for _ in xrange(k): haplotypes.append([]) for _ in xrange(width): #for each site, there is at least one 0 and at least one 1, but others are randomly selected alleles = numpy.ndarray.tolist(numpy.random.choice([0,1],k-2)) + [0,1] random.shuffle(alleles) for i in xrange(len(haplotypes)): haplotypes[i].append(alleles[i]) if outLong != None: outLong = open(outLong,"w") with open(args.matrixout,"w") as out: if args.longfmt: outLong.write(str(height) + "\n" + str(width) + "\n") if fragmentlength == None: fragmentlength = width else: fragmentlength = int(fragmentlength) end = width-fragmentlength+1 #index where rightmost fragment could start +1 [OR] number of fragment starting points startpoints = [] persite = height/end #rounds down for _ in xrange(persite): startpoints += range(0,end) remaining = height - persite * end #assert remaining < end if remaining > 0: if 1.0*end/remaining < 2: #choose places where fragments won't start instead of places where they will step = end/(end-remaining) #number of places to choose A = range(0,end,step) startpoints += [i for i in xrange(end) if i not in A][:remaining] #"complement" of the sequence else: #choose places where fragments will start step = end/remaining startpoints += range(0,end,step)[:remaining] #assert len(startpoints) == height == remaining + persite * end random.shuffle(startpoints) if len(startpoints) < remaining: for sp in xrange(remaining-len(startpoints)): startpoints.append(sp) #assign start points to haplotypes allH = [] for h in xrange(k): allH.append(startpoints[h::k]) for h,H in enumerate(allH): for i in H: #number of gaps to put in front prefix = ["-" for _ in xrange(i)] #fragment = [ "-" if random.random() < gaprate else str(haplotype[ch]) if random.random() > errorrate else str(abs(1-haplotype[ch])) for ch in xrange(i,i+fragmentlength)] suffix = ["-" for _ in xrange(i+fragmentlength,width)] fragment = [haplotypes[h][q] for q in xrange(i,i+fragmentlength)] #ints for f in xrange(len(fragment)): if random.random() < gaprate: fragment[f] = "-" n_gaps += 1 elif random.random() < errorrate: fragment[f] = str(abs(1-fragment[f])) n_errors += 1 else: fragment[f] = str(fragment[f]) if args.longfmt: outLong.write("".join(prefix) + "".join(fragment) + "".join(suffix) + "\n") out.write(str(i) + "\t" + "".join(fragment) + "\n") if outLong != None: out.close() print str(n_gaps) + " gaps" print str(n_errors) + " errors" return haplotypes parser = argparse.ArgumentParser(description='simulateDiploidMatrix.py --matrixout --hapout [--height --width --gaprate --errorrate --fragmentlength --longfmt]') parser.add_argument('--matrixout', help='output filename for the fragment matrix',required=True) parser.add_argument('--hapout', help='output filename for the actual haplotype - depending on error rate, may not be the haplotypes corresponding to the MEC score',required=True) parser.add_argument('--height',help="fragment matrix height (number of fragments)",required=False,default=2) parser.add_argument('--width',help="fragment matrix width (number of sites)",required=False,default=1) parser.add_argument('--gaprate',help="fraction of entries within fragments that are gaps (randomly distributed; can be at ends of fragments)",required=False,default=0.0) parser.add_argument('--errorrate',help="fraction of matrix entries that have errors (randomly distributed) given that there is not a gap at that point",required=False,default=0.0) #parser.add_argument('--fractionh0',help="fraction of rows that come from 'hap 0' - NOT USED",required=False,default=0.5) parser.add_argument('--fragmentlength',help="length of fragments between first non-gap and last non-gap (with --paired True it is the length of one end-segment",required=False,default=None) parser.add_argument('--insertlength',help="number of gaps between the end-segments of the pair",required=False,default=None) parser.add_argument('--longfmt',help="Write the fragment matrix in long format?",required=False,default=False) parser.add_argument('--k',help="k>1 number of haplotypes to simulate",required=False,default=2) parser.add_argument('--pairedend',help="Are reads paired-end?",required=False,default=False) args = parser.parse_args() (height,width) = (int(args.height),int(args.width)) gaprate = float(args.gaprate) errorrate = float(args.errorrate) k = int(args.k) #fractionh0 = float(args.fractionh0) if args.fractionh0 != None else None if args.pairedend and args.fragmentlength != None and (int(args.fragmentlength) < 1 or 2*int(args.fragmentlength) > width): print "Since you specified fragment length in paired mode, it must be at least 1 and at most (width-insertlength)/2 (default is (width-insertlength)/2)" sys.exit() if args.pairedend and args.fragmentlength != None and args.insertlength != None and (int(args.insertlength) < 0 or int(args.insertlength) > width - (int(args.fragmentlength)*2)): print "Since you specified insert length in paired mode, it must be at least 0 and at most width-(fragmentlength*2) (default is 0)" sys.exit() if not args.pairedend and args.fragmentlength != None and (int(args.fragmentlength) < 1 or int(args.fragmentlength) > width): print "Since you specified fragment length (not in paired mode), it must be at least 1 and at most width (default is width)" sys.exit() if height < 1 or width < 1: print "dimensions must be at least 1" sys.exit() if k < 2: print "k must be greater or equal to 2" sys.exit() if errorrate < 0.0 or errorrate > 1.0 or gaprate < 0.0 or gaprate > 1.0: print "rates must be between 0 and 1" sys.exit() if args.longfmt == False: outfile = None outfile1 = args.matrixout else: outfile = args.matrixout + "-long" outfile1 = args.matrixout if k == 2: if args.pairedend: H = diploidPairedend(args.fragmentlength,args.insertlength,height, width, gaprate, errorrate,k,outfile,outfile1) else: H = diploid(args.fragmentlength,height, width, gaprate, errorrate,k,outfile,outfile1) else: if args.pairedend: H = kploidPairedend(args.fragmentlength,args.insertlength,height, width, gaprate, errorrate,k,outfile,outfile1) else: H = kploid(args.fragmentlength,height, width, gaprate, errorrate,k,outfile,outfile1) with open(args.hapout,"w") as F: for h in H: F.write("".join([str(h[i]) for i in xrange(width)])) F.write("\n")

43.575448

218

0.678249

2,437

17,038

4.713172

0.086582

0.039701

0.018806

0.012537

0.829967

0.816472

0.802716

0.786784

0.772941

0

0.016264

0.177192

17,038

391

219

43.575448

0.803053

0.16158

0

0.831325

0

0.018072

0.109197

0.006539

0

null

0

0.006024

null

0.042169

0

null

0

1

0

1

0

null

0

1

0

8

af5e1c07403f2a2d1609e0f66c31ca9c72481ac9

1,299

py

Python

gestionProtocolos_y_Estudios/admin.py

AnuTor/UniNeuroLab

5825f440d4663650f038083f3da05229cc5ada4f

[ "Apache-2.0" ]

1

2021-01-09T01:20:45.000Z

gestionProtocolos_y_Estudios/admin.py

AnuTor/UniNeuroLab

5825f440d4663650f038083f3da05229cc5ada4f

[ "Apache-2.0" ]

1

2021-01-09T00:53:55.000Z

gestionProtocolos_y_Estudios/admin.py

AnuTor/UniNeuroLab

5825f440d4663650f038083f3da05229cc5ada4f

[ "Apache-2.0" ]

1

2021-01-07T23:57:28.000Z

# GESTION PROTOCOLOS Y ESTUDIOS from django.contrib import admin from gestionProtocolos_y_Estudios.models import direccionProtocolo # Register your models here. class direccionProtocoloAdmin(admin.ModelAdmin): list_display=("protocoloEstudio", "clave_Protocolo", "tipoInvestigacion", "aceptadoDiseño_Metodológico", "fechaAceptacionDM", "aceptadoConsetimiento_Informado", "fechaAceptacionCI","fechaInicioInvestigacion", "investigadorResponsable1", "MP_IR1", "investigadorResponsable2", "MP_IR2", "investigadorResponsable3", "MP_IR3") search_fields=("protocoloEstudio", "clave_Protocolo", "tipoInvestigacion", "aceptadoDiseño_Metodológico", "fechaAceptacionDM", "aceptadoConsetimiento_Informado", "fechaAceptacionCI","fechaInicioInvestigacion", "investigadorResponsable1", "MP_IR1", "investigadorResponsable2", "MP_IR2", "investigadorResponsable3", "MP_IR3") list_filter=("protocoloEstudio", "clave_Protocolo", "tipoInvestigacion", "aceptadoDiseño_Metodológico", "fechaAceptacionDM", "aceptadoConsetimiento_Informado", "fechaAceptacionCI","fechaInicioInvestigacion", "investigadorResponsable1", "MP_IR1", "investigadorResponsable2", "MP_IR2", "investigadorResponsable3", "MP_IR3") date_hierarchy=("fechaInicioInvestigacion") admin.site.register(direccionProtocolo, direccionProtocoloAdmin)

86.6

324

0.82756

98

1,299

10.72449

0.44898

0.059943

0.085633

0.134158

0.707897

0

0.014682

0.056197

1,299

14

325

92.785714

0.842577

0.04311

0

0.633871

0.391935

0

1

0

false

0

0.25

0

0.875

0

1

null

0

1

0

1

0

null

0

7

af8716a81eadc0456f7631860ffae014f8e66b53

4,918

py

Python

processedPrograms/path.py

Vlad12344/RoboDKToPulsePostprocessor

95b3c52a82bffe43862a1d4edcf388fa25dffca0

[ "MIT" ]

null

processedPrograms/path.py

Vlad12344/RoboDKToPulsePostprocessor

95b3c52a82bffe43862a1d4edcf388fa25dffca0

[ "MIT" ]

null

processedPrograms/path.py

Vlad12344/RoboDKToPulsePostprocessor

95b3c52a82bffe43862a1d4edcf388fa25dffca0

[ "MIT" ]

null

import time from pulseapi import * robot = RobotPulse('127.0.0.1:8081') speed_ms = 0.3 speed_ms = 1.0 robot.change_tool_info(tool_info(position([0.0,0.0,0.0], [-0.0,0.0,-0.0]))) target_poses = [ pose([-148.91, -52.65, 134.48, -171.83, -90.0, 121.09]), ] robot.run_poses(target_poses, tcp_max_velocity=1.0, motion_type=MT_JOINT) robot.await_stop() target_position = [ position([0.315, 0.3307, 0.0], [-3.142, -0.0, -3.142]), ] robot.run_positions(target_position, tcp_max_velocity=1.0, motion_type=MT_LINEAR) robot.await_stop() speed_ms = 0.05 target_position = [ position([0.315, 0.428, 0.0], [-3.142, -0.0, -3.142]), position([0.316, 0.4302, 0.0], [-3.142, -0.0, -3.142]), position([0.318, 0.431, 0.0], [-3.142, -0.0, -3.142]), position([0.3206, 0.431, 0.0], [-3.142, -0.0, -3.142]), position([0.3221, 0.4312, 0.0], [-3.142, -0.0, -3.142]), position([0.325, 0.4329, 0.0], [-3.142, -0.0, -3.142]), position([0.3265, 0.436, 0.0], [-3.142, -0.0, -3.142]), position([0.3261, 0.4394, 0.0], [-3.142, -0.0, -3.142]), position([0.3239, 0.442, 0.0], [-3.142, -0.0, -3.142]), position([0.3206, 0.443, 0.0], [-3.142, -0.0, -3.142]), position([0.318, 0.443, 0.0], [-3.142, -0.0, -3.142]), position([0.316, 0.4438, 0.0], [-3.142, -0.0, -3.142]), position([0.315, 0.446, 0.0], [-3.142, -0.0, -3.142]), position([0.315, 0.5433, 0.0], [-3.142, -0.0, -3.142]), position([0.3158, 0.5453, 0.0], [-3.142, -0.0, -3.142]), position([0.318, 0.5463, 0.0], [-3.142, -0.0, -3.142]), position([0.3206, 0.5463, 0.0], [-3.142, -0.0, -3.142]), position([0.3239, 0.5473, 0.0], [-3.142, -0.0, -3.142]), position([0.3261, 0.5499, 0.0], [-3.142, -0.0, -3.142]), position([0.3266, 0.5523, 0.0], [-3.142, -0.0, -3.142]), position([0.3266, 0.556, 0.0], [-3.142, -0.0, -3.142]), position([0.3274, 0.558, 0.0], [-3.142, -0.0, -3.142]), position([0.3296, 0.559, 0.0], [-3.142, -0.0, -3.142]), position([0.4204, 0.559, 0.0], [-3.142, -0.0, -3.142]), position([0.4226, 0.558, 0.0], [-3.142, -0.0, -3.142]), position([0.4234, 0.556, 0.0], [-3.142, -0.0, -3.142]), position([0.4234, 0.5523, 0.0], [-3.142, -0.0, -3.142]), position([0.4244, 0.549, 0.0], [-3.142, -0.0, -3.142]), position([0.427, 0.5468, 0.0], [-3.142, -0.0, -3.142]), position([0.4294, 0.5463, 0.0], [-3.142, -0.0, -3.142]), position([0.432, 0.5463, 0.0], [-3.142, -0.0, -3.142]), position([0.4342, 0.5453, 0.0], [-3.142, -0.0, -3.142]), position([0.435, 0.5433, 0.0], [-3.142, -0.0, -3.142]), position([0.435, 0.446, 0.0], [-3.142, -0.0, -3.142]), position([0.434, 0.4438, 0.0], [-3.142, -0.0, -3.142]), position([0.432, 0.443, 0.0], [-3.142, -0.0, -3.142]), position([0.4294, 0.443, 0.0], [-3.142, -0.0, -3.142]), position([0.4279, 0.4428, 0.0], [-3.142, -0.0, -3.142]), position([0.425, 0.4411, 0.0], [-3.142, -0.0, -3.142]), position([0.4235, 0.438, 0.0], [-3.142, -0.0, -3.142]), position([0.4239, 0.4346, 0.0], [-3.142, -0.0, -3.142]), position([0.4261, 0.432, 0.0], [-3.142, -0.0, -3.142]), position([0.4294, 0.431, 0.0], [-3.142, -0.0, -3.142]), position([0.432, 0.431, 0.0], [-3.142, -0.0, -3.142]), position([0.4342, 0.43, 0.0], [-3.142, -0.0, -3.142]), position([0.435, 0.428, 0.0], [-3.142, -0.0, -3.142]), position([0.435, 0.3307, 0.0], [-3.142, -0.0, -3.142]), position([0.4342, 0.3287, 0.0], [-3.142, -0.0, -3.142]), position([0.432, 0.3277, 0.0], [-3.142, -0.0, -3.142]), position([0.4294, 0.3277, 0.0], [-3.142, -0.0, -3.142]), position([0.4261, 0.3267, 0.0], [-3.142, -0.0, -3.142]), position([0.4239, 0.3241, 0.0], [-3.142, -0.0, -3.142]), position([0.4234, 0.3217, 0.0], [-3.142, -0.0, -3.142]), position([0.4234, 0.318, 0.0], [-3.142, -0.0, -3.142]), position([0.4226, 0.316, 0.0], [-3.142, -0.0, -3.142]), position([0.4204, 0.315, 0.0], [-3.142, -0.0, -3.142]), position([0.3296, 0.315, 0.0], [-3.142, -0.0, -3.142]), position([0.3276, 0.3158, 0.0], [-3.142, -0.0, -3.142]), position([0.3266, 0.318, 0.0], [-3.142, -0.0, -3.142]), position([0.3266, 0.3217, 0.0], [-3.142, -0.0, -3.142]), position([0.3261, 0.3241, 0.0], [-3.142, -0.0, -3.142]), position([0.3239, 0.3267, 0.0], [-3.142, -0.0, -3.142]), position([0.3206, 0.3277, 0.0], [-3.142, -0.0, -3.142]), position([0.318, 0.3277, 0.0], [-3.142, -0.0, -3.142]), position([0.316, 0.3285, 0.0], [-3.142, -0.0, -3.142]), position([0.315, 0.3307, 0.0], [-3.142, -0.0, -3.142]), ] robot.run_positions(target_position, tcp_max_velocity=0.05, motion_type=MT_LINEAR) robot.await_stop() speed_ms = 1.0 target_position = [ position([0.315, 0.3307, 0.1], [-3.142, -0.0, -3.142]), ] robot.run_positions(target_position, tcp_max_velocity=1.0, motion_type=MT_LINEAR) robot.await_stop()

51.768421

83

0.519317

1,020

4,918

2.465686

0.105882

0.116899

0.161034

0.322068

0.870775

0.860437

0.831014

0.812724

0

0.367805

0.166328

4,918

94

84

52.319149

0.24561

0

0.139785

0

0.002847

0

1

0

false

0

0.021505

0

0.021505

0

null

0

1

0

1

0

1

0

null

0

9

afa607e75c099181d79c9a0ba64e74b995cd6023

172

py

Python

utils/convert/quant_onnx.py

stephanballer/deepedgebench

1f905f88874f063607dd9f5fa97177a701a317f9

[ "MIT" ]

1

2021-12-28T09:04:05.000Z

utils/convert/quant_onnx.py

stephanballer/deepedgebench

1f905f88874f063607dd9f5fa97177a701a317f9

[ "MIT" ]

null

utils/convert/quant_onnx.py

stephanballer/deepedgebench

1f905f88874f063607dd9f5fa97177a701a317f9

[ "MIT" ]

null

import onnx from onnxruntime.quantization import quantize_dynamic def quant_onnx(model_path, output_path): quantized_model = quantize_dynamic(model_path, output_path)

28.666667

63

0.843023

23

172

5.956522

0.565217

0.218978

0.277372

0

0.104651

172

5

64

34.4

0.88961

0

1

0.25

false

0

0.5

0

0.75

0

1

0

null

1

0

1

0

null

0

1

0

1

0

7

afd600309ff7fb3ae56ab5a96de19367c156daf0

75

py

Python

xrayMP/test.py

x94carbone/xrayMP

d43aff9cfe70ccacd6b635322841faeed2d3467e

[ "BSD-3-Clause" ]

null

xrayMP/test.py

x94carbone/xrayMP

d43aff9cfe70ccacd6b635322841faeed2d3467e

[ "BSD-3-Clause" ]

null

xrayMP/test.py

x94carbone/xrayMP

d43aff9cfe70ccacd6b635322841faeed2d3467e

[ "BSD-3-Clause" ]

null

#!/usr/bin/env python3 def print_hello_world(): print("hello world")

12.5

24

0.68

11

75

4.454545

0.727273

0.408163

0.612245

0

0.015873

0.16

75

5

25

15

0.761905

0.28

0

0.207547

0

1

0.5

true

0

0.5

1

0

null

1

0

1

0

null

0

1

0

1

0

7

bb7f43b3bcd518004adc561520284f007eca8b34

64,408

py

Python

TweakApi/apis/team_permission_set_api.py

tweak-com-public/tweak-api-client-python

019f86da11fdb12683d516f8f37db5d717380bcc

[ "Apache-2.0" ]

null

TweakApi/apis/team_permission_set_api.py

tweak-com-public/tweak-api-client-python

019f86da11fdb12683d516f8f37db5d717380bcc

[ "Apache-2.0" ]

null

TweakApi/apis/team_permission_set_api.py

tweak-com-public/tweak-api-client-python

019f86da11fdb12683d516f8f37db5d717380bcc

[ "Apache-2.0" ]

null

# coding: utf-8 """ tweak-api Tweak API to integrate with all the Tweak services. You can find out more about Tweak at <a href='https://www.tweak.com'>https://www.tweak.com</a>, #tweak. OpenAPI spec version: 1.0.8-beta.0 Generated by: https://github.com/swagger-api/swagger-codegen.git Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at http://www.apache.org/licenses/LICENSE-2.0 Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License. """ from __future__ import absolute_import import sys import os import re # python 2 and python 3 compatibility library from six import iteritems from ..configuration import Configuration from ..api_client import ApiClient class TeamPermissionSetApi(object): """ NOTE: This class is auto generated by the swagger code generator program. Do not edit the class manually. Ref: https://github.com/swagger-api/swagger-codegen """ def __init__(self, api_client=None): config = Configuration() if api_client: self.api_client = api_client else: if not config.api_client: config.api_client = ApiClient() self.api_client = config.api_client def team_permission_sets_change_stream_get(self, **kwargs): """ Create a change stream. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_change_stream_get(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str options: :return: file If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_change_stream_get_with_http_info(**kwargs) else: (data) = self.team_permission_sets_change_stream_get_with_http_info(**kwargs) return data def team_permission_sets_change_stream_get_with_http_info(self, **kwargs): """ Create a change stream. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_change_stream_get_with_http_info(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str options: :return: file If the method is called asynchronously, returns the request thread. """ all_params = ['options'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_change_stream_get" % key ) params[key] = val del params['kwargs'] collection_formats = {} resource_path = '/TeamPermissionSets/change-stream'.replace('{format}', 'json') path_params = {} query_params = {} if 'options' in params: query_params['options'] = params['options'] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='file', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_change_stream_post(self, **kwargs): """ Create a change stream. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_change_stream_post(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str options: :return: file If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_change_stream_post_with_http_info(**kwargs) else: (data) = self.team_permission_sets_change_stream_post_with_http_info(**kwargs) return data def team_permission_sets_change_stream_post_with_http_info(self, **kwargs): """ Create a change stream. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_change_stream_post_with_http_info(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str options: :return: file If the method is called asynchronously, returns the request thread. """ all_params = ['options'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_change_stream_post" % key ) params[key] = val del params['kwargs'] collection_formats = {} resource_path = '/TeamPermissionSets/change-stream'.replace('{format}', 'json') path_params = {} query_params = {} header_params = {} form_params = [] local_var_files = {} if 'options' in params: form_params.append(('options', params['options'])) body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='file', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_count_get(self, **kwargs): """ Count instances of the model matched by where from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_count_get(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str where: Criteria to match model instances :return: InlineResponse2001 If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_count_get_with_http_info(**kwargs) else: (data) = self.team_permission_sets_count_get_with_http_info(**kwargs) return data def team_permission_sets_count_get_with_http_info(self, **kwargs): """ Count instances of the model matched by where from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_count_get_with_http_info(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str where: Criteria to match model instances :return: InlineResponse2001 If the method is called asynchronously, returns the request thread. """ all_params = ['where'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_count_get" % key ) params[key] = val del params['kwargs'] collection_formats = {} resource_path = '/TeamPermissionSets/count'.replace('{format}', 'json') path_params = {} query_params = {} if 'where' in params: query_params['where'] = params['where'] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='InlineResponse2001', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_find_one_get(self, **kwargs): """ Find first instance of the model matched by filter from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_find_one_get(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str filter: Filter defining fields, where, include, order, offset, and limit - must be a JSON-encoded string ({\"something\":\"value\"}) :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_find_one_get_with_http_info(**kwargs) else: (data) = self.team_permission_sets_find_one_get_with_http_info(**kwargs) return data def team_permission_sets_find_one_get_with_http_info(self, **kwargs): """ Find first instance of the model matched by filter from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_find_one_get_with_http_info(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str filter: Filter defining fields, where, include, order, offset, and limit - must be a JSON-encoded string ({\"something\":\"value\"}) :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ all_params = ['filter'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_find_one_get" % key ) params[key] = val del params['kwargs'] collection_formats = {} resource_path = '/TeamPermissionSets/findOne'.replace('{format}', 'json') path_params = {} query_params = {} if 'filter' in params: query_params['filter'] = params['filter'] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='TeamPermissionSet', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_get(self, **kwargs): """ Find all instances of the model matched by filter from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_get(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str filter: Filter defining fields, where, include, order, offset, and limit - must be a JSON-encoded string ({\"something\":\"value\"}) :return: list[TeamPermissionSet] If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_get_with_http_info(**kwargs) else: (data) = self.team_permission_sets_get_with_http_info(**kwargs) return data def team_permission_sets_get_with_http_info(self, **kwargs): """ Find all instances of the model matched by filter from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_get_with_http_info(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str filter: Filter defining fields, where, include, order, offset, and limit - must be a JSON-encoded string ({\"something\":\"value\"}) :return: list[TeamPermissionSet] If the method is called asynchronously, returns the request thread. """ all_params = ['filter'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_get" % key ) params[key] = val del params['kwargs'] collection_formats = {} resource_path = '/TeamPermissionSets'.replace('{format}', 'json') path_params = {} query_params = {} if 'filter' in params: query_params['filter'] = params['filter'] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='list[TeamPermissionSet]', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_delete(self, id, **kwargs): """ Delete a model instance by {{id}} from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_delete(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_delete_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_delete_with_http_info(id, **kwargs) return data def team_permission_sets_id_delete_with_http_info(self, id, **kwargs): """ Delete a model instance by {{id}} from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_delete_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :return: object If the method is called asynchronously, returns the request thread. """ all_params = ['id'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_delete" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_delete`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'DELETE', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_exists_get(self, id, **kwargs): """ Check whether a model instance exists in the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_exists_get(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :return: InlineResponse2002 If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_exists_get_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_exists_get_with_http_info(id, **kwargs) return data def team_permission_sets_id_exists_get_with_http_info(self, id, **kwargs): """ Check whether a model instance exists in the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_exists_get_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :return: InlineResponse2002 If the method is called asynchronously, returns the request thread. """ all_params = ['id'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_exists_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_exists_get`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}/exists'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='InlineResponse2002', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_get(self, id, **kwargs): """ Find a model instance by {{id}} from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_get(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :param str filter: Filter defining fields and include - must be a JSON-encoded string ({\"something\":\"value\"}) :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_get_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_get_with_http_info(id, **kwargs) return data def team_permission_sets_id_get_with_http_info(self, id, **kwargs): """ Find a model instance by {{id}} from the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_get_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :param str filter: Filter defining fields and include - must be a JSON-encoded string ({\"something\":\"value\"}) :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ all_params = ['id', 'filter'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_get`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} if 'filter' in params: query_params['filter'] = params['filter'] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='TeamPermissionSet', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_head(self, id, **kwargs): """ Check whether a model instance exists in the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_head(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :return: InlineResponse2002 If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_head_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_head_with_http_info(id, **kwargs) return data def team_permission_sets_id_head_with_http_info(self, id, **kwargs): """ Check whether a model instance exists in the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_head_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :return: InlineResponse2002 If the method is called asynchronously, returns the request thread. """ all_params = ['id'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_head" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_head`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'HEAD', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='InlineResponse2002', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_patch(self, id, **kwargs): """ Patch attributes for a model instance and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_patch(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: TeamPermissionSet id (required) :param TeamPermissionSet data: An object of model property name/value pairs :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_patch_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_patch_with_http_info(id, **kwargs) return data def team_permission_sets_id_patch_with_http_info(self, id, **kwargs): """ Patch attributes for a model instance and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_patch_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: TeamPermissionSet id (required) :param TeamPermissionSet data: An object of model property name/value pairs :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ all_params = ['id', 'data'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_patch" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_patch`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} header_params = {} form_params = [] local_var_files = {} body_params = None if 'data' in params: body_params = params['data'] # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'PATCH', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='TeamPermissionSet', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_put(self, id, **kwargs): """ Replace attributes for a model instance and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_put(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :param TeamPermissionSet data: Model instance data :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_put_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_put_with_http_info(id, **kwargs) return data def team_permission_sets_id_put_with_http_info(self, id, **kwargs): """ Replace attributes for a model instance and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_put_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :param TeamPermissionSet data: Model instance data :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ all_params = ['id', 'data'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_put" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_put`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} header_params = {} form_params = [] local_var_files = {} body_params = None if 'data' in params: body_params = params['data'] # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'PUT', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='TeamPermissionSet', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_replace_post(self, id, **kwargs): """ Replace attributes for a model instance and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_replace_post(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :param TeamPermissionSet data: Model instance data :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_replace_post_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_replace_post_with_http_info(id, **kwargs) return data def team_permission_sets_id_replace_post_with_http_info(self, id, **kwargs): """ Replace attributes for a model instance and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_replace_post_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: Model id (required) :param TeamPermissionSet data: Model instance data :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ all_params = ['id', 'data'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_replace_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_replace_post`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}/replace'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} header_params = {} form_params = [] local_var_files = {} body_params = None if 'data' in params: body_params = params['data'] # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='TeamPermissionSet', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_id_team_get(self, id, **kwargs): """ Fetches belongsTo relation team. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_team_get(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: TeamPermissionSet id (required) :param bool refresh: :return: Team If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_id_team_get_with_http_info(id, **kwargs) else: (data) = self.team_permission_sets_id_team_get_with_http_info(id, **kwargs) return data def team_permission_sets_id_team_get_with_http_info(self, id, **kwargs): """ Fetches belongsTo relation team. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_id_team_get_with_http_info(id, callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param str id: TeamPermissionSet id (required) :param bool refresh: :return: Team If the method is called asynchronously, returns the request thread. """ all_params = ['id', 'refresh'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_id_team_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'id' is set if ('id' not in params) or (params['id'] is None): raise ValueError("Missing the required parameter `id` when calling `team_permission_sets_id_team_get`") collection_formats = {} resource_path = '/TeamPermissionSets/{id}/team'.replace('{format}', 'json') path_params = {} if 'id' in params: path_params['id'] = params['id'] query_params = {} if 'refresh' in params: query_params['refresh'] = params['refresh'] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='Team', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats) def team_permission_sets_post(self, **kwargs): """ Create a new instance of the model and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_post(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param TeamPermissionSet data: Model instance data :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('callback'): return self.team_permission_sets_post_with_http_info(**kwargs) else: (data) = self.team_permission_sets_post_with_http_info(**kwargs) return data def team_permission_sets_post_with_http_info(self, **kwargs): """ Create a new instance of the model and persist it into the data source. This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please define a `callback` function to be invoked when receiving the response. >>> def callback_function(response): >>> pprint(response) >>> >>> thread = api.team_permission_sets_post_with_http_info(callback=callback_function) :param callback function: The callback function for asynchronous request. (optional) :param TeamPermissionSet data: Model instance data :return: TeamPermissionSet If the method is called asynchronously, returns the request thread. """ all_params = ['data'] all_params.append('callback') all_params.append('_return_http_data_only') params = locals() for key, val in iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method team_permission_sets_post" % key ) params[key] = val del params['kwargs'] collection_formats = {} resource_path = '/TeamPermissionSets'.replace('{format}', 'json') path_params = {} query_params = {} header_params = {} form_params = [] local_var_files = {} body_params = None if 'data' in params: body_params = params['data'] # HTTP header `Accept` header_params['Accept'] = self.api_client.\ select_header_accept(['application/json', 'application/xml', 'text/xml', 'application/javascript', 'text/javascript']) if not header_params['Accept']: del header_params['Accept'] # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.\ select_header_content_type(['application/json', 'application/x-www-form-urlencoded', 'application/xml', 'text/xml']) # Authentication setting auth_settings = ['access_token'] return self.api_client.call_api(resource_path, 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='TeamPermissionSet', auth_settings=auth_settings, callback=params.get('callback'), _return_http_data_only=params.get('_return_http_data_only'), collection_formats=collection_formats)

41.102744

165

0.568687

6,572

64,408

5.34084

0.039257

0.063818

0.054359

0.036467

0.96416

0.961425

0.959316

0.949544

0.945584

0.943647

0

0.00112

0.348171

64,408

1,566

166

41.128991

0.834933

0.324028

0

0.821429

0

0.176511

0.069288

0

1

0.039835

false

0

0.009615

0

0.108516

0

null

0

1

0

1

0

null

0

7

bba3e056a32bcb1a5aa6d731a43c75fd47c8a2e7

7,400

py

Python

tests/models/work_experience_tests.py

domenicosolazzo/Human

272bbd939c90e0874a51022b9f716ed47e886fec

[ "MIT" ]

null

tests/models/work_experience_tests.py

domenicosolazzo/Human

272bbd939c90e0874a51022b9f716ed47e886fec

[ "MIT" ]

null

tests/models/work_experience_tests.py

domenicosolazzo/Human

272bbd939c90e0874a51022b9f716ed47e886fec

[ "MIT" ]

null

from nose.tools import * from human.core.api.models.work_experience import Employer, Place def test_employer(): data = { "name": "abc", "from_date": "25/08/1982", "to_date":"26/08/1982", "summary": "This is a summary", "name": "abc", "title": "Developer", "sector": "Healthcare", "keywords": ["Python"], "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, "abc") assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place.name, "Oslo") def test_employer__without_name(): data = { "from_date": "25/08/1982", "to_date":"26/08/1982", "summary": "This is a summary", "title": "Developer", "sector": "Healthcare", "keywords": ["Python"], "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, None) assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place.name, "Oslo") def test_employer__without_from_date(): data = { "name": "abc", "to_date":"26/08/1982", "summary": "This is a summary", "name": "abc", "title": "Developer", "sector": "Healthcare", "keywords": ["Python"], "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, None) assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, "abc") assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place.name, "Oslo") def test_employer__without_to_date(): data = { "name": "abc", "from_date": "25/08/1982", "summary": "This is a summary", "name": "abc", "title": "Developer", "sector": "Healthcare", "keywords": ["Python"], "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, None) assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, "abc") assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place.name, "Oslo") def test_employer__without_summary(): data = { "name": "abc", "from_date": "25/08/1982", "to_date":"26/08/1982", "name": "abc", "title": "Developer", "sector": "Healthcare", "keywords": ["Python"], "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, None) assert_equal(employer.name, "abc") assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place.name, "Oslo") def test_employer__without_title(): data = { "name": "abc", "from_date": "25/08/1982", "to_date":"26/08/1982", "summary": "This is a summary", "name": "abc", "sector": "Healthcare", "keywords": ["Python"], "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, "abc") assert_equal(employer.title,None) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place.name, "Oslo") def test_employer__without_sector(): data = { "name": "abc", "from_date": "25/08/1982", "to_date":"26/08/1982", "summary": "This is a summary", "name": "abc", "title": "Developer", "keywords": ["Python"], "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, "abc") assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, None) assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place.name, "Oslo") def test_employer__without_keywords(): data = { "name": "abc", "from_date": "25/08/1982", "to_date":"26/08/1982", "summary": "This is a summary", "name": "abc", "title": "Developer", "sector": "Healthcare", "place": {"name":"Oslo"} } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, "abc") assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, []) assert_equal(employer.place.name, "Oslo") def test_employer__without_place(): data = { "name": "abc", "from_date": "25/08/1982", "to_date":"26/08/1982", "summary": "This is a summary", "name": "abc", "title": "Developer", "sector": "Healthcare", "keywords": ["Python"] } employer = Employer(data) assert_true(isinstance(employer, Employer)) assert_equal(employer.from_date, "25/08/1982") assert_equal(employer.to_date, "26/08/1982") assert_equal(employer.summary, "This is a summary") assert_equal(employer.name, "abc") assert_equal(employer.title,"Developer" ) assert_equal(employer.sector, "Healthcare") assert_equal(employer.keywords, ["Python"]) assert_equal(employer.place, None) def test_employer__keywords_must_be_a_list(): data = { "keywords": 1 } employer = Employer(data) assert_equal(employer.keywords, []) data = {"keywords": True} employer = Employer(data) assert_equal(employer.keywords, []) data = {"keywords": "string"} employer = Employer(data) assert_equal(employer.keywords, []) data = {"keywords": ["Python"]} employer = Employer(data) assert_equal(employer.keywords, ["Python"])

31.489362

65

0.628378

854

7,400

5.255269

0.052693

0.186275

0.321747

0.042781

0.948752

0.945633

0.944296

0.933824

0.929144

0.889706

0

0.044014

0.210946

7,400

234

66

31.623932

0.72461

0

0.838235

0

0.223214

0

0.416667

1

0.04902

false

0

0.009804

0

0.058824

0

null

0

1

0

1

0

1

0

null

0

1

0

9

a5445586308cf87377d4a8cebf77198263e6bd4a

44

py

Python

test.py

coffeeTeaOne/IPProxy

a02f6fdb508394d8a9274d9da2c2ba092c0c13df

[ "Apache-2.0" ]

null

test.py

coffeeTeaOne/IPProxy

a02f6fdb508394d8a9274d9da2c2ba092c0c13df

[ "Apache-2.0" ]

null

test.py

coffeeTeaOne/IPProxy

a02f6fdb508394d8a9274d9da2c2ba092c0c13df

[ "Apache-2.0" ]

null

print(123) print(123) print(123) print(123)

8.8

10

0.727273

8

44

4

0.25

1

1.21875

1.5

1

0

0.3

0.090909

44

4

11

0.5

0

1

0

1

0

true

0

1

0

null

1

0

1

0

1

0

1

0

null

0

1

0

1

0

12

a5ac57e8e9427ddaa34e723bc39595ea610c1ce6

17,822

py

Python

thor/plotting/analysis.py

B612-Asteroid-Institute/thor

d3d1dcbe86f67a62c90b4cde3fc577e414825cf2

[ "BSD-3-Clause" ]

null

thor/plotting/analysis.py

B612-Asteroid-Institute/thor

d3d1dcbe86f67a62c90b4cde3fc577e414825cf2

[ "BSD-3-Clause" ]

null

thor/plotting/analysis.py

B612-Asteroid-Institute/thor

d3d1dcbe86f67a62c90b4cde3fc577e414825cf2

[ "BSD-3-Clause" ]

null

import pandas as pd import matplotlib.pyplot as plt import matplotlib.patches as patches from ..config import Config from .helpers import _setPercentage from .contour import plotScatterContour __all__ = ["_plotGrid", "plotProjectionVelocitiesFindable", "plotProjectionVelocitiesFound", "plotProjectionVelocitiesMissed", "plotOrbitsFindable", "plotOrbitsFound", "plotOrbitsMissed"] def _plotGrid(ax, vxRange, vyRange): """ Helper function that plots a rectangular shape. """ rect = patches.Rectangle((vxRange[0], vyRange[0]), vxRange[1]-vxRange[0], vyRange[1]-vyRange[0], linewidth=0.5, edgecolor='r', facecolor='none') ax.add_patch(rect) return def plotProjectionVelocitiesFindable(allObjects, vxRange=None, vyRange=None): """ Plots objects that should be findable in the projection space based on their median velocities and the chosen velocity ranges. Parameters ---------- allObjects : `~pandas.DataFrame` Object summary DataFrame. Needs 'findable' column to be populated, as well as the median projection space velocities and the median heliocentric distance. vxRange : {None, list or `~numpy.ndarray` (2)} Maximum and minimum velocity range in x. [Default = None] vyRange : {None, list or `~numpy.ndarray` (2)} Maximum and minimum velocity range in y. [Default = None] Returns ------- fig : `~matplotlib.figure.Figure` The matplotlib figure object. ax : `~matplotlib.axes._subplots.AxesSubplot` The matplotlib axes object. """ if vxRange is not None and vyRange is not None: in_zone_findable = ((allObjects["dtheta_x/dt_median"] >= vxRange[0]) & (allObjects["dtheta_x/dt_median"] <= vxRange[1]) & (allObjects["dtheta_y/dt_median"] <= vyRange[1]) & (allObjects["dtheta_y/dt_median"] >= vyRange[0]) & (allObjects["findable"] == 1)) fig, ax = plt.subplots(1, 1, dpi=600) ax.errorbar(allObjects[allObjects["findable"] == 1]["dtheta_x/dt_median"].values, allObjects[allObjects["findable"] == 1]["dtheta_y/dt_median"].values, yerr=allObjects[allObjects["findable"] == 1]["dtheta_y/dt_sigma"].values, xerr=allObjects[allObjects["findable"] == 1]["dtheta_x/dt_sigma"].values, fmt="o", ms=0.01, capsize=0.1, elinewidth=0.1, c="k", zorder=-1) cm = ax.scatter(allObjects[allObjects["findable"] == 1]["dtheta_x/dt_median"].values, allObjects[allObjects["findable"] == 1]["dtheta_y/dt_median"].values, s=0.1, c=allObjects[allObjects["findable"] == 1]["r_au_median"].values, vmin=0, vmax=5.0, cmap="viridis") cb = fig.colorbar(cm, fraction=0.02, pad=0.02) ax.set_aspect("equal") if vxRange is not None and vyRange is not None: _plotGrid(ax, vxRange, vyRange) # Add labels and text cb.set_label("r [AU]", size=10) ax.set_xlabel(r"Median $ d\theta_X / dt$ [Degrees Per Day]", size=10) ax.set_ylabel(r"Median $ d\theta_Y / dt$ [Degrees Per Day]", size=10) ax.text(_setPercentage(ax.get_xlim(), 0.04), _setPercentage(ax.get_ylim(), 0.05), "Objects Findable: {}".format(len(allObjects[allObjects["findable"] == 1]))) if vxRange is not None and vyRange is not None: ax.text(_setPercentage(ax.get_xlim(), 0.04), _setPercentage(ax.get_ylim(), 0.11), "Objects Findable in Grid: {}".format(len(allObjects[in_zone_findable])), color="r") return fig, ax def plotProjectionVelocitiesFound(allObjects, vxRange=None, vyRange=None): """ Plots objects that were found in the projection space based on their median velocities and the chosen velocity ranges. Parameters ---------- allObjects : `~pandas.DataFrame` Object summary DataFrame. Needs 'found' column to be populated, as well as the median projection space velocities and the median heliocentric distance. vxRange : {None, list or `~numpy.ndarray` (2)} Maximum and minimum velocity range in x. [Default = None] vyRange : {None, list or `~numpy.ndarray` (2)} Maximum and minimum velocity range in y. [Default = None] Returns ------- fig : `~matplotlib.figure.Figure` The matplotlib figure object. ax : `~matplotlib.axes._subplots.AxesSubplot` The matplotlib axes object. """ if vxRange is not None and vyRange is not None: in_zone_found = ((allObjects["dtheta_x/dt_median"] >= vxRange[0]) & (allObjects["dtheta_x/dt_median"] <= vxRange[1]) & (allObjects["dtheta_y/dt_median"] <= vyRange[1]) & (allObjects["dtheta_y/dt_median"] >= vyRange[0]) & (allObjects["found"] == 1)) fig, ax = plt.subplots(1, 1, dpi=600) ax.errorbar(allObjects[allObjects["findable"] == 1]["dtheta_x/dt_median"].values, allObjects[allObjects["findable"] == 1]["dtheta_y/dt_median"].values, yerr=allObjects[allObjects["findable"] == 1]["dtheta_y/dt_sigma"].values, xerr=allObjects[allObjects["findable"] == 1]["dtheta_x/dt_sigma"].values, fmt="o", ms=0.01, capsize=0.1, elinewidth=0.1, c="k", zorder=-1) if len(allObjects[allObjects["found"] == 1]) != 0: cm = ax.scatter(allObjects[allObjects["found"] == 1]["dtheta_x/dt_median"].values, allObjects[allObjects["found"] == 1]["dtheta_y/dt_median"].values, s=0.1, c=allObjects[allObjects["found"] == 1]["r_au_median"].values, vmin=0, vmax=5.0, cmap="viridis") cb = fig.colorbar(cm, fraction=0.02, pad=0.02) cb.set_label("r [AU]", size=10) ax.set_aspect("equal") if vxRange is not None and vyRange is not None: _plotGrid(ax, vxRange, vyRange) # Add labels and text ax.set_xlabel(r"Median $ d\theta_X / dt$ [Degrees Per Day]", size=10) ax.set_ylabel(r"Median $ d\theta_Y / dt$ [Degrees Per Day]", size=10) ax.text(_setPercentage(ax.get_xlim(), 0.04), _setPercentage(ax.get_ylim(), 0.05), "Objects Found: {}".format(len(allObjects[allObjects["found"] == 1]))) if vxRange is not None and vyRange is not None: ax.text(_setPercentage(ax.get_xlim(), 0.04), _setPercentage(ax.get_ylim(), 0.11), "Objects Found in Grid: {}".format(len(allObjects[in_zone_found])), color="g") return fig, ax def plotProjectionVelocitiesMissed(allObjects, vxRange=None, vyRange=None): """ Plots objects that were missed in the projection space based on their median velocities and the chosen velocity ranges. Parameters ---------- allObjects : `~pandas.DataFrame` Object summary DataFrame. Needs 'found' and 'findable' column to be populated, as well as the median projection space velocities and the median heliocentric distance. vxRange : {None, list or `~numpy.ndarray` (2)} Maximum and minimum velocity range in x. [Default = None] vyRange : {None, list or `~numpy.ndarray` (2)} Maximum and minimum velocity range in y. [Default = None] Returns ------- fig : `~matplotlib.figure.Figure` The matplotlib figure object. ax : `~matplotlib.axes._subplots.AxesSubplot` The matplotlib axes object. """ if vxRange is not None and vyRange is not None: in_zone_missed = ((allObjects["dtheta_x/dt_median"] >= vxRange[0]) & (allObjects["dtheta_x/dt_median"] <= vxRange[1]) & (allObjects["dtheta_y/dt_median"] <= vyRange[1]) & (allObjects["dtheta_y/dt_median"] >= vyRange[0]) & (allObjects["found"] == 0) & (allObjects["findable"] == 1)) fig, ax = plt.subplots(1, 1, dpi=600) ax.errorbar(allObjects[allObjects["findable"] == 1]["dtheta_x/dt_median"].values, allObjects[allObjects["findable"] == 1]["dtheta_y/dt_median"].values, yerr=allObjects[allObjects["findable"] == 1]["dtheta_y/dt_sigma"].values, xerr=allObjects[allObjects["findable"] == 1]["dtheta_x/dt_sigma"].values, fmt="o", ms=0.01, capsize=0.1, elinewidth=0.1, c="k", zorder=-1) if len(allObjects[(allObjects["findable"] == 1) & (allObjects["found"] == 0)]) > 0: cm = ax.scatter(allObjects[(allObjects["findable"] == 1) & (allObjects["found"] == 0)]["dtheta_x/dt_median"].values, allObjects[(allObjects["findable"] == 1) & (allObjects["found"] == 0)]["dtheta_y/dt_median"].values, s=0.1, c=allObjects[(allObjects["findable"] == 1) & (allObjects["found"] == 0)]["r_au_median"].values, vmin=0, vmax=5.0, cmap="viridis") cb = fig.colorbar(cm, fraction=0.02, pad=0.02) cb.set_label("r [AU]", size=10) ax.set_aspect("equal") if vxRange is not None and vyRange is not None: _plotGrid(ax, vxRange, vyRange) # Add labels and text ax.set_xlabel(r"Median $ d\theta_X / dt$ [Degrees Per Day]", size=10) ax.set_ylabel(r"Median $ d\theta_Y / dt$ [Degrees Per Day]", size=10) ax.text(_setPercentage(ax.get_xlim(), 0.04), _setPercentage(ax.get_ylim(), 0.05), "Objects Missed: {}".format(len(allObjects[(allObjects["findable"] == 1) & (allObjects["found"] == 0)]))) if vxRange is not None and vyRange is not None: ax.text(_setPercentage(ax.get_xlim(), 0.04), _setPercentage(ax.get_ylim(), 0.11), "Objects Missed in Grid: {}".format(len(allObjects[in_zone_missed])), color="r") return fig, ax def plotOrbitsFindable(allObjects, orbits, testOrbits=None, columnMapping=Config.COLUMN_MAPPING): """ Plots orbits that should be findable in semi-major axis, inclination and eccentrity space. Parameters ---------- allObjects : `~pandas.DataFrame` Object summary DataFrame. Needs 'findable' column to be populated. orbits : `~pandas.DataFrame` Orbit DataFrame, should contain the orbits for the objects in the allObjects DataFrame. testOrbits : {None, `~pandas.DataFrame`}, optional If passed, will plot test orbits in red. [Default = None] columnMapping : dict, optional Column name mapping of orbits DataFrame to internally used column names. [Default = `~thor.Config.COLUMN_MAPPING`] Returns ------- fig : `~matplotlib.figure.Figure` The matplotlib figure object. ax : `~matplotlib.axes._subplots.AxesSubplot` The matplotlib axes object. """ findable = orbits[orbits[columnMapping["name"]].isin(allObjects[allObjects["findable"] == 1][columnMapping["name"]].values)] fig, ax = plotScatterContour(findable, columnMapping["a_au"], columnMapping["i_deg"], columnMapping["e"], plotCounts=False, logCounts=True, countLevels=4, mask=None, xLabel="a [AU]", yLabel="i [Degrees]", zLabel="e", scatterKwargs={"s": 0.1, "vmin": 0, "vmax": 1, "cmap": "viridis"}) if type(testOrbits) == pd.DataFrame: # If test orbits exist in known orbits, plot them test_orbits_in_known = orbits[orbits[columnMapping["name"]].isin(testOrbits[columnMapping["name"]].values)] if len(test_orbits_in_known) != 0: ax.scatter(*test_orbits_in_known[[columnMapping["a_au"], columnMapping["i_deg"]]].values.T, s=2, c="r", label="Test Orbits") ax.legend(loc='upper right') return fig, ax def plotOrbitsFound(allObjects, orbits, testOrbits=None, columnMapping=Config.COLUMN_MAPPING): """ Plots orbits that have been found in semi-major axis, inclination and eccentrity space. Parameters ---------- allObjects : `~pandas.DataFrame` Object summary DataFrame. Needs 'found' column to be populated. orbits : `~pandas.DataFrame` Orbit DataFrame, should contain the orbits for the objects in the allObjects DataFrame. testOrbits : {None, `~pandas.DataFrame`}, optional If passed, will plot test orbits in red. [Default = None] columnMapping : dict, optional Column name mapping of orbits DataFrame to internally used column names. [Default = `~thor.Config.COLUMN_MAPPING`] Returns ------- fig : `~matplotlib.figure.Figure` The matplotlib figure object. ax : `~matplotlib.axes._subplots.AxesSubplot` The matplotlib axes object. """ found = orbits[orbits[columnMapping["name"]].isin(allObjects[allObjects["found"] == 1][columnMapping["name"]].values)] fig, ax = plotScatterContour(found, columnMapping["a_au"], columnMapping["i_deg"], columnMapping["e"], plotCounts=False, logCounts=True, countLevels=4, mask=None, xLabel="a [AU]", yLabel="i [Degrees]", zLabel="e", scatterKwargs={"s": 0.1, "vmin": 0, "vmax": 1, "cmap": "viridis"}) if type(testOrbits) == pd.DataFrame: # If test orbits exist in known orbits, plot them test_orbits_in_known = orbits[orbits[columnMapping["name"]].isin(testOrbits[columnMapping["name"]].values)] if len(test_orbits_in_known) != 0: ax.scatter(*test_orbits_in_known[[columnMapping["a_au"], columnMapping["i_deg"]]].values.T, s=2, c="r", label="Test Orbits") ax.legend(loc='upper right') return fig, ax def plotOrbitsMissed(allObjects, orbits, testOrbits=None, columnMapping=Config.COLUMN_MAPPING): """ Plots orbits that have been missed (but were findable) in semi-major axis, inclination and eccentrity space. Parameters ---------- allObjects : `~pandas.DataFrame` Object summary DataFrame. Needs 'found' and 'findable' column to be populated. orbits : `~pandas.DataFrame` Orbit DataFrame, should contain the orbits for the objects in the allObjects DataFrame. testOrbits : {None, `~pandas.DataFrame`}, optional If passed, will plot test orbits in red. [Default = None] columnMapping : dict, optional Column name mapping of orbits DataFrame to internally used column names. [Default = `~thor.Config.COLUMN_MAPPING`] Returns ------- fig : `~matplotlib.figure.Figure` The matplotlib figure object. ax : `~matplotlib.axes._subplots.AxesSubplot` The matplotlib axes object. """ missed = orbits[orbits[columnMapping["name"]].isin(allObjects[(allObjects["found"] == 0) & (allObjects["findable"] == 1)][columnMapping["name"]].values)] fig, ax = plotScatterContour(missed, columnMapping["a_au"], columnMapping["i_deg"], columnMapping["e"], plotCounts=False, logCounts=True, countLevels=4, mask=None, xLabel="a [AU]", yLabel="i [Degrees]", zLabel="e", scatterKwargs={"s": 0.1, "vmin": 0, "vmax": 1, "cmap": "viridis"}) if type(testOrbits) == pd.DataFrame: # If test orbits exist in known orbits, plot them test_orbits_in_known = orbits[orbits[columnMapping["name"]].isin(testOrbits[columnMapping["name"]].values)] if len(test_orbits_in_known) != 0: ax.scatter(*test_orbits_in_known[[columnMapping["a_au"], columnMapping["i_deg"]]].values.T, s=2, c="r", label="Test Orbits") ax.legend(loc='upper right') return fig, ax

42.841346

157

0.549714

1,904

17,822

5.049895

0.108193

0.060322

0.049402

0.066355

0.914821

0.907748

0.89558

0.872595

0.837233

0.80572

0

0.017816

0.326002

17,822

416

158

42.841346

0.782634

0.271687

0

0.748918

0

0.139964

0.007371

0

1

0.030303

false

0

0.025974

0

0.08658

0

null

0

1

0

1

0

null

0

7

3c3562a4049268c84ac5d07ba1c687e06a5d1bc5

9,143

py

Python

pylily/0409/0409/module1.py

joannachuang/2019_summer_joanna

1773cbad88cc2b7ebf20cebbd97d2988919372e6

[ "Apache-2.0" ]

null

pylily/0409/0409/module1.py

joannachuang/2019_summer_joanna

1773cbad88cc2b7ebf20cebbd97d2988919372e6

[ "Apache-2.0" ]

null

pylily/0409/0409/module1.py

joannachuang/2019_summer_joanna

1773cbad88cc2b7ebf20cebbd97d2988919372e6

[ "Apache-2.0" ]

1

2019-07-09T08:39:47.000Z

import Lily.ctao.database as cdb import Lily.crawler.url_string as url import pandas import numpy import requests import os import io def write_url_tofile(url, filename): response = requests.get(url , verify=False) datafile = io.BytesIO() for chunk in response.iter_content(chunk_size=512 * 1024): if chunk: # filter out keep-alive new chunks datafile.write(chunk) f = open (filename,'wb') f.write(datafile.getvalue()) f.close() return datafile.getvalue() for a in range(1,120): target='''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/N{0}.pdf''' target = target.format("%03d" % a) file = '''d:/107_N{0}.pdf''' file = file.format("%03d" % a) arg1 = url.url_string(target) arg1.to_file(file) print (target, file) # delete file os.remove('''d:/107_N012.pdf''') os.remove('''d:/107_N105.pdf''') for b in range(1,115): target='''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/S{0}.pdf''' target = target.format("%03d" % b) file = '''d:/107_S{0}.pdf''' file = file.format("%03d" % b) arg1 = url.url_string(target) arg1.to_file(file) print (target, file) os.remove('''d:/107_S024.pdf''') for b in range(1,120): for c in range(1,6): target='''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N{0}.files/sheet{1}.htm''' target = target.format("%03d"%b,"%03d"%c) file = '''d:/107_N{0}_sheet{1}.htm''' file = file.format("%03d"%b,"%03d"%c) arg1 = url.url_string(target) arg1.to_file(file) print (target, file) for d in range(1,115): for e in range(1,6): target='''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S{0}.files/sheet{1}.htm''' target = target.format("%03d"%d,"%03d"%e) file = '''d:/107_S{0}_sheet{1}.htm''' file = file.format("%03d"%d,"%03d"%e) arg1 = url.url_string(target) arg1.to_file(file) print (target, file) os.remove('''d:/107_N012_sheet001.htm''') os.remove('''d:/107_N012_sheet002.htm''') os.remove('''d:/107_N012_sheet003.htm''') os.remove('''d:/107_N012_sheet004.htm''') os.remove('''d:/107_N012_sheet005.htm''') os.remove('''d:/107_N105_sheet001.htm''') os.remove('''d:/107_N105_sheet002.htm''') os.remove('''d:/107_N105_sheet003.htm''') os.remove('''d:/107_N105_sheet004.htm''') os.remove('''d:/107_N105_sheet005.htm''') os.remove('''d:/107_S024_sheet001.htm''') os.remove('''d:/107_S024_sheet002.htm''') os.remove('''d:/107_S024_sheet003.htm''') os.remove('''d:/107_S024_sheet004.htm''') os.remove('''d:/107_S024_sheet005.htm''') if __name__ == '__console__' or __name__ == '__main__': write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/N012(1).pdf''', 'd:/107_N012(1).pdf') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/N012(2).pdf''', 'd:/107_N012(2).pdf') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/N105(1).pdf''', 'd:/107_N105(1).pdf') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/N105(2).pdf''', 'd:/107_N105(2).pdf') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/S024(1).pdf''', 'd:/107_S024(1).pdf') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/PDF/S024(2).pdf''', 'd:/107_S024(2).pdf') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(1).files/sheet001.htm''', 'd:/107_N012(1)_sheet001.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(1).files/sheet002.htm''', 'd:/107_N012(1)_sheet002.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(1).files/sheet003.htm''', 'd:/107_N012(1)_sheet003.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(1).files/sheet004.htm''', 'd:/107_N012(1)_sheet004.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(1).files/sheet005.htm''', 'd:/107_N012(1)_sheet005.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(2).files/sheet001.htm''', 'd:/107_N012(2)_sheet001.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(2).files/sheet002.htm''', 'd:/107_N012(2)_sheet002.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(2).files/sheet003.htm''', 'd:/107_N012(2)_sheet003.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(2).files/sheet004.htm''', 'd:/107_N012(2)_sheet004.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N012(2).files/sheet005.htm''', 'd:/107_N012(2)_sheet005.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(1).files/sheet001.htm''', 'd:/107_N105(1)_sheet001.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(1).files/sheet002.htm''', 'd:/107_N105(1)_sheet002.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(1).files/sheet003.htm''', 'd:/107_N105(1)_sheet003.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(1).files/sheet004.htm''', 'd:/107_N105(1)_sheet004.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(1).files/sheet005.htm''', 'd:/107_N015(1)_sheet005.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(2).files/sheet001.htm''', 'd:/107_N105(2)_sheet001.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(2).files/sheet002.htm''', 'd:/107_N105(2)_sheet002.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(2).files/sheet003.htm''', 'd:/107_N105(2)_sheet003.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(2).files/sheet004.htm''', 'd:/107_N105(2)_sheet004.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/N105(2).files/sheet005.htm''', 'd:/107_N105(2)_sheet005.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(1).files/sheet001.htm''', 'd:/107_S024(1)_sheet001.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(1).files/sheet002.htm''', 'd:/107_S024(1)_sheet002.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(1).files/sheet003.htm''', 'd:/107_S024(1)_sheet003.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(1).files/sheet004.htm''', 'd:/107_S024(1)_sheet004.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(1).files/sheet005.htm''', 'd:/107_S024(1)_sheet005.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(2).files/sheet001.htm''', 'd:/107_S024(2)_sheet001.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(2).files/sheet002.htm''', 'd:/107_S024(2)_sheet002.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(2).files/sheet003.htm''', 'd:/107_S024(2)_sheet003.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(2).files/sheet004.htm''', 'd:/107_S024(2)_sheet004.htm') write_url_tofile('''http://163.29.251.188/botedata/%E4%BA%A4%E9%80%9A%E6%B5%81%E9%87%8F/107%E5%B9%B4%E5%BA%A6/HTM/S024(2).files/sheet005.htm''', 'd:/107_S024(2)_sheet005.htm')

71.429688

181

0.667396

1,911

9,143

3.085296

0.055992

0.039349

0.061058

0.081411

0.909939

0.895862

0.711669

0.70251

0.690299

0

0.25

0.067265

9,143

127

182

71.992126

0.44137

0.004812

0

0.113208

0

0.377358

0.674876

0.13392

0

1

0.009434

false

0

0.066038

0

0.084906

0.037736

0

null

0

1

0

1

0

1

0

1

0

null

0

10

3c6ce458d4a438bc4e21cc994f95ef3d41181ee4

6,138

py

Python

tests/test_base_level_precip_changer.py

alexmitchell/terrainbento

b8f6dd7fd9c96d3a40e0d1f8cd41b1dfe8d0b5da

[ "MIT" ]

null

tests/test_base_level_precip_changer.py

alexmitchell/terrainbento

b8f6dd7fd9c96d3a40e0d1f8cd41b1dfe8d0b5da

[ "MIT" ]

null

tests/test_base_level_precip_changer.py

alexmitchell/terrainbento

b8f6dd7fd9c96d3a40e0d1f8cd41b1dfe8d0b5da

[ "MIT" ]

null

# coding: utf8 # !/usr/env/python import pytest from scipy.integrate import IntegrationWarning from landlab import HexModelGrid, RasterModelGrid from terrainbento.boundary_handlers import PrecipChanger def test_not_passing_daily_rainfall__intermittency_factor(): mg = HexModelGrid((5, 5)) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor_time_rate_of_change=0.001, rainfall__mean_rate=3.0, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=2.0, ) def test_not_passing_daily_rainfall__intermittency_factor_troc(): mg = HexModelGrid((5, 5)) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor=0.3, rainfall__mean_rate=3.0, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=2.0, ) def test_not_passing_rainfall__mean_rate(): mg = HexModelGrid((5, 5)) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor=0.3, daily_rainfall__intermittency_factor_time_rate_of_change=0.001, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=2.0, ) def test_not_passing_rainfall__mean_rate_time_rate_of_change(): mg = HexModelGrid((5, 5)) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor=0.3, daily_rainfall__intermittency_factor_time_rate_of_change=0.001, rainfall__mean_rate=3.0, rainfall__shape_factor=0.65, infiltration_capacity=2.0, ) def test_not_passing_rainfall__shape_factor(): mg = HexModelGrid((5, 5)) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor=0.3, daily_rainfall__intermittency_factor_time_rate_of_change=0.001, rainfall__mean_rate=3.0, rainfall__mean_rate_time_rate_of_change=0.2, infiltration_capacity=2.0, ) def test_not_passing_infiltration_capacity(): mg = HexModelGrid((5, 5)) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor=0.3, daily_rainfall__intermittency_factor_time_rate_of_change=0.001, rainfall__mean_rate=3.0, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, ) def test_a_stop_time(): """Test that it is possible to provide a stop time.""" mg = HexModelGrid((5, 5)) pc = PrecipChanger( mg, daily_rainfall__intermittency_factor=0.3, daily_rainfall__intermittency_factor_time_rate_of_change=0.001, rainfall__mean_rate=3.0, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=2.0, time_unit="day", precipchanger_start_time=10.0, precipchanger_stop_time=20.0, ) # for the first ten steps, nothing should change for _ in range(10): pc.run_one_step(1.0) i, p = pc.get_current_precip_params() f = pc.get_erodibility_adjustment_factor() assert i == pc.starting_frac_wet_days assert p == pc.starting_daily_mean_depth assert f == 1.0 # run 10 more steps and save pc.run_one_step(10.0) i_end, p_end = pc.get_current_precip_params() f_end = pc.get_erodibility_adjustment_factor() # then verify that no change occurs again. for _ in range(10): pc.run_one_step(1.0) i, p = pc.get_current_precip_params() f = pc.get_erodibility_adjustment_factor() assert i == i_end assert p == p_end assert f == f_end def test_bad_intermittency(): """Test intermittency factors that are too big or small.""" mg = RasterModelGrid((5, 5)) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor=-0.001, daily_rainfall__intermittency_factor_time_rate_of_change=0.01, rainfall__mean_rate=3.0, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=0, ) with pytest.raises(ValueError): PrecipChanger( mg, daily_rainfall__intermittency_factor=1.001, daily_rainfall__intermittency_factor_time_rate_of_change=0.01, rainfall__mean_rate=3.0, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=0, ) def test_bad_intensity(): """Test rainfall intensity that is too small.""" mg = RasterModelGrid((5, 5)) with pytest.raises(ValueError): with pytest.warns(IntegrationWarning): PrecipChanger( mg, daily_rainfall__intermittency_factor=1.0, daily_rainfall__intermittency_factor_time_rate_of_change=0.01, rainfall__mean_rate=-1, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=0, ) def test_bad_infiltration(): """Test infiltration_capacity that is too small.""" mg = RasterModelGrid((5, 5)) with pytest.raises(ValueError): with pytest.warns(IntegrationWarning): PrecipChanger( mg, daily_rainfall__intermittency_factor=1.0, daily_rainfall__intermittency_factor_time_rate_of_change=0.01, rainfall__mean_rate=0.34, rainfall__mean_rate_time_rate_of_change=0.2, rainfall__shape_factor=0.65, infiltration_capacity=-0.001, )

33

78

0.652493

750

6,138

4.866667

0.142667

0.078356

0.156712

0.192877

0.81589

0.807123

0.800274

0.795616

0.764384

0.758356

0

0.042739

0.271913

6,138

185

79

33.178378

0.773999

0.054904

0

0.711409

0

0.000519

0

0.040268

1

0.067114

false

0.040268

0.026846

0

0.09396

0

null

0

1

0

1

0

null

0

8

3c6d2cd856409896e90cab3fd637fec2b0a611be

218

py

Python

hds/util/__init__.py

Half-Shot/hds

91af7e35bb4ece73cca90a815fcd7ae97fb79a80

[ "MIT" ]

1

2021-07-17T20:43:01.000Z

hds/util/__init__.py

Half-Shot/hds

91af7e35bb4ece73cca90a815fcd7ae97fb79a80

[ "MIT" ]

1

2019-08-02T15:40:38.000Z

hds/util/__init__.py

Half-Shot/hds

91af7e35bb4ece73cca90a815fcd7ae97fb79a80

[ "MIT" ]

null

from .util import (HDSFailure, HDSBadKeyFailure, verify_payload, determine_our_host) __all__ = [ HDSFailure, HDSBadKeyFailure, verify_payload, determine_our_host]

21.8

48

0.62844

18

218

7.055556

0.611111

0.409449

0.503937

0.614173

0.866142

0

0.316514

218

9

49

24.222222

0.852349

0

0.25

0

1

0

false

0

0.125

0

0.125

0

1

0

null

1

0

1

0

null

0

8

b1e4f1389bdc41db415227d509e2b5b0ebc12105

811

py

Python

tests/unit/model/test_soa.py

becelot/python-hostingde

9af53747ccf418b97de6510f5c21627ab7bac77f

[ "MIT" ]

null

tests/unit/model/test_soa.py

becelot/python-hostingde

9af53747ccf418b97de6510f5c21627ab7bac77f

[ "MIT" ]

6

2021-11-08T10:27:45.000Z

2021-11-21T18:20:46.000Z

tests/unit/model/test_soa.py

cancom/python-hostingde

9af53747ccf418b97de6510f5c21627ab7bac77f

[ "MIT" ]

null

from hostingde.model.soa_values import SoaValues def test_soa_constructor(): soa: SoaValues = SoaValues(refresh=23, retry=213, expire=25, ttl=12566, negative_ttl=2) assert soa.refresh == 23 assert soa.retry == 213 assert soa.expire == 25 assert soa.ttl == 12566 assert soa.negative_ttl == 2 def test_soa_parse(): data = dict(refresh=23, retry=213, expire=25, ttl=12566, negativeTtl=2) soa = SoaValues.from_json(data) assert soa.refresh == 23 assert soa.retry == 213 assert soa.expire == 25 assert soa.ttl == 12566 assert soa.negative_ttl == 2 def test_soa_dump(): soa: SoaValues = SoaValues(refresh=23, retry=213, expire=25, ttl=12566, negative_ttl=2) assert soa.to_json() == dict(refresh=23, retry=213, expire=25, ttl=12566, negativeTtl=2)

27.033333

92

0.688039

121

811

4.504132

0.231405

0.181651

0.102752

0.124771

0.805505

0

0.118721

0.189889

811

29

93

27.965517

0.710807

0

0.631579

0

0.578947

1

0.157895

false

0

0.052632

0

0.210526

0

null

0

1

0

null

0

1

0

7

b1f9181ca0ad18308fdd088510f4cdca01606b03

44,635

py

Python

web/transiq/restapi/tests/tests_employee_roles_mapping.py

manibhushan05/transiq

763fafb271ce07d13ac8ce575f2fee653cf39343

[ "Apache-2.0" ]

null

web/transiq/restapi/tests/tests_employee_roles_mapping.py

manibhushan05/transiq

763fafb271ce07d13ac8ce575f2fee653cf39343

[ "Apache-2.0" ]

14

2020-06-05T23:06:45.000Z

2022-03-12T00:00:18.000Z

web/transiq/restapi/tests/tests_employee_roles_mapping.py

manibhushan05/transiq

763fafb271ce07d13ac8ce575f2fee653cf39343

[ "Apache-2.0" ]

null

import json from django.contrib.auth.models import User from django.urls import reverse from model_mommy import mommy from rest_framework import status from rest_framework.test import APITestCase from authentication.models import Profile from employee.models import Employee from restapi.models import EmployeeRoles from utils.models import AahoOffice class EmployeeRolesMappingTests(APITestCase): def setUp(self): self.login_url = reverse('login') self.logout_url = reverse('logout') self.employeerolesmappinglist_url = reverse('employee_roles_mapping_list/') self.employeerolesmappingcreate_url = reverse('employee_roles_mapping_create/') self.user = User.objects.create_user(username='john_doe', email='harshadasawant89@gmail.com', password='abc12345') Profile.objects.create( user=self.user, name='John_Doe', phone='9619125174', ) self.login_data = self.client.post(self.login_url, {'username': 'john_doe', 'password': 'abc12345'}).content self.login_data = json.loads(self.login_data.decode('utf8')) self.token = 'Token {}'.format(self.login_data['token']) self.aaho_office = mommy.make(AahoOffice) self.employee = mommy.make(Employee, office=self.aaho_office) self.employee_id = self.employee.id self.employee_roles = mommy.make(EmployeeRoles) self.employeeroles_id = self.employee_roles.id self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_201_CREATED) self.employeerolesmapping_id = response.data['data']['id'] class EmployeeRolesMappingCreateTests(EmployeeRolesMappingTests): def setUp(self): super().setUp() self.aaho_office = mommy.make(AahoOffice) self.employee = mommy.make(Employee, office=self.aaho_office) self.employee_id = self.employee.id self.employee_roles = mommy.make(EmployeeRoles, role="traffic") self.employeeroles_id = self.employee_roles.id """ Test ID:TS01TD00055 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:wrong method Status code:405 """ def test_employee_roles_mapping_create_405_wrong_method(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get(self.employeerolesmappingcreate_url, {"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_405_METHOD_NOT_ALLOWED) """ Test ID:TS01TD00056 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:no header Status code:401 """ def test_employee_roles_mapping_create_401_no_header(self): self.client.credentials() response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Authentication credentials were not provided.") """ Test ID:TS01TD00057 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:expired header Status code:401 """ def test_employee_roles_mapping_create_401_expired_header(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.delete(self.logout_url) self.assertEqual(response.status_code, status.HTTP_200_OK) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00057 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:wrong token Status code:401 """ def test_employee_roles_mapping_create_401_wrong_token(self): token = 'Token c8b0f520fa7380fe7090131a4456859b1efc7777' self.client.credentials(HTTP_AUTHORIZATION=token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00059 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:wrong content type Status code:415 """ def test_employee_roles_mapping_create_415_header_with_wrong_content_type(self): # Negative test case of req quotes create with HTTP Header Authorization token with wrong content type self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/pdf') self.assertEqual(response.status_code, status.HTTP_415_UNSUPPORTED_MEDIA_TYPE) """ Test ID:TS01TD00058 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:blank body Status code:400 """ def test_employee_roles_mapping_create_400_blank_body(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, {}, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) self.assertEqual(response.data['employee_id'][0], "This field is required.") self.assertEqual(response.data['employee_role_id'][0], "This field is required.") self.assertEqual(response.data['employee_status'][0], "This field is required.") """ Test ID:TS01TD00060 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:blank fields Status code:400 """ def test_employee_roles_mapping_create_400_blank_fields(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": "", "employee_role_id": "", "employee_status": ""}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) self.assertEqual(response.data['employee_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_role_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_status'][0], "\"\" is not a valid choice.") """ Test ID:TS01TD00061 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:currupt fields Status code:400 """ def test_employee_roles_mapping_create_400_corrupt_fields(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": "ksln", "employee_role_id": "shdks", "employee_status": "shjdsdh"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) self.assertEqual(response.data['employee_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_role_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_status'][0], "\"shjdsdh\" is not a valid choice.") """ Test ID:TS01TD00062 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:incorrect employee id Status code:400 """ def test_employee_roles_mapping_create_400_incorrect_employee_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": "6179797947", "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) """ Test ID:TS01TD00063 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:incorrect employee role Status code:400 """ def test_employee_roles_mapping_create_400_incorrect_employee_role_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": "73837", "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) """ Test ID:TS01TD00065 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:success Message:correct feilds Status code:201 """ def test_employee_roles_mapping_create_201_correct_fields(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_201_CREATED) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Role Mapping Created") """ Test ID:TS01TD00064 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-create/ Status:failure Message:duplicate fields Status code:401 """ def test_employee_roles_mapping_create_400_duplicate_role_field(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_201_CREATED) response = self.client.post(self.employeerolesmappingcreate_url, json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) class EmployeeRolesMappingRetrieveTests(EmployeeRolesMappingTests): """ Test ID:TS01TD00066 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-retrieve/<Valid ID>/ Status:failure Message:wrong method Status code:405 """ def test_employee_roles_mapping_retrieve_405_wrong_method(self): # Negative test for getting req quotes detail with wrong method self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-retrieve/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_405_METHOD_NOT_ALLOWED) """ Test ID:TS01TD00067 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-retrieve/<Valid ID>/ Status:failure Message:no header Status code:401 """ def test_employee_roles_mapping_retrieve_401_no_header(self): # Negative test case of req quotes create with no HTTP Header Authorization token self.client.credentials() response = self.client.get("/api/employee-roles-mapping-retrieve/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Authentication credentials were not provided.") """ Test ID:TS01TD00068 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-retrieve/<Valid ID>/ Status:failure Message:expired header Status code:401 """ def test_employee_roles_mapping_retrieve_401_expired_header(self): # Negative test case of req quotes create with expired/logged out HTTP Header Authorization token self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.delete(self.logout_url) self.assertEqual(response.status_code, status.HTTP_200_OK) response = self.client.get("/api/employee-roles-mapping-retrieve/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00068 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-retrieve/<Valid ID>/ Status:failure Message:wrong token Status code:401 """ def test_employee_roles_mappig_retrieve_401_wrong_token(self): # Negative test case of req quotes create with wrong HTTP Header Authorization token token = 'Token c8b0f520fa7380fe7090131a4456859b1efc7777' self.client.credentials(HTTP_AUTHORIZATION=token) response = self.client.get("/api/employee-roles-mapping-retrieve/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00069 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-retrieve/<Valid ID>/ Status:failure Message:wrong id Status code:404 """ def test_employee_roles_mapping_retrieve_404_wrong_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) employeerolesmapping_id = 10000 response = self.client.get("/api/employee-roles-mapping-retrieve/{}/".format(employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_404_NOT_FOUND) self.assertEqual(response.data['detail'], "Not found.") """ Test ID:TS01TD00070 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-retrieve/<Valid ID>/ Status:sucess Message:retreive roles Status code:200 """ def test_employee_roles_mapping_retrieve_200(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-retrieve/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Role Mapping Retrieved") class EmployeeRolesMappingUpdateTests(EmployeeRolesMappingTests): """ Test ID:TS01TD00071 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:wrong method Status code:405 """ def test_employee_roles_mapping_update_405_wrong_method(self): # Negative test for getting req quotes detail with wrong method self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), {"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_405_METHOD_NOT_ALLOWED) """ Test ID:TS01TD00072 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:wrong method Status code:405 """ def test_employee_roles_mapping_update_401_no_header(self): # Negative test case of req quotes create with no HTTP Header Authorization token self.client.credentials() response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Authentication credentials were not provided.") """ Test ID:TS01TD00073 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:expired header Status code:401 """ def test_employee_roles_mapping_update_401_expired_header(self): # Negative test case of req quotes create with expired/logged out HTTP Header Authorization token self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.delete(self.logout_url) self.assertEqual(response.status_code, status.HTTP_200_OK) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00073 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:wrong token Status code:401 """ def test_employee_roles_mapping_update_401_wrong_token(self): # Negative test case of req quotes create with wrong HTTP Header Authorization token token = 'Token c8b0f520fa7380fe7090131a4456859b1efc7777' self.client.credentials(HTTP_AUTHORIZATION=token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00074 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:wrong content type Status code:415 """ def test_employee_roles_mapping_update_415_header_with_wrong_content_type(self): # Negative test case of req quotes create with HTTP Header Authorization token with wrong content type self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/pdf') self.assertEqual(response.status_code, status.HTTP_415_UNSUPPORTED_MEDIA_TYPE) """ Test ID:TS01TD00075 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:blank body Status code:400 """ def test_employee_roles_mapping_update_400_blank_body(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), {}, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) self.assertEqual(response.data['employee_id'][0], "This field is required.") self.assertEqual(response.data['employee_role_id'][0], "This field is required.") self.assertEqual(response.data['employee_status'][0], "This field is required.") """ Test ID:TS01TD00076 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:blank fields Status code:400 """ def test_employee_roles_mapping_update_400_blank_fields(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": "", "employee_role_id": "", "employee_status": ""}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) self.assertEqual(response.data['employee_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_role_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_status'][0], "\"\" is not a valid choice.") """ Test ID:TS01TD00077 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:corrupt fields Status code:400 """ def test_employee_roles_mapping_update_400_corrupt_fields(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": "ksln", "employee_role_id": "shdks", "employee_status": "shjdsdh"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) self.assertEqual(response.data['employee_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_role_id'][0], "A valid integer is required.") self.assertEqual(response.data['employee_status'][0], "\"shjdsdh\" is not a valid choice.") """ Test ID:TS01TD00078 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:incorrect employee id field Status code:400 """ def test_employee_roles_mapping_update_400_incorrect_employee_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": "6179797947", "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) """ Test ID:TS01TD00079 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:incorrect employee role id field Status code:400 """ def test_employee_roles_mapping_update_400_incorrect_employee_role_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": self.employee_id, "employee_role_id": "73837", "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) """ Test ID:TS01TD00080 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:failure Message:wrong id field Status code:400 """ def test_employee_roles_mapping_update_400_wrong_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) employeerolesmapping_id = 10000 response = self.client.post("/api/employee-roles-mapping-update/{}/".format(employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_400_BAD_REQUEST) self.assertEqual(response.data['status'], "EmployeeRolesMapping Doesn't exists") """ Test ID:TS01TD00081 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-update/<Valid ID>/ Status:success Message:correct field Status code:202 """ def test_employee_roles_mapping_update_202_correct_fields(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-update/{}/".format(self.employeerolesmapping_id), json.dumps({"employee_id": self.employee_id, "employee_role_id": self.employeeroles_id, "employee_status": "active"}), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_202_ACCEPTED) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Role Mapping Updated") class EmployeeRolesDestroyMappingTests(EmployeeRolesMappingTests): """ Test ID:TS01TD00082 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-destroy/<Valid ID>/ Status:failure Message:wrong method Status code:405 """ def test_employee_roles_mapping_delete_405_wrong_method(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-destroy/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_405_METHOD_NOT_ALLOWED) """ Test ID:TS01TD00083 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-destroy/<Valid ID>/ Status:failure Message:no header Status code:401 """ def test_employee_roles_mapping_delete_401_no_header(self): self.client.credentials() response = self.client.post("/api/employee-roles-mapping-destroy/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Authentication credentials were not provided.") """ Test ID:TS01TD00084 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-destroy/<Valid ID>/ Status:failure Message:expired header Status code:401 """ def test_employee_roles_mapping_delete_401_expired_header(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.delete(self.logout_url) self.assertEqual(response.status_code, status.HTTP_200_OK) response = self.client.post("/api/employee-roles-mapping-destroy/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00084 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-destroy/<Valid ID>/ Status:failure Message:wrong token Status code:401 """ def test_employee_roles_mapping_delete_401_wrong_token(self): token = 'Token c8b0f520fa7380fe7090131a4456859b1efc7777' self.client.credentials(HTTP_AUTHORIZATION=token) response = self.client.post("/api/employee-roles-mapping-destroy/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00085 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-destroy/<Valid ID>/ Status:failure Message:wrong id Status code:404 """ def test_employee_roles_mapping_delete_404_wrong_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) employeerolesmapping_id = 1000 response = self.client.post("/api/employee-roles-mapping-destroy/{}/".format(employeerolesmapping_id), {'role': 'traffic'}, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_404_NOT_FOUND) self.assertEqual(response.data['detail'], "Not found.") """ Test ID:TS01TD00086 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-destroy/<Valid ID>/ Status:success Message:mapping delete Status code:200 """ def test_employee_roles_mapping_delete_200(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post("/api/employee-roles-mapping-destroy/{}/".format(self.employeerolesmapping_id), content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Role Mapping Deleted") class EmployeeRolesMappingListTests(EmployeeRolesMappingTests): """ Test ID:TS01TD00087 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:failure Message:wrong method Status code:405 """ def test_employee_roles_mapping_list_405_wrong_method(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.post(self.employeerolesmappinglist_url, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_405_METHOD_NOT_ALLOWED) """ Test ID:TS01TD00088 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:failure Message:no header Status code:401 """ def test_employee_roles_mapping_list_401_no_header(self): self.client.credentials() response = self.client.get(self.employeerolesmappinglist_url, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Authentication credentials were not provided.") """ Test ID:TS01TD00089 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:failure Message:expired header Status code:401 """ def test_employee_roles_mapping_list_401_expired_header(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.delete(self.logout_url) self.assertEqual(response.status_code, status.HTTP_200_OK) response = self.client.post(self.employeerolesmappinglist_url, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00089 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:failure Message:expired header Status code:401 """ def test_employee_roles_mapping_list_401_wrong_token(self): token = 'Token c8b0f520fa7380fe7090131a4456859b1efc7777' self.client.credentials(HTTP_AUTHORIZATION=token) response = self.client.get(self.employeerolesmappinglist_url, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_401_UNAUTHORIZED) self.assertEqual(response.data['detail'], "Invalid token.") """ Test ID:TS01TD00090 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles mapping list Status code:200 """ def test_employee_roles_mapping_list_200(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get(self.employeerolesmappinglist_url, content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00091 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles search by name Status code:200 """ def test_employee_roles_mapping_list_200_search_by_name(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/?search=ravi", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00092 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles search by employee status Status code:200 """ def test_employee_roles_mapping_list_200_search_by_employee_status(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/?search=active", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00093 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles search by employee role traffic Status code:200 """ def test_employee_roles_mapping_list_200_search_by_employee_role_traffic(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/?search=traffic", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00094 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles mapping list valid id Status code:200 """ def test_employee_roles_mapping_list_200_valid_id(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/?id=9", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00095 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles mapping list range Status code:200 """ def test_employee_roles_mapping_list_200_range(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/?id_range_0=9&id_range_1=10", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00096 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles mapping list employee Status code:200 """ def test_employee_roles_mapping_list_200_employee(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/??employee=harsh", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00097 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles mapping list employee status Status code:200 """ def test_employee_roles_mapping_list_200_employee_status(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/??employee_status=active", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List") """ Test ID:TS01TD00098 Created By:Hari Created On:13/12/2018 Scenario:employee-roles-mapping-list/ Status:success Message:employee roles mapping list employee role Status code:200 """ def test_employee_roles_mapping_list_200_employee_role(self): self.client.credentials(HTTP_AUTHORIZATION=self.token) response = self.client.get("/api/employee-roles-mapping-list/??employee_role=traffic", content_type='application/json') self.assertEqual(response.status_code, status.HTTP_200_OK) self.assertEqual(response.data['status'], "success") self.assertEqual(response.data['msg'], "Employee Roles Mapping List")

44.769308

151

0.627333

4,689

44,635

5.782256

0.047985

0.073839

0.107697

0.061742

0.926603

0.922325

0.917014

0.9141

0.91115

0.908051

0

0.044227

0.276621

44,635

996

152

44.814257

0.795497

0.033113

0

0.743529

0

0.174147

0.050873

0

0.277647

1

0.12

false

0.004706

0.023529

0

0.157647

0

null

0

1

0

1

0

null

0

7

593ef0d6661dc757c5e7dc5a9ee6caeedd0ba0d8

553

py

Python

python/anyascii/_data/_001.py

casept/anyascii

d4f426b91751254b68eaa84c6cd23099edd668e6

[ "ISC" ]

null

python/anyascii/_data/_001.py

casept/anyascii

d4f426b91751254b68eaa84c6cd23099edd668e6

[ "ISC" ]

null

python/anyascii/_data/_001.py

casept/anyascii

d4f426b91751254b68eaa84c6cd23099edd668e6

[ "ISC" ]

null

b="A a A a A a C c C c C c C c D d D d E e E e E e E e E e G g G g G g G g H h H h I i I i I i I i I i IJ ij J j K k q L l L l L l L l L l N n N n N n 'n Ng ng O o O o O o OE oe R r R r R r S s S s S s S s T t T t T t U u U u U u U u U u U u W w Y y Y Z z Z z Z z s b B B b 6 6 O C c D D D d d E e E F f G G hw I I K k l l M N n O O o Gh gh P p R 2 2 Sh sh t T t T U u U V Y y Z z Zh Zh zh zh 2 5 5 ts w | || |= ! DZ Dz dz LJ Lj lj NJ Nj nj A a I i O o U u U u U u U u U u e A a A a AE ae G g G g K k O o O o Zh zh j DZ Dz dz G g Hw W N n A a AE ae O o"

553

0.520796

253

553

1.13834

0.158103

0.152778

0.197917

0.222222

0.465278

0.375

0.340278

0.180556

0.076389

0

0.02349

0.461121

553

1

553

0.942953

0

1

0.990975

0

1

0

false

0

1

null

0

1

0

1

0

1

0

1

0

null

0

7

59caf040e8f7ef303f461727895b0f648e490e15

107

py

Python

model/loss.py

jiangxiluning/pytorch-template

8976ef05606ea14585a1362232f5d659147a9aed

[ "MIT" ]

1

2019-11-28T08:26:26.000Z

model/loss.py

MotJuMi/AlexNet

bab6623c345f2fe6c85db31623609cd5af4d0b5b

[ "MIT" ]

null

model/loss.py

MotJuMi/AlexNet

bab6623c345f2fe6c85db31623609cd5af4d0b5b

[ "MIT" ]

2

2020-02-29T02:41:50.000Z

2021-10-02T16:54:34.000Z

import torch.nn.functional as F def my_loss(y_input, y_target): return F.nll_loss(y_input, y_target)

17.833333

40

0.757009

21

107

3.571429

0.666667

0.133333

0.266667

0.293333

0.453333

0

0.149533

107

5

41

21.4

0.824176

0

1

0.333333

false

0

0.333333

1

0

1

0

null

0

1

0

1

0

null

0

1

0

1

0

8

ab73879d5ba498977e4e8d82d668abf02f6f7d73

170

py

Python

gym_customersim/envs/__init__.py

rezanazari/CustomerSim

adb9d3b44b29b738c5886f6161623dfc56949a97

[ "Apache-2.0" ]

null

gym_customersim/envs/__init__.py

rezanazari/CustomerSim

adb9d3b44b29b738c5886f6161623dfc56949a97

[ "Apache-2.0" ]

null

gym_customersim/envs/__init__.py

rezanazari/CustomerSim

adb9d3b44b29b738c5886f6161623dfc56949a97

[ "Apache-2.0" ]

null

from gym_customersim.envs.customer_sim import CustomerSimEnv from gym_customersim.envs.churn_sim import ChrunEnv from gym_customersim.envs.churn_sim_v2 import ChrunEnvV2

42.5

60

0.894118

25

170

5.8

0.48

0.144828

0.372414

0.455172

0.413793

0

0.012658

0.070588

170

3

61

56.666667

0.905063

0

1

0

true

0

1

0

1

0

1

0

null

0

1

0

1

0

null

0

1

0

1

0

1

0

7

abc17391ec4fff555c02b671044cf6cca5fe2aee

270

py

Python

python/testData/inspections/PyTypeCheckerInspection/FunctionAssignments.py

jnthn/intellij-community

8fa7c8a3ace62400c838e0d5926a7be106aa8557

[ "Apache-2.0" ]

2

2019-04-28T07:48:50.000Z

2020-12-11T14:18:08.000Z

python/testData/inspections/PyTypeCheckerInspection/FunctionAssignments.py

jnthn/intellij-community

8fa7c8a3ace62400c838e0d5926a7be106aa8557

[ "Apache-2.0" ]

173

2018-07-05T13:59:39.000Z

2018-08-09T01:12:03.000Z

python/testData/inspections/PyTypeCheckerInspection/FunctionAssignments.py

jnthn/intellij-community

8fa7c8a3ace62400c838e0d5926a7be106aa8557

[ "Apache-2.0" ]

2

2020-03-15T08:57:37.000Z

2020-04-07T04:48:14.000Z

def test(): def g(x): """ :type x: int """ return x g(<warning descr="Expected type 'int', got 'str' instead">"str"</warning>) #fail h = g h(<warning descr="Expected type 'int', got 'str' instead">"str"</warning>) #fail

22.5

84

0.514815

36

270

3.861111

0.416667

0.172662

0.28777

0.345324

0.776978

0

0.296296

270

11

85

24.545455

0.731579

0.02963

0

0.369369

0

null

0

null

0

null

0

1

0

1

0

null

0

1

0

8

abd65257455504df6aa09dc3ed9a3c9da7ea4240

4,581

py

Python

remlang/compiler/linked_list.py

thautwarm/Rem

97be815bd9f90cc7bca51782b0583fe90e196c4f

[ "MIT" ]

24

2017-12-30T12:37:13.000Z

2020-10-21T02:48:42.000Z

remlang/compiler/linked_list.py

thautwarm/Rem

97be815bd9f90cc7bca51782b0583fe90e196c4f

[ "MIT" ]

2

2018-03-16T03:23:58.000Z

2019-10-11T16:54:06.000Z

remlang/compiler/linked_list.py

thautwarm/Rem

97be815bd9f90cc7bca51782b0583fe90e196c4f

[ "MIT" ]

null

from typing import Optional class Node: __slots__ = ['next', 'content'] def __init__(self, content=None): self.next = None self.content = content def __str__(self): return self.content.__str__() def __repr__(self): return self.content.__str__() class LinkedList: __slots__ = ['head', 'end'] def __init__(self, head_end=None): if head_end: self.head, self.end = head_end else: self.head: Optional[Node] = None self.end: Optional[Node] = None def append_node(self, node): try: self.end.next = node except AttributeError: self.head = self.end = node self.end = node def __getitem__(self, item): node = self.head for i in range(item): if not node.next: return None node = node.next return node def append(self, v): self.append_node(Node(v)) def append_left_node(self, node): node.next = self.head self.head = node if self.end is None: self.end = node def append_left(self, v): self.append_left_node(Node(v)) def extend(self, linked_list): self.end.next = linked_list.head self.end = linked_list.end def extend_left(self, linked_list): linked_list.end.next = self.head self.head = linked_list.head def __iter__(self): if self.head is None: return None else: n = self.head while n.next: yield n n = n.next yield n def __repr__(self): return self.__str__() def __str__(self): return [n for n in self].__str__() @property def tail(self): return LinkedList(head_end=(self.head.next, self.end) if self.head is not self.end else None) @property def to_list(self): return [e.content for e in self] @property def to_tuple(self): return tuple(e.content for e in self) @staticmethod def from_iter(sequence): _list = LinkedList() for elem in sequence: _list.append(elem) return _list class RevNode(Node): def __init__(self, content=None): super(RevNode, self).__init__(content) self.prev: Optional[RevNode] = None class RevLinkedList: def __init__(self, head_end=None): if head_end: self.head, self.end = head_end else: self.head: Optional[RevNode] = None self.end: Optional[RevNode] = None def append_node(self, node): try: self.end.next = node node.prev = self.end except AttributeError: self.head = self.end = node self.end = node def __getitem__(self, item): node = self.head for i in range(item): if not node.next: return None node = node.next return node def append(self, v): self.append_node(RevNode(v)) def append_left_node(self, node): node.next = self.head if self.head is not Node: self.head.prev = node self.head = node if self.end is None: self.end = node def append_left(self, v): self.append_left_node(RevNode(v)) def extend(self, linked_list): self.end.next = linked_list.head if linked_list.head is not None: linked_list.head.prev = self.end self.end = linked_list.end def extend_left(self, linked_list): linked_list.end.next = self.head if self.head is not None: self.head.prev = linked_list.end self.head = linked_list.head def __iter__(self): if self.head is None: return None else: n = self.head while n.next: yield n n = n.next yield n def __repr__(self): return self.__str__() def __str__(self): return [n for n in self].__str__() @property def tail(self): return LinkedList(head_end=(self.head.next, self.end) if self.head is not self.end else None) @property def to_list(self): return [e.content for e in self] @property def to_tuple(self): return tuple(e.content for e in self) @staticmethod def from_iter(sequence): _list = RevLinkedList() for elem in sequence: _list.append(elem) return _list

24.238095

101

0.560358

590

4,581

4.108475

0.091525

0.09901

0.029703

0.827145

0.786304

0.773927

0.740099

0

0.348614

4,581

188

102

24.367021

0.812332

0

0.810811

0

0.003929

0

1

0.22973

false

0

0.006757

0.081081

0.412162

0

null

0

1

0

1

0

null

0

1

0

8

e6017b47f0f4f995e274b05a8af1413f9c233aaa

11,887

py

Python

controller/api/tests/test_perm.py

shopkeep/deis

d9dd78187e1ddca7086fbdf600a738ae482c5378

[ "Apache-2.0" ]

1

2019-06-17T18:51:47.000Z

controller/api/tests/test_perm.py

shopkeep/deis

d9dd78187e1ddca7086fbdf600a738ae482c5378

[ "Apache-2.0" ]

null

controller/api/tests/test_perm.py

shopkeep/deis

d9dd78187e1ddca7086fbdf600a738ae482c5378

[ "Apache-2.0" ]

null

from __future__ import unicode_literals import json from django.test import TestCase class TestAdminPerms(TestCase): def test_first_signup(self): # register a first user username, password = 'firstuser', 'password' email = 'autotest@deis.io' submit = { 'username': username, 'password': password, 'email': email, } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertTrue(response.data['is_superuser']) # register a second user username, password = 'seconduser', 'password' email = 'autotest@deis.io' submit = { 'username': username, 'password': password, 'email': email, } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertFalse(response.data['is_superuser']) def test_list(self): submit = { 'username': 'firstuser', 'password': 'password', 'email': 'autotest@deis.io', } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertTrue(response.data['is_superuser']) self.assertTrue( self.client.login(username='firstuser', password='password')) response = self.client.get('/api/admin/perms', content_type='application/json') self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 1) self.assertEqual(response.data['results'][0]['username'], 'firstuser') self.assertTrue(response.data['results'][0]['is_superuser']) # register a non-superuser submit = { 'username': 'seconduser', 'password': 'password', 'email': 'autotest@deis.io', } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertFalse(response.data['is_superuser']) self.assertTrue( self.client.login(username='seconduser', password='password')) response = self.client.get('/api/admin/perms', content_type='application/json') self.assertEqual(response.status_code, 403) self.assertIn('You do not have permission', response.data['detail']) def test_create(self): submit = { 'username': 'first', 'password': 'password', 'email': 'autotest@deis.io', } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertTrue(response.data['is_superuser']) submit = { 'username': 'second', 'password': 'password', 'email': 'autotest@deis.io', } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertFalse(response.data['is_superuser']) self.assertTrue( self.client.login(username='first', password='password')) # grant user 2 the superuser perm url = '/api/admin/perms' body = {'username': 'second'} response = self.client.post(url, json.dumps(body), content_type='application/json') self.assertEqual(response.status_code, 201) response = self.client.get(url) self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 2) self.assertIn('second', str(response.data['results'])) def test_delete(self): submit = { 'username': 'first', 'password': 'password', 'email': 'autotest@deis.io', } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertTrue(response.data['is_superuser']) submit = { 'username': 'second', 'password': 'password', 'email': 'autotest@deis.io', } url = '/api/auth/register' response = self.client.post(url, json.dumps(submit), content_type='application/json') self.assertEqual(response.status_code, 201) self.assertFalse(response.data['is_superuser']) self.assertTrue( self.client.login(username='first', password='password')) # grant user 2 the superuser perm url = '/api/admin/perms' body = {'username': 'second'} response = self.client.post(url, json.dumps(body), content_type='application/json') self.assertEqual(response.status_code, 201) # revoke the superuser perm response = self.client.delete(url + '/second') self.assertEqual(response.status_code, 204) response = self.client.get(url) self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 1) self.assertNotIn('two', str(response.data['results'])) class TestAppPerms(TestCase): fixtures = ['test_sharing.json'] def setUp(self): self.assertTrue( self.client.login(username='autotest-1', password='password')) def test_create(self): # check that user 1 sees her lone app and user 2's app response = self.client.get('/api/apps') self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 2) app_id = response.data['results'][0]['id'] # check that user 2 can only see his app self.assertTrue( self.client.login(username='autotest-2', password='password')) response = self.client.get('/api/apps') self.assertEqual(len(response.data['results']), 1) # check that user 2 can't see any of the app's builds, configs, # containers, limits, or releases for model in ['builds', 'config', 'containers', 'limits', 'releases']: response = self.client.get("/api/apps/{}/{}/".format(app_id, model)) self.assertEqual(response.data['detail'], 'Not found') # TODO: test that git pushing to the app fails # give user 2 permission to user 1's app self.assertTrue( self.client.login(username='autotest-1', password='password')) url = "/api/apps/{}/perms".format(app_id) body = {'username': 'autotest-2'} response = self.client.post(url, json.dumps(body), content_type='application/json') self.assertEqual(response.status_code, 201) # check that user 2 can see the app self.assertTrue( self.client.login(username='autotest-2', password='password')) response = self.client.get('/api/apps') self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 2) # check that user 2 sees (empty) results now for builds, containers, # and releases. (config and limit will still give 404s since we didn't # push a build here.) for model in ['builds', 'containers', 'releases']: response = self.client.get("/api/apps/{}/{}/".format(app_id, model)) self.assertEqual(len(response.data['results']), 0) # TODO: check that user 2 can git push the app def test_create_errors(self): # check that user 1 sees her lone app response = self.client.get('/api/apps') app_id = response.data['results'][0]['id'] # check that user 2 can't create a permission self.assertTrue( self.client.login(username='autotest-2', password='password')) url = "/api/apps/{}/perms".format(app_id) body = {'username': 'autotest-2'} response = self.client.post(url, json.dumps(body), content_type='application/json') self.assertEqual(response.status_code, 403) def test_delete(self): # give user 2 permission to user 1's app self.assertTrue( self.client.login(username='autotest-1', password='password')) response = self.client.get('/api/apps') app_id = response.data['results'][0]['id'] url = "/api/apps/{}/perms".format(app_id) body = {'username': 'autotest-2'} response = self.client.post(url, json.dumps(body), content_type='application/json') self.assertEqual(response.status_code, 201) # check that user 2 can see the app as well as his own self.assertTrue( self.client.login(username='autotest-2', password='password')) response = self.client.get('/api/apps') self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 2) # try to delete the permission as user 2 url = "/api/apps/{}/perms/{}".format(app_id, 'autotest-2') response = self.client.delete(url, content_type='application/json') self.assertEqual(response.status_code, 403) self.assertIsNone(response.data) # delete permission to user 1's app self.assertTrue( self.client.login(username='autotest-1', password='password')) response = self.client.delete(url, content_type='application/json') self.assertEqual(response.status_code, 204) self.assertIsNone(response.data) # check that user 2 can only see his app self.assertTrue( self.client.login(username='autotest-2', password='password')) response = self.client.get('/api/apps') self.assertEqual(len(response.data['results']), 1) # delete permission to user 1's app again, expecting an error self.assertTrue( self.client.login(username='autotest-1', password='password')) response = self.client.delete(url, content_type='application/json') self.assertEqual(response.status_code, 404) def test_list(self): # check that user 1 sees her lone app and user 2's app response = self.client.get('/api/apps') self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 2) app_id = response.data['results'][0]['id'] # create a new object permission url = "/api/apps/{}/perms".format(app_id) body = {'username': 'autotest-2'} response = self.client.post(url, json.dumps(body), content_type='application/json') self.assertEqual(response.status_code, 201) # list perms on the app response = self.client.get( "/api/apps/{}/perms".format(app_id), content_type='application/json') self.assertEqual(response.data, {'users': ['autotest-2']}) def test_admin_can_list(self): """Check that an administrator can list an app's perms""" response = self.client.get('/api/apps') self.assertEqual(response.status_code, 200) self.assertEqual(len(response.data['results']), 2) def test_list_errors(self): response = self.client.get('/api/apps') app_id = response.data['results'][0]['id'] # login as user 2 self.assertTrue( self.client.login(username='autotest-2', password='password')) # list perms on the app response = self.client.get( "/api/apps/{}/perms".format(app_id), content_type='application/json') self.assertEqual(response.status_code, 403)

45.197719

93

0.619164

1,392

11,887

5.220546

0.104167

0.07018

0.08917

0.111738

0.82166

0.814366

0.803358

0.795239

0.790835

0

0.01607

0.240935

11,887

262

94

45.370229

0.789316

0.101455

0

0.821596

0

0.189197

0.001973

0

0.003817

0.333333

1

0.051643

false

0.117371

0.014085

0

0.079812

0

null

0

1

0

1

0

null

0

1

0

8

e6098f9147f54d830712328f16541a10eb622936

229

py

Python

hedwig/stats/__init__.py

JanKralj/hedwig

a3c54fae253dca3234c880f92836cea73f1569b2

[ "MIT" ]

9

2015-01-18T14:00:13.000Z

2020-03-28T18:57:20.000Z

hedwig/stats/__init__.py

JanKralj/hedwig

a3c54fae253dca3234c880f92836cea73f1569b2

[ "MIT" ]

null

hedwig/stats/__init__.py

JanKralj/hedwig

a3c54fae253dca3234c880f92836cea73f1569b2

[ "MIT" ]

10

2015-01-28T10:31:46.000Z

2021-05-29T04:58:11.000Z

from hedwig.stats import scorefunctions from hedwig.stats import adjustment from hedwig.stats import significance from hedwig.stats.validate import Validate __all__ = ["scorefunctions", "adjustment", "significance", "Validate"]

32.714286

70

0.816594

26

229

7.038462

0.346154

0.218579

0.327869

0.344262

0

0.100437

229

6

71

38.166667

0.88835

0

0.19214

0

1

0

false

0

0.8

0

0.8

0

1

0

null

1

0

1

0

null

0

1

0

1

0

7

e61c7fb593163a3399d4b6f6fd861628b26696ab

41

py

Python

smartmove/visuals/latex/__init__.py

ryanjdillon/smartmove

fb0bf9a309939519e076ea7cbb5aadcd900f9301

[ "MIT" ]

null

smartmove/visuals/latex/__init__.py

ryanjdillon/smartmove

fb0bf9a309939519e076ea7cbb5aadcd900f9301

[ "MIT" ]

13

2017-10-09T10:08:43.000Z

2018-12-05T17:45:46.000Z

smartmove/visuals/latex/__init__.py

ryanjdillon/smartmove

fb0bf9a309939519e076ea7cbb5aadcd900f9301

[ "MIT" ]

null

from . import tables from . import utils

13.666667

20

0.756098

6

41

5.166667

0.666667

0.645161

0

0.195122

41

2

21

20.5

0.939394

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

e6469a9d725b9e4af9dc714fa007ff8380655c9c

172

py

Python

gaiadet/models/__init__.py

zengming16/GAIA-det

cac6b5601d63aeaa3882cea2256dcb2539fecb34

[ "Apache-2.0" ]

149

2021-06-21T06:18:16.000Z

2022-03-23T08:55:23.000Z

gaiadet/models/__init__.py

zengming16/GAIA-det

cac6b5601d63aeaa3882cea2256dcb2539fecb34

[ "Apache-2.0" ]

7

2021-07-11T07:52:58.000Z

2022-03-30T11:41:39.000Z

gaiadet/models/__init__.py

zengming16/GAIA-det

cac6b5601d63aeaa3882cea2256dcb2539fecb34

[ "Apache-2.0" ]

13

2021-06-29T06:06:13.000Z

2022-02-28T01:31:17.000Z

from .backbones import * # noqa: F401, F403 from .detectors import * # noqa: F401, F403 from .necks import * # noqa: F401, F403 from .utils import * # noqa: F401, F403

34.4

44

0.674419

24

172

4.833333

0.375

0.344828

0.482759

0.62069

0.568966

0

0.176471

0.209302

172

4

45

43

0.676471

0.389535

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

8

0512571619fa252ebff942684fb9eb4d74c49c5c

2,232

py

Python

ClassicMedium/Bender/test_multiloop.py

RevDownie/CodinGameSolutions

af7d0ef4b38007766c3b121ea14be59eec26541c

[ "MIT" ]

null

ClassicMedium/Bender/test_multiloop.py

RevDownie/CodinGameSolutions

af7d0ef4b38007766c3b121ea14be59eec26541c

[ "MIT" ]

null

ClassicMedium/Bender/test_multiloop.py

RevDownie/CodinGameSolutions

af7d0ef4b38007766c3b121ea14be59eec26541c

[ "MIT" ]

null

# Test in which Bender cannot reach the goal and instead loops import core SAMPLE_INPUT_DIMS = '30 15' SAMPLE_INPUT_GRID_LINES = [ '###############', '# #@#I T$# #', '# # IB # #', '# # W # #', '# # ## #', '# #B XBN# # #', '# ## # #', '# # # #', '# # W # #', '# # ## #', '# #B XBN# # #', '# ## # #', '# # # #', '# # W # #', '# # ## #', '# #B XBN# # #', '# ## # #', '# # # #', '# # # #', '# # ## #', '# # XBIT # #', '# ######### #', '# #', '# ##### ##### #', '# # # #', '# # # ## #', '# # # # #', '# ##### ##### #', '# #', '###############'] SAMPLE_EXPECTED_OUTPUT_LINES = [ 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'EAST', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'WEST', 'WEST', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'NORTH', 'WEST', 'WEST', 'WEST', 'WEST', 'WEST', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'EAST', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'WEST', 'WEST', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'NORTH', 'WEST', 'WEST', 'WEST', 'WEST', 'WEST', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'EAST', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'WEST', 'WEST', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'SOUTH', 'SOUTH', 'SOUTH', 'WEST', 'WEST', 'WEST', 'WEST', 'WEST', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'EAST', 'NORTH', 'NORTH', 'NORTH', 'NORTH', 'WEST', 'WEST', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'SOUTH', 'EAST', 'EAST', 'EAST', 'EAST' ] h, w = core.parse_dims(SAMPLE_INPUT_DIMS) grid = core.parse_grid(SAMPLE_INPUT_GRID_LINES, w, h) core.run(grid, SAMPLE_EXPECTED_OUTPUT_LINES)

11.16

62

0.447133

220

2,232

4.454545

0.163636

0.632653

0.811224

0.959184

0.742857

0.727551

0.713265

0

0.002278

0.213262

2,232

199

63

11.21608

0.555809

0.026882

0

0.917526

0

0.545161

0

1

0

false

0

0.005155

0

0.005155

0

null

1

0

1

0

1

0

null

0

9

052b365b1cbb76b49e15da922d705dd67f10f7a0

13,867

py

Python

Collect_data.py

Tsettaro/AniHelp

92738616e57fb951cdb32b0312faeef35095d2c6

[ "MIT" ]

null

Collect_data.py

Tsettaro/AniHelp

92738616e57fb951cdb32b0312faeef35095d2c6

[ "MIT" ]

1

2021-07-14T20:39:06.000Z

2021-07-14T20:39:07.000Z

Collect_data.py

Tsettaro/AniHelp

92738616e57fb951cdb32b0312faeef35095d2c6

[ "MIT" ]

null

from bs4 import BeautifulSoup import requests from itertools import combinations import re import pandas as pd import time from selenium import webdriver def get_n(soup, id, shop): if shop == 'discomir': goods = soup.findAll('a', class_='text_fader') elif shop == 'XL': driver = webdriver.Firefox(executable_path=r'A:\geckodriver.exe') driver.get(soup) time.sleep(6) elif shop == 'Nyaki': goods = soup.findAll('div', class_='product-name') namae = [] if shop == 'discomir': for data in goods: namae.append(data.text) elif shop == "XL": tag_list = driver.find_elements_by_class_name("product-name") for e in tag_list: namae.append(e.text) elif shop == 'Nyaki': for data in goods: namae.append(data.text) lim = [] lim_pr = [] if id == 'manga' and shop == 'discomir': goods.clear() for i in range(len(namae)): if re.findall(r'Ранобэ',namae[i]): lim.append(i) namae = [x for ind,x in enumerate(namae) if ind+1 not in lim] lim.clear() for i in range(len(namae)): if re.findall(r'Том 1+$|Книга 1+$|Vol. 1+$',namae[i]): lim.append(namae[i]) namae.clear() return lim elif id == 'manga' and shop == 'XL': but = driver.find_elements_by_class_name("button") for e in but: lim.append(e.text) del lim[0] for e in range(len(lim)): if lim[e] != 'Купить': lim_pr.append(e) for n in sorted(lim_pr, reverse=True): del namae[n] but.clear() lim.clear() for i in range(len(namae)): if re.findall(r'Том 1+$|Книга 1+$|Vol. 1+$|Том 1.+$', namae[i]): lim.append(namae[i]) driver.quit() return lim elif id == 'manga' and shop == 'Nyaki': for i in range(len(namae)): if re.findall(r'1 том+$|1 книга+$', namae[i]): j = namae[i].find('1') if namae[i][j + 1] == ' ': lim.append(namae[i]) return lim elif id == 'figure' and shop == 'XL': but = driver.find_elements_by_class_name("button") for e in but: lim.append(e.text) del lim[0] for e in range(len(lim)): if lim[e] != 'Купить': lim_pr.append(e) for n in sorted(lim_pr, reverse=True): del namae[n] but.clear() lim.clear() driver.quit() return namae elif id == 'figure' and shop == 'discomir': for i in range(len(namae)): if re.findall(r'Копия', namae[i]) or re.findall(r'Pokemon', namae[i]) or re.findall(r'One Piece', namae[i]): lim.append(i) namae = [x for ind,x in enumerate(namae) if ind+1 not in lim] lim.clear() return namae elif id == 'znachok' and shop == 'discomir': for i in range(len(namae)): namae[i] = namae[i][:-5] return namae elif id == 'napitki' and shop == 'Nyaki': return namae def get_p(soup, id, shop): if shop == 'discomir': goods = soup.findAll('a', class_='text_fader') t_pri = soup.findAll('div', class_='price') elif shop == 'XL': driver = webdriver.Firefox(executable_path=r'A:\geckodriver.exe') driver.get(soup) time.sleep(6) elif shop == 'Nyaki': goods = soup.findAll('div', class_='product-name') t_pri = soup.findAll('div', class_='column column-cost') namae = [] pri = [] if shop == 'discomir': for data in goods: namae.append(data.text) for data in t_pri: pri.append(data.text[:-5]) elif shop == 'XL': tag_list = driver.find_elements_by_class_name("product-name") for e in tag_list: namae.append(e.text) but = driver.find_elements_by_class_name("costs-value") m = [] for e in but: m.append(e.text) for data in m: r = data if 'Цена' in r: s = r[1:-3].find('а') dob = r[s+3:-1] dob = re.sub('\s', '', dob) pri.append(dob) else: s = r[1:-3].find('₽') ik = r[s + 3:-2] dob = re.sub('\s', '', ik) pri.append(dob) elif shop == 'Nyaki': for data in goods: namae.append(data.text) for data in t_pri: pri.append(data.text[:-11]) lim = [] lim_pr = [] if id == 'manga' and shop == 'discomir': goods.clear() t_pri.clear() for i in range(len(namae)): if re.findall(r'Ранобэ', namae[i]): lim.append(i) lim_pr.append(i) namae = [x for ind, x in enumerate(namae) if ind + 1 not in lim] pri = [x for ind, x in enumerate(pri) if ind + 1 not in lim_pr] lim.clear() lim_pr.clear() for i in range(len(namae)): if re.findall(r'Том 1+$|Книга 1+$|Vol. 1+$', namae[i]): lim.append(namae[i]) lim_pr.append(pri[i]) namae.clear() pri.clear() return lim_pr elif id == 'manga' and shop == 'XL': but = driver.find_elements_by_class_name("button") for e in but: lim.append(e.text) del lim[0] for e in range(len(lim)): if lim[e] != 'Купить': lim_pr.append(e) for n in sorted(lim_pr, reverse=True): del namae[n] del pri[n] but.clear() lim.clear() lim_pr.clear() for i in range(len(namae)): if re.findall(r'Том 1+$|Книга 1+$|Vol. 1+$|Том 1.+$', namae[i]): lim.append(namae[i]) lim_pr.append(pri[i]) driver.quit() return lim_pr elif id == 'manga' and shop == 'Nyaki': for i in range(len(namae)): if re.findall(r'1 том+$|1 книга+$', namae[i]): j = namae[i].find('1') if namae[i][j + 1] == ' ': lim_pr.append(pri[i]) return lim_pr elif id == 'figure' and shop == 'XL': but = driver.find_elements_by_class_name("button") for e in but: lim.append(e.text) del lim[0] for e in range(len(lim)): if lim[e] != 'Купить': lim_pr.append(e) for n in sorted(lim_pr, reverse=True): del namae[n] del pri[n] but.clear() lim.clear() lim_pr.clear() driver.quit() return pri elif id == 'figure' and shop == 'discomir': for i in range(len(namae)): if re.findall(r'Копия', namae[i]) or re.findall(r'Pokemon', namae[i]) or re.findall(r'One Piece', namae[i]): lim_pr.append(i) pri = [x for ind, x in enumerate(pri) if ind + 1 not in lim_pr] lim_pr.clear() return pri elif id == 'znachok' and shop == 'discomir': return pri elif id == 'napitki' and shop == 'Nyaki': return pri df = pd.read_excel('output.xlsx') df.pop('Unnamed: 0') # namae = [] # price = [] # Discomir (znachki) # url = "https://diskomir.ru/catalog/znachki/nabory_znachkov/?from_movie=bananovaya_ryba_banana_fish_rybka_bananka&from_movie=voleybol_haikyu_haikyuu_&from_movie=doktor_stoun_dr_stone_doctor_stone&from_movie=drakon_gornichnaya_kobayashi_kobayashi_san_chi_no_maid_dragon_miss_kobayashi_s_dragon_maid&from_movie=durochka_aho_girl_ahogaru_clueless_girl" # page = requests.get(url) # soup = BeautifulSoup(page.text, "html.parser") # namae = namae + get_n(soup, 'znachok', 'discomir') # price = price + get_p(soup, 'znachok', 'discomir') # for i in range(len(namae)): # if price[i].isdigit()==True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'Discomir', 'Pins']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # Old collect data # Diskomir (manga) # url = 'https://diskomir.ru/catalog/manga/manga/?arrFilter_ff%5BNAME%5D=&arrFilter_pf%5BNALICHIE%5D=86&arrFilter_pf%5BFROM_MOVIE%5D=&arrFilter_pf%5BMADE_BY%5D=&set_filter=%CD%E0%E9%F2%E8' # page = requests.get(url) # soup = BeautifulSoup(page.text, "html.parser") # namae = namae + get_n(soup, 'manga', 'discomir') # price = price + get_p(soup, 'manga', 'discomir') # for k in range(2, 13): # url = 'https://diskomir.ru/catalog/manga/manga/?arrFilter_ff%5BNAME%5D=&arrFilter_pf%5BNALICHIE%5D=86&arrFilter_pf%5BFROM_MOVIE%5D=&arrFilter_pf%5BMADE_BY%5D=&set_filter=%CD%E0%E9%F2%E8&PAGEN_1=' + str(k) # page = requests.get(url) # soup = BeautifulSoup(page.text, "html.parser") # namae = namae + get_n(soup, 'manga', 'discomir') # price = price + get_p(soup, 'manga', 'discomir') # del price[96] # del namae[96] # # df = pd.DataFrame(columns=['name', 'price', 'shop', 'category']) # for i in range(len(namae)): # if price[i].isdigit() == True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'Discomir', 'Manga']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # namae.clear() # price.clear() # Discomir (figurki) # url = 'https://diskomir.ru/catalog/animefigurki/malenkie_kitayskie_figurki/?arrFilter_ff%5BNAME%5D=&arrFilter_pf%5BNALICHIE%5D=86&arrFilter_pf%5BFROM_MOVIE%5D=&arrFilter_pf%5BMADE_BY%5D=&set_filter=%CD%E0%E9%F2%E8' # page = requests.get(url) # soup = BeautifulSoup(page.text, "html.parser") # namae = namae + get_n(soup, 'figure', 'discomir') # price = price + get_p(soup, 'figure', 'discomir') # url = 'https://diskomir.ru/catalog/animefigurki/malenkie_kitayskie_figurki/?arrFilter_ff%5BNAME%5D=&arrFilter_pf%5BNALICHIE%5D=86&arrFilter_pf%5BFROM_MOVIE%5D=&arrFilter_pf%5BMADE_BY%5D=&set_filter=%CD%E0%E9%F2%E8&PAGEN_1=2' # page = requests.get(url) # soup = BeautifulSoup(page.text, "html.parser") # namae = namae + get_n(soup, 'figure', 'discomir') # price = price + get_p(soup, 'figure', 'discomir') # del namae[len(namae)-1] # del price[len(namae)-1] # for i in range(len(namae)): # if price[i].isdigit()==True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'Discomir', 'Figure']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # # namae.clear() # price.clear() # XL (the end 224) (figurki) # # for k in range(2, 5): # url = 'https://xlm.ru/nendoroid?by=popular&page='+str(k) # namae = namae + get_n(url, 'figure', 'XL') # price = price + get_p(url, 'figure', 'XL') # for i in range(len(namae)): # if price[i].isdigit() == True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'XL Media', 'Figure']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # # namae.clear() # price.clear() # XL (manga) # url = 'https://xlm.ru/manga?by=popular' # namae = namae + get_n(url, 'manga', 'XL') # price = price + get_p(url, 'manga', 'XL') # for i in range(len(namae)): # if price[i].isdigit() == True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'XL Media', 'Manga']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # # namae.clear() # price.clear() # # for k in range(2, 19): # url = 'https://xlm.ru/manga?by=popular&page='+str(k) # namae = namae + get_n(url, 'manga', 'XL') # price = price + get_p(url, 'manga', 'XL') # # for i in range(len(namae)): # if price[i].isdigit() == True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'XL Media', 'Manga']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # Nyaki (manga) # for i in range(1, 9): # url = 'https://nyaki.ru/catalog/manga/?page='+str(i) # page = requests.get(url) # soup = BeautifulSoup(page.text, "html.parser") # namae = namae + get_n(soup, 'manga', 'Nyaki') # price = price + get_p(soup, 'manga', 'Nyaki') # for i in range(len(namae)): # if price[i].isdigit() == True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'Nyaki', 'Manga']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # url = 'https://nyaki.ru/catalog/napitki/' # page = requests.get(url) # soup = BeautifulSoup(page.text, "html.parser") # namae = namae + get_n(soup, 'napitki', 'Nyaki') # price = price + get_p(soup, 'napitki', 'Nyaki') # for i in range(len(namae)): # if price[i].isdigit() == True: # _df = pd.DataFrame([[namae[i], int(price[i]), 'Nyaki', 'Soda']], columns=['name', 'price', 'shop', 'category']) # df = df.append(_df, ignore_index=True) # a = [] # for i in range(168): # a.append(i) # data = list(combinations(a, 3)) # print(len(data)) # a.clear() # i = 0 # for k in range(len(data)): # if df.iloc[data[k][0]]['category'] != df.iloc[data[k][1]]['category'] and df.iloc[data[k][0]]['category'] != df.iloc[data[k][2]]['category'] and df.iloc[data[k][1]]['category'] != df.iloc[data[k][2]]['category']: # a.append(data[k]) # i+=1 # print('Now – '+str(k)) # print('Real – ' + str(i)) # print(a) # # i = 0 # k = 0 # res = pd.DataFrame(columns=['Комплект', 'name', 'price', 'shop', 'category']) # for i in range(len(a)): # for j in range(len(a[i])): # _df = pd.DataFrame([[i + 1, df.at[int(a[i][j]), 'name'], df.at[int(a[i][j]), 'price'],df.at[int(a[i][j]), 'shop'], df.at[int(a[i][j]), 'category']]], columns=['Комплект', 'name', 'price', 'shop', 'category']) # res = res.append(_df, ignore_index=True) # k+=1 # print(k) # res.to_excel('result.xlsx') # i = df.iloc[0]['price'] # i = i + 1 # print(i) # df.to_excel('output.xlsx')

37.579946

350

0.560035

1,996

13,867

3.79509

0.107214

0.026139

0.034323

0.031947

0.825611

0.798152

0.758416

0.732805

0.728845

0.716964

0

0.013915

0.258888

13,867

368

351

37.682065

0.722876

0.453523

0

0.843602

0

0.089125

0

1

0.009479

false

0

0.033175

0

0.109005

0

null

0

1

0

1

0

null

0

7

055f7d5cf89f8dc52c0e13c28e574fb5b8921ac0

14,645

py

Python

yr_2_3_4.py

Shantanu-S/Tuition-Bot-NTU

8632d0534679360229cd9f511e66235901c92c4b

[ "MIT" ]

1

2016-12-10T01:56:09.000Z

yr_2_3_4.py

Shantanu-S/Tuition-Bot-NTU

8632d0534679360229cd9f511e66235901c92c4b

[ "MIT" ]

null

yr_2_3_4.py

Shantanu-S/Tuition-Bot-NTU

8632d0534679360229cd9f511e66235901c92c4b

[ "MIT" ]

null

YEAR 2 ALGORITHMS ['https://www.youtube.com/watch?v=JPyuH4qXLZ0&hl=en-GB&gl=SG','https://www.youtube.com/watch?v=2P-yW7LQr08&list=PLUl4u3cNGP6317WaSNfmCvGym2ucw3oGp','https://www.youtube.com/watch?v=Nz1KZXbghj8','https://www.youtube.com/watch?v=9Jry5-82I68','https://www.youtube.com/watch?v=gXgEDyodOJU','https://www.youtube.com/watch?v=moPtwq_cVH8'] OBJECT ORIENTED DESIGN AND PROGRAMMING ['https://www.youtube.com/watch?v=lbXsrHGhBAU','https://www.youtube.com/watch?v=lbXsrHGhBAU','https://www.youtube.com/watch?v=S3t-5UtvDN0','https://www.youtube.com/watch?v=ng98qapa4Sw','https://www.youtube.com/watch?v=v4SdA2ehvoU','https://www.youtube.com/watch?v=kZnaFP9U9nY','https://www.youtube.com/watch?v=RcZAkBVNYTA','https://www.youtube.com/watch?v=ZQ5_u8Lgvyk','https://www.youtube.com/watch?v=3u1fu6f8Hto','https://www.youtube.com/watch?v=znnAMcGfI0E'] DIGITAL SYSTEMS DESIGN ['https://www.youtube.com/watch?v=0age83XI8Z4 ; https://www.youtube.com/watch?v=5-EEAB0XUIk','https://www.youtube.com/watch?v=5-EEAB0XUIk','https://www.youtube.com/watch?v=5-EEAB0XUIk','https://www.youtube.com/watch?v=CLUoWkJUnN0','https://www.youtube.com/watch?v=rHtNQTjOY3E','https://www.youtube.com/watch?v=AXgfeV568c8','-','https://www.youtube.com/watch?v=Ss1Saa54sBI','https://www.youtube.com/watch?v=AVrJRPL-e0g'] CIRCUITS AND SIGNAL ANALYSIS ['https://www.youtube.com/watch?v=3ARwItoY_nc','https://www.youtube.com/watch?v=3ARwItoY_nc','https://www.youtube.com/watch?v=-FHm2pQmiSM&list=PLUl4u3cNGP61kdPAOC7CzFjJZ8f1eMUxs','https://www.youtube.com/watch?v=JAX4xARloXk'] OPERATING SYSTEMS ['https://www.youtube.com/watch?v=JAX4xARloXk','https://www.youtube.com/watch?v=hsERPf9k54U','https://www.youtube.com/watch?v=FiGKndlvO8I','https://www.youtube.com/watch?v=FiGKndlvO8I','https://www.youtube.com/watch?v=2klwq4GeVtw','https://www.youtube.com/watch?v=0FPOgQ5_YZk','https://www.youtube.com/watch?v=iqfjWIYyQ9k','https://www.youtube.com/watch?v=a86Nxi7lH1s','https://www.youtube.com/watch?v=WW2vB_e-8Os','https://www.youtube.com/watch?v=HlU5cYqGLZE','https://www.youtube.com/watch?v=6nadXMSFSjk'] SOFTWARE ENGINEERING ['https://www.youtube.com/watch?v=LOLxYo23KLc','https://www.youtube.com/watch?v=wEr6mwquPLY','https://www.youtube.com/watch?v=wEr6mwquPLY','https://www.youtube.com/watch?v=1TxXtrQRkuw','https://www.youtube.com/watch?v=1TxXtrQRkuw','https://www.youtube.com/watch?v=Zmv6ha2IBtE','https://www.youtube.com/watch?v=8CO29Pbyjx0'] MICROPROCESSOR-BASED SYSTEM DESIGN ['https://www.youtube.com/watch?v=1famitdmzwk&list=PLZ9YeF_1_vF-y4pIbimAX8iyLJhPjCeLl','https://www.youtube.com/watch?v=ssc-i-Vl3iM','https://www.youtube.com/watch?v=7LqPJGnBPMM','https://www.youtube.com/watch?v=9A5ivudtfsw','https://www.youtube.com/watch?v=Chw-FmmDh2I','https://www.youtube.com/watch?v=jxX8MexaVTk','https://www.youtube.com/watch?v=JJqraszIeeU','https://www.youtube.com/watch?v=9A5ivudtfsw','https://www.youtube.com/watch?v=omxQsvenf9o','https://www.youtube.com/watch?v=UhJ5op0WZLg','https://www.youtube.com/watch?v=whYljse4Abc','-'] year2=[['https://www.youtube.com/watch?v=JPyuH4qXLZ0&hl=en-GB&gl=SG','https://www.youtube.com/watch?v=2P-yW7LQr08&list=PLUl4u3cNGP6317WaSNfmCvGym2ucw3oGp','https://www.youtube.com/watch?v=Nz1KZXbghj8','https://www.youtube.com/watch?v=9Jry5-82I68','https://www.youtube.com/watch?v=gXgEDyodOJU','https://www.youtube.com/watch?v=moPtwq_cVH8'],['https://www.youtube.com/watch?v=lbXsrHGhBAU','https://www.youtube.com/watch?v=lbXsrHGhBAU','https://www.youtube.com/watch?v=S3t-5UtvDN0','https://www.youtube.com/watch?v=ng98qapa4Sw','https://www.youtube.com/watch?v=v4SdA2ehvoU','https://www.youtube.com/watch?v=kZnaFP9U9nY','https://www.youtube.com/watch?v=RcZAkBVNYTA','https://www.youtube.com/watch?v=ZQ5_u8Lgvyk','https://www.youtube.com/watch?v=3u1fu6f8Hto','https://www.youtube.com/watch?v=znnAMcGfI0E'],['https://www.youtube.com/watch?v=0age83XI8Z4 ; https://www.youtube.com/watch?v=5-EEAB0XUIk','https://www.youtube.com/watch?v=5-EEAB0XUIk','https://www.youtube.com/watch?v=5-EEAB0XUIk','https://www.youtube.com/watch?v=CLUoWkJUnN0','https://www.youtube.com/watch?v=rHtNQTjOY3E','https://www.youtube.com/watch?v=AXgfeV568c8','-','https://www.youtube.com/watch?v=Ss1Saa54sBI','https://www.youtube.com/watch?v=AVrJRPL-e0g'],['https://www.youtube.com/watch?v=3ARwItoY_nc','https://www.youtube.com/watch?v=3ARwItoY_nc','https://www.youtube.com/watch?v=-FHm2pQmiSM&list=PLUl4u3cNGP61kdPAOC7CzFjJZ8f1eMUxs','https://www.youtube.com/watch?v=JAX4xARloXk'],['https://www.youtube.com/watch?v=JAX4xARloXk','https://www.youtube.com/watch?v=hsERPf9k54U','https://www.youtube.com/watch?v=FiGKndlvO8I','https://www.youtube.com/watch?v=FiGKndlvO8I','https://www.youtube.com/watch?v=2klwq4GeVtw','https://www.youtube.com/watch?v=0FPOgQ5_YZk','https://www.youtube.com/watch?v=iqfjWIYyQ9k','https://www.youtube.com/watch?v=a86Nxi7lH1s','https://www.youtube.com/watch?v=WW2vB_e-8Os','https://www.youtube.com/watch?v=HlU5cYqGLZE','https://www.youtube.com/watch?v=6nadXMSFSjk'],['https://www.youtube.com/watch?v=LOLxYo23KLc','https://www.youtube.com/watch?v=wEr6mwquPLY','https://www.youtube.com/watch?v=wEr6mwquPLY','https://www.youtube.com/watch?v=1TxXtrQRkuw','https://www.youtube.com/watch?v=1TxXtrQRkuw','https://www.youtube.com/watch?v=Zmv6ha2IBtE','https://www.youtube.com/watch?v=8CO29Pbyjx0'],['https://www.youtube.com/watch?v=1famitdmzwk&list=PLZ9YeF_1_vF-y4pIbimAX8iyLJhPjCeLl','https://www.youtube.com/watch?v=ssc-i-Vl3iM','https://www.youtube.com/watch?v=7LqPJGnBPMM','https://www.youtube.com/watch?v=9A5ivudtfsw','https://www.youtube.com/watch?v=Chw-FmmDh2I','https://www.youtube.com/watch?v=jxX8MexaVTk','https://www.youtube.com/watch?v=JJqraszIeeU','https://www.youtube.com/watch?v=9A5ivudtfsw','https://www.youtube.com/watch?v=omxQsvenf9o','https://www.youtube.com/watch?v=UhJ5op0WZLg','https://www.youtube.com/watch?v=whYljse4Abc','-']] ------------------------------------------------------- YEAR 3 ADNAVED COMPUTER ARCHITECTURE ['https://www.youtube.com/watch?v=39LjZM2zMMw','Instead of seeing a video ,it would be better if you could refer the notes','https://www.youtube.com/watch?v=HbsuwpJgKao','https://www.youtube.com/watch?v=NrfuKTGvsFE','https://www.youtube.com/watch?v=ZSw5HPUwK8s','https://www.youtube.com/watch?v=BWmljynuhYo','https://www.youtube.com/watch?v=LFHOMYlWslU','https://www.youtube.com/watch?v=TfIajPoRdmw','https://www.youtube.com/watch?v=Q-1mSk0HYuY'] SENSORS, INTERFACING AND CONTROL ['https://www.youtube.com/watch?v=jnY9T4Bf9h8','https://www.youtube.com/watch?v=xaOF2SNktRY','https://www.youtube.com/watch?v=Rje5DJSe098','https://www.youtube.com/watch?v=WT-qzgaKeGI','https://www.youtube.com/watch?v=IEeltuxzPYE','https://www.youtube.com/watch?v=VtxFtzWlTgg','https://www.youtube.com/watch?v=dP496kJmzXc','https://www.youtube.com/watch?v=o1MWMrFhXXs','https://www.youtube.com/watch?v=O-OqgFE9SD4&list=PLFFbyVlrhQnvaEyHXkfxpKRVzhDocc6eT','https://www.youtube.com/watch?v=NjRiqHSGmB0','https://www.youtube.com/watch?v=RJleGwXorUk','https://www.youtube.com/watch?v=rNMlaq8xABE','https://www.youtube.com/watch?v=eNVN67eZC88'] MICROCONTROLLER PROGRAMMING ['https://www.youtube.com/watch?v=o-a1uXkcNXY','https://www.youtube.com/watch?v=pz57y4BHIy0','http://www.open-std.org/jtc1/sc22/wg21/docs/ESC_Boston_01_304_paper.pdf','https://www.youtube.com/watch?v=I35w8v_rcmY','https://www.youtube.com/watch?v=kgcUVZARftQ','https://www.youtube.com/watch?v=oWmTJdYYRTg','https://www.youtube.com/watch?v=FnGCDLhaxKU'] MULTIDISCIPLINATU DESIGN PROJECT ['-'] COMPUTER NETWORKS ['https://www.youtube.com/watch?v=JvXro0dzJY8','https://www.youtube.com/watch?v=EcbyD_YycPA','https://www.youtube.com/watch?v=0nUERzTBJbQ','https://www.youtube.com/watch?v=t9TmvFvYfWw','https://www.youtube.com/watch?v=V3E1LmPtkDk','https://www.youtube.com/watch?v=TKJ5oobqcE0','https://www.youtube.com/watch?v=0_QczZ1lNDU'] DIGITAL COMMUNICATION ['https://www.youtube.com/watch?v=3w_0163BVQk','-','https://www.youtube.com/watch?v=I0Xz0ORXkVM','https://www.youtube.com/watch?v=lYjIGni4Z7g','https://www.youtube.com/watch?v=g4FHG04Yra8','https://www.youtube.com/watch?v=lYjIGni4Z7g','https://www.youtube.com/watch?v=nDPoMPT1dYY','https://www.youtube.com/watch?v=eOMpGda71Fg','https://www.youtube.com/watch?v=whYljse4Abc'] DIGITAL SIGNAL PROCESSING ['https://www.youtube.com/watch?v=LJ--VtkMxQY','https://www.youtube.com/watch?v=_0bxZCiFZpU&list=PLdciPPorsHukq1koI2EsNpKir3j0lKkCn','https://www.youtube.com/watch?v=GDFTb-BwA0o','https://www.youtube.com/watch?v=FLPqshreE-g','https://www.youtube.com/watch?v=9yNQBWKRSs4','https://www.youtube.com/watch?v=Z1N0qeiw9oE'] year3=[['https://www.youtube.com/watch?v=39LjZM2zMMw','Instead of seeing a video ,it would be better if you could refer the notes','https://www.youtube.com/watch?v=HbsuwpJgKao','https://www.youtube.com/watch?v=NrfuKTGvsFE','https://www.youtube.com/watch?v=ZSw5HPUwK8s','https://www.youtube.com/watch?v=BWmljynuhYo','https://www.youtube.com/watch?v=LFHOMYlWslU','https://www.youtube.com/watch?v=TfIajPoRdmw','https://www.youtube.com/watch?v=Q-1mSk0HYuY'],['https://www.youtube.com/watch?v=jnY9T4Bf9h8','https://www.youtube.com/watch?v=xaOF2SNktRY','https://www.youtube.com/watch?v=Rje5DJSe098','https://www.youtube.com/watch?v=WT-qzgaKeGI','https://www.youtube.com/watch?v=IEeltuxzPYE','https://www.youtube.com/watch?v=VtxFtzWlTgg','https://www.youtube.com/watch?v=dP496kJmzXc','https://www.youtube.com/watch?v=o1MWMrFhXXs','https://www.youtube.com/watch?v=O-OqgFE9SD4&list=PLFFbyVlrhQnvaEyHXkfxpKRVzhDocc6eT','https://www.youtube.com/watch?v=NjRiqHSGmB0','https://www.youtube.com/watch?v=RJleGwXorUk','https://www.youtube.com/watch?v=rNMlaq8xABE','https://www.youtube.com/watch?v=eNVN67eZC88'],['https://www.youtube.com/watch?v=o-a1uXkcNXY','https://www.youtube.com/watch?v=pz57y4BHIy0','http://www.open-std.org/jtc1/sc22/wg21/docs/ESC_Boston_01_304_paper.pdf','https://www.youtube.com/watch?v=I35w8v_rcmY','https://www.youtube.com/watch?v=kgcUVZARftQ','https://www.youtube.com/watch?v=oWmTJdYYRTg','https://www.youtube.com/watch?v=FnGCDLhaxKU'],['-'],['https://www.youtube.com/watch?v=JvXro0dzJY8','https://www.youtube.com/watch?v=EcbyD_YycPA','https://www.youtube.com/watch?v=0nUERzTBJbQ','https://www.youtube.com/watch?v=t9TmvFvYfWw','https://www.youtube.com/watch?v=V3E1LmPtkDk','https://www.youtube.com/watch?v=TKJ5oobqcE0','https://www.youtube.com/watch?v=0_QczZ1lNDU'],['https://www.youtube.com/watch?v=3w_0163BVQk','-','https://www.youtube.com/watch?v=I0Xz0ORXkVM','https://www.youtube.com/watch?v=lYjIGni4Z7g','https://www.youtube.com/watch?v=g4FHG04Yra8','https://www.youtube.com/watch?v=lYjIGni4Z7g','https://www.youtube.com/watch?v=nDPoMPT1dYY','https://www.youtube.com/watch?v=eOMpGda71Fg','https://www.youtube.com/watch?v=whYljse4Abc'],['https://www.youtube.com/watch?v=LJ--VtkMxQY','https://www.youtube.com/watch?v=_0bxZCiFZpU&list=PLdciPPorsHukq1koI2EsNpKir3j0lKkCn','https://www.youtube.com/watch?v=GDFTb-BwA0o','https://www.youtube.com/watch?v=FLPqshreE-g','https://www.youtube.com/watch?v=9yNQBWKRSs4','https://www.youtube.com/watch?v=Z1N0qeiw9oE']] --------------------------------------------------------- YEAR 4 VIRTUAL AND AUGMENTED REALITY ['https://www.youtube.com/watch?v=H03G8Y7C9L0','https://www.youtube.com/watch?v=zvgWgpGZVKc','http://www.tandfonline.com/doi/abs/10.1080/088395199117315','-'] VISUAL MEDIA COMPRESSION AND PROCESSING ['-'] COMPUTER VISION ['https://www.udacity.com/course/introduction-to-computer-vision--ud810'] 3D MODELLING AND ANIMATION ['Resources can be found at - http://www.comp.nus.edu.sg/~kkyin/CS3242/'] AUDIO AND SPEECH PROCESSING ['https://www.youtube.com/watch?v=Xjzm7S__kBU'] PARALLEL COMPUTING ['https://www.youtube.com/watch?v=yUtn_vUPbNg&list=PL5PHm2jkkXmh4cDkC3s1VBB7-njlgiG5d'] DISTRIBUTED SYSTEMS ['https://www.youtube.com/watch?v=7zafB2GkMBk&list=PL72C36006AD9CED5C'] SIMULATION AND MODELLING ['https://www.youtube.com/watch?v=d3ChB1tDMyI&list=PLUl4u3cNGP63eWjy1orBicyAXrunfs2jT'] ADVANCED TOPICS IN ALGORITHMS ['https://www.youtube.com/watch?v=0JUN9aDxVmI'] PERVASIVE NETWORKS ['https://www.youtube.com/watch?v=t9rF051DWkk'] PERSONAL MOBILE NETWORKS ['http://www.cse.wustl.edu/~jain/cse574-10/'] ADVANCED COMPUTER NETWORKS ['-'] CRYPTOGRAPHY AND NETWORK SECURITY ['https://www.youtube.com/watch?v=WGmvE9ns4nM&list=PLPl8TJzokTObVRv1Mwo-hP_UV0S1GpUzf'] EMBEDDED SYSTEMS DESIGN ['https://www.youtube.com/watch?v=9oorSIfCR5I&list=PLQefpK95HyFmao3zi-WDOMkeSev-Je5dE'] EMBEDDED SYSTEMS DEVELOPMENT ['https://www.youtube.com/watch?v=3V9eqvkMzHA&list=PLPW8O6W-1chwyTzI3BHwBLbGQoPFxPAPM'] EMBEDDED OPERATING SYSTEMS ['https://www.youtube.com/watch?v=bOFMXuoc5kE&list=PLsiW6hTaeDlSerwQ6JYAu2ED7b4nsMBHM'] PROGRAMMABLE SYSTEMS-ON-CHIP ['https://www.youtube.com/watch?v=pFz1S5NVfRg&list=PLlBhKdf4iTIhzXN0qFK6DKDHHtUsc301S'] COMPUTER SECURITY (SYSTEM SECURITY) ['https://www.youtube.com/watch?v=GqmQg-cszw4&list=PLUl4u3cNGP62K2DjQLRxDNRi0z2IRWnNh'] SECURITY MANAGEMENT ['https://www.youtube.com/watch?v=V7T4WVWvAA8&list=PL5E6D4A5B33DCAE78'] DIGITAL FORENSICS ['https://www.youtube.com/watch?v=Gt0JyXxfB2E&list=PL6oHuo5it4TgA-ZtIo3x5G0l0HDwPPZ9d'] year4=[['https://www.youtube.com/watch?v=H03G8Y7C9L0','https://www.youtube.com/watch?v=zvgWgpGZVKc','http://www.tandfonline.com/doi/abs/10.1080/088395199117315','-'],['-'],['https://www.udacity.com/course/introduction-to-computer-vision--ud810'],['Resources can be found at - http://www.comp.nus.edu.sg/~kkyin/CS3242/'],['https://www.youtube.com/watch?v=Xjzm7S__kBU'],['https://www.youtube.com/watch?v=yUtn_vUPbNg&list=PL5PHm2jkkXmh4cDkC3s1VBB7-njlgiG5d'],['https://www.youtube.com/watch?v=7zafB2GkMBk&list=PL72C36006AD9CED5C'],['https://www.youtube.com/watch?v=d3ChB1tDMyI&list=PLUl4u3cNGP63eWjy1orBicyAXrunfs2jT'],['https://www.youtube.com/watch?v=0JUN9aDxVmI'],['https://www.youtube.com/watch?v=t9rF051DWkk'],['http://www.cse.wustl.edu/~jain/cse574-10/'],['-'],['https://www.youtube.com/watch?v=WGmvE9ns4nM&list=PLPl8TJzokTObVRv1Mwo-hP_UV0S1GpUzf'],['https://www.youtube.com/watch?v=9oorSIfCR5I&list=PLQefpK95HyFmao3zi-WDOMkeSev-Je5dE'],['https://www.youtube.com/watch?v=3V9eqvkMzHA&list=PLPW8O6W-1chwyTzI3BHwBLbGQoPFxPAPM'],['https://www.youtube.com/watch?v=bOFMXuoc5kE&list=PLsiW6hTaeDlSerwQ6JYAu2ED7b4nsMBHM'],['https://www.youtube.com/watch?v=pFz1S5NVfRg&list=PLlBhKdf4iTIhzXN0qFK6DKDHHtUsc301S'],['https://www.youtube.com/watch?v=GqmQg-cszw4&list=PLUl4u3cNGP62K2DjQLRxDNRi0z2IRWnNh'],['https://www.youtube.com/watch?v=V7T4WVWvAA8&list=PL5E6D4A5B33DCAE78'],['https://www.youtube.com/watch?v=Gt0JyXxfB2E&list=PL6oHuo5it4TgA-ZtIo3x5G0l0HDwPPZ9d']] ----------------------------------------------------

92.106918

2,832

0.756367

2,116

14,645

5.215028

0.140359

0.178342

0.331672

0.398006

0.941278

0.918894

0.90222

0.841867

0

0.047798

0.018573

14,645

158

2,833

92.689873

0.719961

0

0.038961

0

0.12987

0.855094

0

null

0

null

0

null

0

1

0

1

0

1

0

null

0

1

0

11

55745fd3991a092bc6741864d77e152a69da3b3b

11,729

py

Python

Simulators/Microsoft Airsim Simulator/Control/changeRoad.py

enesdoruk/Autonom-Vehicles-Projects

0cf4de4fe10eb0f5c886eca8fb5117b0121ae53b

[ "MIT" ]

2

2022-01-20T14:34:28.000Z

2022-02-10T22:12:37.000Z

Simulators/Microsoft Airsim Simulator/Control/changeRoad.py

enesdoruk/Autonom-Vehicles-Projects

0cf4de4fe10eb0f5c886eca8fb5117b0121ae53b

[ "MIT" ]

null

Simulators/Microsoft Airsim Simulator/Control/changeRoad.py

enesdoruk/Autonom-Vehicles-Projects

0cf4de4fe10eb0f5c886eca8fb5117b0121ae53b

[ "MIT" ]

null

import setup_path import airsim import cv2 import numpy as np import os import time import math from Sensors.Distance import distanceSensor def do_control(client, car_controls,label_sign, dist_sign, label_light, dist_light, label_x, label_y): l_distance = distanceSensor.distance_left(client) r_distance = distanceSensor.distance_right(client) front_distance = distanceSensor.distance_front(client) print("on====",front_distance) print("sol====",l_distance) print("sag====",r_distance) if front_distance < 2: print("Dur") car_controls.throttle = 0.0 car_controls.steering = 0.0 client.setCarControls(car_controls) else: if 'stop' in label_light: for i in range(len(label_light)): if label_light[i] == 'stop': if dist_light[i] < 35: print("Duz gidiyor") car_controls.throttle = 0.0 car_controls.steering = 0 client.setCarControls(car_controls) else: if front_distance > 15 and l_distance > 3 and r_distance > 3: print("Duz gidiyor") car_controls.throttle = 0.32 car_controls.steering = 0 client.setCarControls(car_controls) if 'turnRight' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnRight': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 7: car_controls.throttle = 0.25 car_controls.steering = 0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 4: car_controls.throttle = 0.25 car_controls.steering = 0.3 client.setCarControls(car_controls) if 'turnLeft' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnLeft': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 5: car_controls.throttle = 0.3 car_controls.steering = -0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 3: car_controls.throttle = 0.25 car_controls.steering = -0.35 client.setCarControls(car_controls) if front_distance > 15 and l_distance < 3 and r_distance > 3: print("hafif saga meyil") car_controls.throttle = 0.3 car_controls.steering = 0.1 client.setCarControls(car_controls) if 'turnRight' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnRight': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 7: car_controls.throttle = 0.25 car_controls.steering = 0.10 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 4: car_controls.throttle = 0.25 car_controls.steering = 0.3 client.setCarControls(car_controls) if 'turnLeft' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnLeft': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 5: car_controls.throttle = 0.3 car_controls.steering = -0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 3: car_controls.throttle = 0.25 car_controls.steering = -0.35 client.setCarControls(car_controls) if front_distance > 15 and l_distance > 3 and r_distance < 3: print("hafif sola meyil") car_controls.throttle = 0.3 car_controls.steering = -0.1 client.setCarControls(car_controls) if 'turnRight' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnRight': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 7: car_controls.throttle = 0.25 car_controls.steering = 0.10 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 4: car_controls.throttle = 0.25 car_controls.steering = 0.3 client.setCarControls(car_controls) if 'turnLeft' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnLeft': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 5: car_controls.throttle = 0.3 car_controls.steering = -0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 3: car_controls.throttle = 0.25 car_controls.steering = -0.35 client.setCarControls(car_controls) if front_distance < 20 and (l_distance > r_distance * 2.2 ): print("keskin sola meyil") car_controls.throttle = 0.3 car_controls.steering = -0.47 client.setCarControls(car_controls) if 'turnRight' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnRight': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 7: car_controls.throttle = 0.25 car_controls.steering = 0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 4: car_controls.throttle = 0.25 car_controls.steering = 0.3 client.setCarControls(car_controls) if 'turnLeft' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnLeft': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 5: car_controls.throttle = 0.3 car_controls.steering = -0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 3: car_controls.throttle = 0.25 car_controls.steering = -0.35 client.setCarControls(car_controls) if front_distance < 15 and (l_distance * 2.2 < r_distance): print("keskin saga meyil") car_controls.throttle = 0.3 car_controls.steering = 0.45 client.setCarControls(car_controls) if 'turnRight' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnRight': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 7: car_controls.throttle = 0.25 car_controls.steering = 0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 4: car_controls.throttle = 0.25 car_controls.steering = 0.3 client.setCarControls(car_controls) if 'turnLeft' in label_sign: for i in range(len(label_sign)): if label_sign[i] == 'turnLeft': if dist_sign[i] < 25: start_time = time.time() while time.time() - start_time < 5: car_controls.throttle = 0.3 car_controls.steering = -0.11 client.setCarControls(car_controls) start_time2 = time.time() while time.time() - start_time2 < 3: car_controls.throttle = 0.25 car_controls.steering = -0.35 client.setCarControls(car_controls)

51.442982

102

0.392276

976

11,729

4.510246

0.078893

0.204907

0.116538

0.122672

0.882326

0.87801

0.858246

0.846661

0.828033

0

0.041519

0.542075

11,729

228

103

51.442982

0.778067

0

0.815385

0

0.024638

0

1

0.005128

false

0

0.041026

0

0.046154

0.051282

0

null

1

0

1

0

1

0

1

0

null

0

9

e97ed56f2aa168cae85d92d1ccd077ac0e919bf8

351,941

py

Python

sympy/integrals/rubi/rules/miscellaneous_algebraic.py

STALKER2010/sympy-bleeding-edge

81233029a9a30866747f6da2c0e9604d1681d474

[ "BSD-3-Clause" ]

2

2018-12-05T02:30:43.000Z

2020-11-14T01:43:15.000Z

sympy/integrals/rubi/rules/miscellaneous_algebraic.py

STALKER2010/sympy-bleeding-edge

81233029a9a30866747f6da2c0e9604d1681d474

[ "BSD-3-Clause" ]

1

2017-10-23T06:56:43.000Z

sympy/integrals/rubi/rules/miscellaneous_algebraic.py

STALKER2010/sympy-bleeding-edge

81233029a9a30866747f6da2c0e9604d1681d474

[ "BSD-3-Clause" ]

1

2020-10-02T15:05:03.000Z

from sympy.external import import_module matchpy = import_module("matchpy") from sympy.utilities.decorator import doctest_depends_on if matchpy: from matchpy import Pattern, ReplacementRule, CustomConstraint from sympy.integrals.rubi.utility_function import (Int, Set, With, Module, Scan, MapAnd, FalseQ, ZeroQ, NegativeQ, NonzeroQ, FreeQ, NFreeQ, List, Log, PositiveQ, PositiveIntegerQ, NegativeIntegerQ, IntegerQ, IntegersQ, ComplexNumberQ, PureComplexNumberQ, RealNumericQ, PositiveOrZeroQ, NegativeOrZeroQ, FractionOrNegativeQ, NegQ, Equal, Unequal, IntPart, FracPart, RationalQ, ProductQ, SumQ, NonsumQ, Subst, First, Rest, SqrtNumberQ, SqrtNumberSumQ, LinearQ, Sqrt, ArcCosh, Coefficient, Denominator, Hypergeometric2F1, Not, Simplify, FractionalPart, IntegerPart, AppellF1, EllipticPi, EllipticE, EllipticF, ArcTan, ArcCot, ArcCoth, ArcTanh, ArcSin, ArcSinh, ArcCos, ArcCsc, ArcSec, ArcCsch, ArcSech, Sinh, Tanh, Cosh, Sech, Csch, Coth, LessEqual, Less, Greater, GreaterEqual, FractionQ, IntLinearcQ, Expand, IndependentQ, PowerQ, IntegerPowerQ, PositiveIntegerPowerQ, FractionalPowerQ, AtomQ, ExpQ, LogQ, Head, MemberQ, TrigQ, SinQ, CosQ, TanQ, CotQ, SecQ, CscQ, Sin, Cos, Tan, Cot, Sec, Csc, HyperbolicQ, SinhQ, CoshQ, TanhQ, CothQ, SechQ, CschQ, InverseTrigQ, SinCosQ, SinhCoshQ, LeafCount, Numerator, NumberQ, NumericQ, Length, ListQ, Im, Re, InverseHyperbolicQ, InverseFunctionQ, TrigHyperbolicFreeQ, InverseFunctionFreeQ, RealQ, EqQ, FractionalPowerFreeQ, ComplexFreeQ, PolynomialQ, FactorSquareFree, PowerOfLinearQ, Exponent, QuadraticQ, LinearPairQ, BinomialParts, TrinomialParts, PolyQ, EvenQ, OddQ, PerfectSquareQ, NiceSqrtAuxQ, NiceSqrtQ, Together, PosAux, PosQ, CoefficientList, ReplaceAll, ExpandLinearProduct, GCD, ContentFactor, NumericFactor, NonnumericFactors, MakeAssocList, GensymSubst, KernelSubst, ExpandExpression, Apart, SmartApart, MatchQ, PolynomialQuotientRemainder, FreeFactors, NonfreeFactors, RemoveContentAux, RemoveContent, FreeTerms, NonfreeTerms, ExpandAlgebraicFunction, CollectReciprocals, ExpandCleanup, AlgebraicFunctionQ, Coeff, LeadTerm, RemainingTerms, LeadFactor, RemainingFactors, LeadBase, LeadDegree, Numer, Denom, hypergeom, Expon, MergeMonomials, PolynomialDivide, BinomialQ, TrinomialQ, GeneralizedBinomialQ, GeneralizedTrinomialQ, FactorSquareFreeList, PerfectPowerTest, SquareFreeFactorTest, RationalFunctionQ, RationalFunctionFactors, NonrationalFunctionFactors, Reverse, RationalFunctionExponents, RationalFunctionExpand, ExpandIntegrand, SimplerQ, SimplerSqrtQ, SumSimplerQ, BinomialDegree, TrinomialDegree, CancelCommonFactors, SimplerIntegrandQ, GeneralizedBinomialDegree, GeneralizedBinomialParts, GeneralizedTrinomialDegree, GeneralizedTrinomialParts, MonomialQ, MonomialSumQ, MinimumMonomialExponent, MonomialExponent, LinearMatchQ, PowerOfLinearMatchQ, QuadraticMatchQ, CubicMatchQ, BinomialMatchQ, TrinomialMatchQ, GeneralizedBinomialMatchQ, GeneralizedTrinomialMatchQ, QuotientOfLinearsMatchQ, PolynomialTermQ, PolynomialTerms, NonpolynomialTerms, PseudoBinomialParts, NormalizePseudoBinomial, PseudoBinomialPairQ, PseudoBinomialQ, PolynomialGCD, PolyGCD, AlgebraicFunctionFactors, NonalgebraicFunctionFactors, QuotientOfLinearsP, QuotientOfLinearsParts, QuotientOfLinearsQ, Flatten, Sort, AbsurdNumberQ, AbsurdNumberFactors, NonabsurdNumberFactors, SumSimplerAuxQ, Prepend, Drop, CombineExponents, FactorInteger, FactorAbsurdNumber, SubstForInverseFunction, SubstForFractionalPower, SubstForFractionalPowerOfQuotientOfLinears, FractionalPowerOfQuotientOfLinears, SubstForFractionalPowerQ, SubstForFractionalPowerAuxQ, FractionalPowerOfSquareQ, FractionalPowerSubexpressionQ, Apply, FactorNumericGcd, MergeableFactorQ, MergeFactor, MergeFactors, TrigSimplifyQ, TrigSimplify, TrigSimplifyRecur, Order, FactorOrder, Smallest, OrderedQ, MinimumDegree, PositiveFactors, Sign, NonpositiveFactors, PolynomialInAuxQ, PolynomialInQ, ExponentInAux, ExponentIn, PolynomialInSubstAux, PolynomialInSubst, Distrib, DistributeDegree, FunctionOfPower, DivideDegreesOfFactors, MonomialFactor, FullSimplify, FunctionOfLinearSubst, FunctionOfLinear, NormalizeIntegrand, NormalizeIntegrandAux, NormalizeIntegrandFactor, NormalizeIntegrandFactorBase, NormalizeTogether, NormalizeLeadTermSigns, AbsorbMinusSign, NormalizeSumFactors, SignOfFactor, NormalizePowerOfLinear, SimplifyIntegrand, SimplifyTerm, TogetherSimplify, SmartSimplify, SubstForExpn, ExpandToSum, UnifySum, UnifyTerms, UnifyTerm, CalculusQ, FunctionOfInverseLinear, PureFunctionOfSinhQ, PureFunctionOfTanhQ, PureFunctionOfCoshQ, IntegerQuotientQ, OddQuotientQ, EvenQuotientQ, FindTrigFactor, FunctionOfSinhQ, FunctionOfCoshQ, OddHyperbolicPowerQ, FunctionOfTanhQ, FunctionOfTanhWeight, FunctionOfHyperbolicQ, SmartNumerator, SmartDenominator, SubstForAux, ActivateTrig, ExpandTrig, TrigExpand, SubstForTrig, SubstForHyperbolic, InertTrigFreeQ, LCM, SubstForFractionalPowerOfLinear, FractionalPowerOfLinear, InverseFunctionOfLinear, InertTrigQ, InertReciprocalQ, DeactivateTrig, FixInertTrigFunction, DeactivateTrigAux, PowerOfInertTrigSumQ, PiecewiseLinearQ, KnownTrigIntegrandQ, KnownSineIntegrandQ, KnownTangentIntegrandQ, KnownCotangentIntegrandQ, KnownSecantIntegrandQ, TryPureTanSubst, TryTanhSubst, TryPureTanhSubst, AbsurdNumberGCD, AbsurdNumberGCDList, ExpandTrigExpand, ExpandTrigReduce, ExpandTrigReduceAux, NormalizeTrig, TrigToExp, ExpandTrigToExp, TrigReduce, FunctionOfTrig, AlgebraicTrigFunctionQ, FunctionOfHyperbolic, FunctionOfQ, FunctionOfExpnQ, PureFunctionOfSinQ, PureFunctionOfCosQ, PureFunctionOfTanQ, PureFunctionOfCotQ, FunctionOfCosQ, FunctionOfSinQ, OddTrigPowerQ, FunctionOfTanQ, FunctionOfTanWeight, FunctionOfTrigQ, FunctionOfDensePolynomialsQ, FunctionOfLog, PowerVariableExpn, PowerVariableDegree, PowerVariableSubst, EulerIntegrandQ, FunctionOfSquareRootOfQuadratic, SquareRootOfQuadraticSubst, Divides, EasyDQ, ProductOfLinearPowersQ, Rt, NthRoot, AtomBaseQ, SumBaseQ, NegSumBaseQ, AllNegTermQ, SomeNegTermQ, TrigSquareQ, RtAux, TrigSquare, IntSum, IntTerm, Map2, ConstantFactor, SameQ, ReplacePart, CommonFactors, MostMainFactorPosition, FunctionOfExponentialQ, FunctionOfExponential, FunctionOfExponentialFunction, FunctionOfExponentialFunctionAux, FunctionOfExponentialTest, FunctionOfExponentialTestAux, stdev, rubi_test, If, IntQuadraticQ, IntBinomialQ, RectifyTangent, RectifyCotangent, Inequality, Condition, Simp, SimpHelp, SplitProduct, SplitSum, SubstFor, SubstForAux, FresnelS, FresnelC, Erfc, Erfi, Gamma, FunctionOfTrigOfLinearQ, ElementaryFunctionQ, Complex, UnsameQ, _SimpFixFactor, SimpFixFactor, _FixSimplify, FixSimplify, _SimplifyAntiderivativeSum, SimplifyAntiderivativeSum, _SimplifyAntiderivative, SimplifyAntiderivative, _TrigSimplifyAux, TrigSimplifyAux, Cancel, Part, PolyLog, D, Dist) from sympy import Integral, S, sqrt from sympy.integrals.rubi.symbol import WC from sympy.core.symbol import symbols, Symbol from sympy.functions import (log, sin, cos, tan, cot, csc, sec, sqrt, erf, exp, log) from sympy.functions.elementary.hyperbolic import (acosh, asinh, atanh, acoth, acsch, asech, cosh, sinh, tanh, coth, sech, csch) from sympy.functions.elementary.trigonometric import (atan, acsc, asin, acot, acos, asec) A_, B_, C_, F_, G_, H_, a_, b_, c_, d_, e_, f_, g_, h_, i_, j_, k_, l_, m_, n_, p_, q_, r_, t_, u_, v_, s_, w_, x_, y_, z_ = [WC(i) for i in 'ABCFGHabcdefghijklmnpqrtuvswxyz'] a1_, a2_, b1_, b2_, c1_, c2_, d1_, d2_, n1_, n2_, e1_, e2_, f1_, f2_, g1_, g2_, n1_, n2_, n3_, Pq_, Pm_, Px_, Qm_, Qr_, Qx_, jn_, mn_, non2_, RFx_, RGx_ = [WC(i) for i in ['a1', 'a2', 'b1', 'b2', 'c1', 'c2', 'd1', 'd2', 'n1', 'n2', 'e1', 'e2', 'f1', 'f2', 'g1', 'g2', 'n1', 'n2', 'n3', 'Pq', 'Pm', 'Px', 'Qm', 'Qr', 'Qx', 'jn', 'mn', 'non2', 'RFx', 'RGx']] _UseGamma = False def miscellaneous_algebraic(rubi): pattern1 = Pattern(Integral(((x_**n_*WC('c', S(1)))**q_*WC('b', S(1)) + WC('a', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, q: IntegerQ(n*q))) rule1 = ReplacementRule(pattern1, lambda p, n, a, q, x, b, c : x*(c*x**n)**(-S(1)/n)*Subst(Int((a + b*x**(n*q))**p, x), x, (c*x**n)**(1/n))) rubi.add(rule1) pattern2 = Pattern(Integral(x_**WC('m', S(1))*((x_**n_*WC('c', S(1)))**q_*WC('b', S(1)) + WC('a', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda n, q: IntegerQ(n*q)), CustomConstraint(lambda m: IntegerQ(m))) rule2 = ReplacementRule(pattern2, lambda p, n, a, q, x, m, b, c : x**(m + S(1))*(c*x**n)**(-(m + S(1))/n)*Subst(Int(x**m*(a + b*x**(n*q))**p, x), x, (c*x**n)**(1/n))) rubi.add(rule2) pattern3 = Pattern(Integral(x_**WC('m', S(1))*((a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('r', S(1))*WC('e', S(1)))**p_*((c_ + x_**WC('n', S(1))*WC('d', S(1)))**s_*WC('f', S(1)))**q_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda r, x: FreeQ(r, x)), CustomConstraint(lambda s, x: FreeQ(s, x))) rule3 = ReplacementRule(pattern3, lambda r, p, n, a, s, q, f, x, m, b, d, e, c : (e*(a + b*x**n)**r)**p*(f*(c + d*x**n)**s)**q*(a + b*x**n)**(-p*r)*(c + d*x**n)**(-q*s)*Int(x**m*(a + b*x**n)**(p*r)*(c + d*x**n)**(q*s), x)) rubi.add(rule3) pattern4 = Pattern(Integral(((x_**WC('n', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1))/(c_ + x_**WC('n', S(1))*WC('d', S(1))))**p_*WC('u', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda b, a, d, c: ZeroQ(-a*d + b*c))) rule4 = ReplacementRule(pattern4, lambda p, n, a, x, u, b, d, e, c : (b*e/d)**p*Int(u, x)) rubi.add(rule4) pattern5 = Pattern(Integral(((x_**WC('n', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1))/(c_ + x_**WC('n', S(1))*WC('d', S(1))))**p_*WC('u', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda b, e, d: PositiveQ(b*d*e)), CustomConstraint(lambda b, a, d, c: PositiveQ(-a*d/b + c))) rule5 = ReplacementRule(pattern5, lambda p, n, a, x, u, b, d, e, c : Int(u*(e*(a + b*x**n))**p*(c + d*x**n)**(-p), x)) rubi.add(rule5) pattern6 = Pattern(Integral(((x_**WC('n', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1))/(c_ + x_**WC('n', S(1))*WC('d', S(1))))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda p: FractionQ(p)), CustomConstraint(lambda n: IntegerQ(1/n)), ) def With6(e, p, n, a, x, b, d, c): q = Denominator(p) return e*q*(-a*d + b*c)*Subst(Int(x**(q*(p + S(1)) + S(-1))*(-a*e + c*x**q)**(S(-1) + 1/n)*(b*e - d*x**q)**(S(-1) - S(1)/n), x), x, (e*(a + b*x**n)/(c + d*x**n))**(1/q))/n rule6 = ReplacementRule(pattern6, lambda e, p, n, a, x, b, d, c : With6(e, p, n, a, x, b, d, c)) rubi.add(rule6) pattern7 = Pattern(Integral(x_**WC('m', S(1))*((x_**WC('n', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1))/(c_ + x_**WC('n', S(1))*WC('d', S(1))))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p: FractionQ(p)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n)), ) def With7(p, n, a, x, m, b, d, e, c): q = Denominator(p) return e*q*(-a*d + b*c)*Subst(Int(x**(q*(p + S(1)) + S(-1))*(-a*e + c*x**q)**(S(-1) + (m + S(1))/n)*(b*e - d*x**q)**(S(-1) - (m + S(1))/n), x), x, (e*(a + b*x**n)/(c + d*x**n))**(1/q))/n rule7 = ReplacementRule(pattern7, lambda p, n, a, x, m, b, d, e, c : With7(p, n, a, x, m, b, d, e, c)) rubi.add(rule7) pattern8 = Pattern(Integral(u_**WC('r', S(1))*((x_**WC('n', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1))/(c_ + x_**WC('n', S(1))*WC('d', S(1))))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda x, u: PolynomialQ(u, x)), CustomConstraint(lambda p: FractionQ(p)), CustomConstraint(lambda n: IntegerQ(1/n)), CustomConstraint(lambda r: IntegerQ(r)), ) def With8(r, p, n, a, x, u, b, d, e, c): q = Denominator(p) return e*q*(-a*d + b*c)*Subst(Int(SimplifyIntegrand(x**(q*(p + S(1)) + S(-1))*(-a*e + c*x**q)**(S(-1) + 1/n)*(b*e - d*x**q)**(S(-1) - S(1)/n)*ReplaceAll(u, Rule(x, (-a*e + c*x**q)**(1/n)*(b*e - d*x**q)**(-S(1)/n)))**r, x), x), x, (e*(a + b*x**n)/(c + d*x**n))**(1/q))/n rule8 = ReplacementRule(pattern8, lambda r, p, n, a, x, u, b, d, e, c : With8(r, p, n, a, x, u, b, d, e, c)) rubi.add(rule8) pattern9 = Pattern(Integral(u_**WC('r', S(1))*x_**WC('m', S(1))*((x_**WC('n', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1))/(c_ + x_**WC('n', S(1))*WC('d', S(1))))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda x, u: PolynomialQ(u, x)), CustomConstraint(lambda p: FractionQ(p)), CustomConstraint(lambda n: IntegerQ(1/n)), CustomConstraint(lambda r, m: IntegersQ(m, r)), ) def With9(r, p, n, a, x, u, m, b, d, e, c): q = Denominator(p) return e*q*(-a*d + b*c)*Subst(Int(SimplifyIntegrand(x**(q*(p + S(1)) + S(-1))*(-a*e + c*x**q)**(S(-1) + (m + S(1))/n)*(b*e - d*x**q)**(S(-1) - (m + S(1))/n)*ReplaceAll(u, Rule(x, (-a*e + c*x**q)**(1/n)*(b*e - d*x**q)**(-S(1)/n)))**r, x), x), x, (e*(a + b*x**n)/(c + d*x**n))**(1/q))/n rule9 = ReplacementRule(pattern9, lambda r, p, n, a, x, u, m, b, d, e, c : With9(r, p, n, a, x, u, m, b, d, e, c)) rubi.add(rule9) pattern10 = Pattern(Integral(((WC('c', S(1))/x_)**n_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x))) rule10 = ReplacementRule(pattern10, lambda p, n, a, x, b, c : -c*Subst(Int((a + b*x**n)**p/x**S(2), x), x, c/x)) rubi.add(rule10) pattern11 = Pattern(Integral(x_**WC('m', S(1))*((WC('c', S(1))/x_)**n_*WC('b', S(1)) + WC('a', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda m: IntegerQ(m))) rule11 = ReplacementRule(pattern11, lambda p, n, a, x, m, b, c : -c**(m + S(1))*Subst(Int(x**(-m + S(-2))*(a + b*x**n)**p, x), x, c/x)) rubi.add(rule11) pattern12 = Pattern(Integral((x_*WC('d', S(1)))**m_*((WC('c', S(1))/x_)**n_*WC('b', S(1)) + WC('a', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda m: Not(IntegerQ(m)))) rule12 = ReplacementRule(pattern12, lambda p, n, a, x, m, b, d, c : -c*(c/x)**m*(d*x)**m*Subst(Int(x**(-m + S(-2))*(a + b*x**n)**p, x), x, c/x)) rubi.add(rule12) pattern13 = Pattern(Integral(((WC('d', S(1))/x_)**n_*WC('b', S(1)) + (WC('d', S(1))/x_)**WC('n2', S(1))*WC('c', S(1)) + WC('a', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2))) rule13 = ReplacementRule(pattern13, lambda n2, p, n, a, x, b, d, c : -d*Subst(Int((a + b*x**n + c*x**(S(2)*n))**p/x**S(2), x), x, d/x)) rubi.add(rule13) pattern14 = Pattern(Integral(x_**WC('m', S(1))*(a_ + (WC('d', S(1))/x_)**n_*WC('b', S(1)) + (WC('d', S(1))/x_)**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda m: IntegerQ(m))) rule14 = ReplacementRule(pattern14, lambda n2, p, n, a, x, m, b, d, c : -d**(m + S(1))*Subst(Int(x**(-m + S(-2))*(a + b*x**n + c*x**(S(2)*n))**p, x), x, d/x)) rubi.add(rule14) pattern15 = Pattern(Integral((x_*WC('e', S(1)))**m_*(a_ + (WC('d', S(1))/x_)**n_*WC('b', S(1)) + (WC('d', S(1))/x_)**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda m: Not(IntegerQ(m)))) rule15 = ReplacementRule(pattern15, lambda n2, e, p, n, a, x, m, b, d, c : -d*(d/x)**m*(e*x)**m*Subst(Int(x**(-m + S(-2))*(a + b*x**n + c*x**(S(2)*n))**p, x), x, d/x)) rubi.add(rule15) pattern16 = Pattern(Integral((x_**WC('n2', S(1))*WC('c', S(1)) + (WC('d', S(1))/x_)**n_*WC('b', S(1)) + WC('a', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(S(2)*n + n2)), CustomConstraint(lambda n: IntegerQ(S(2)*n))) rule16 = ReplacementRule(pattern16, lambda n2, p, n, a, x, b, d, c : -d*Subst(Int((a + b*x**n + c*d**(-S(2)*n)*x**(S(2)*n))**p/x**S(2), x), x, d/x)) rubi.add(rule16) pattern17 = Pattern(Integral(x_**WC('m', S(1))*(a_ + x_**WC('n2', S(1))*WC('c', S(1)) + (WC('d', S(1))/x_)**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(S(2)*n + n2)), CustomConstraint(lambda n: IntegerQ(S(2)*n)), CustomConstraint(lambda m: IntegerQ(m))) rule17 = ReplacementRule(pattern17, lambda n2, p, n, a, x, m, b, d, c : -d**(m + S(1))*Subst(Int(x**(-m + S(-2))*(a + b*x**n + c*d**(-S(2)*n)*x**(S(2)*n))**p, x), x, d/x)) rubi.add(rule17) pattern18 = Pattern(Integral((x_*WC('e', S(1)))**m_*(a_ + x_**WC('n2', S(1))*WC('c', S(1)) + (WC('d', S(1))/x_)**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(S(2)*n + n2)), CustomConstraint(lambda m: Not(IntegerQ(m))), CustomConstraint(lambda n: IntegerQ(S(2)*n))) rule18 = ReplacementRule(pattern18, lambda n2, e, p, n, a, x, m, b, d, c : -d*(d/x)**m*(e*x)**m*Subst(Int(x**(-m + S(-2))*(a + b*x**n + c*d**(-S(2)*n)*x**(S(2)*n))**p, x), x, d/x)) rubi.add(rule18) pattern19 = Pattern(Integral(u_**m_, x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda x, u: LinearQ(u, x)), CustomConstraint(lambda x, u: Not(LinearMatchQ(u, x)))) rule19 = ReplacementRule(pattern19, lambda x, u, m : Int(ExpandToSum(u, x)**m, x)) rubi.add(rule19) pattern20 = Pattern(Integral(u_**WC('m', S(1))*v_**WC('n', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda v, x, u: LinearQ(List(u, v), x)), CustomConstraint(lambda v, x, u: Not(LinearMatchQ(List(u, v), x)))) rule20 = ReplacementRule(pattern20, lambda n, v, x, u, m : Int(ExpandToSum(u, x)**m*ExpandToSum(v, x)**n, x)) rubi.add(rule20) pattern21 = Pattern(Integral(u_**WC('m', S(1))*v_**WC('n', S(1))*w_**WC('p', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda w, v, x, u: LinearQ(List(u, v, w), x)), CustomConstraint(lambda w, v, x, u: Not(LinearMatchQ(List(u, v, w), x)))) rule21 = ReplacementRule(pattern21, lambda p, n, w, v, x, u, m : Int(ExpandToSum(u, x)**m*ExpandToSum(v, x)**n*ExpandToSum(w, x)**p, x)) rubi.add(rule21) pattern22 = Pattern(Integral(u_**WC('m', S(1))*v_**WC('n', S(1))*w_**WC('p', S(1))*z_**WC('q', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda w, v, x, u, z: LinearQ(List(u, v, w, z), x)), CustomConstraint(lambda w, v, x, u, z: Not(LinearMatchQ(List(u, v, w, z), x)))) rule22 = ReplacementRule(pattern22, lambda p, n, q, w, v, x, u, m, z : Int(ExpandToSum(u, x)**m*ExpandToSum(v, x)**n*ExpandToSum(w, x)**p*ExpandToSum(z, x)**q, x)) rubi.add(rule22) pattern23 = Pattern(Integral(u_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: QuadraticQ(u, x)), CustomConstraint(lambda x, u: Not(QuadraticMatchQ(u, x)))) rule23 = ReplacementRule(pattern23, lambda p, x, u : Int(ExpandToSum(u, x)**p, x)) rubi.add(rule23) pattern24 = Pattern(Integral(u_**WC('m', S(1))*v_**WC('p', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: LinearQ(u, x)), CustomConstraint(lambda v, x: QuadraticQ(v, x)), CustomConstraint(lambda v, x, u: Not(LinearMatchQ(u, x) & QuadraticMatchQ(v, x)))) rule24 = ReplacementRule(pattern24, lambda p, v, x, u, m : Int(ExpandToSum(u, x)**m*ExpandToSum(v, x)**p, x)) rubi.add(rule24) pattern25 = Pattern(Integral(u_**WC('m', S(1))*v_**WC('n', S(1))*w_**WC('p', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda v, x, u: LinearQ(List(u, v), x)), CustomConstraint(lambda w, x: QuadraticQ(w, x)), CustomConstraint(lambda w, v, x, u: Not(QuadraticMatchQ(w, x) & LinearMatchQ(List(u, v), x)))) rule25 = ReplacementRule(pattern25, lambda p, n, w, v, x, u, m : Int(ExpandToSum(u, x)**m*ExpandToSum(v, x)**n*ExpandToSum(w, x)**p, x)) rubi.add(rule25) pattern26 = Pattern(Integral(u_**WC('p', S(1))*v_**WC('q', S(1)), x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda v, x, u: QuadraticQ(List(u, v), x)), CustomConstraint(lambda v, x, u: Not(QuadraticMatchQ(List(u, v), x)))) rule26 = ReplacementRule(pattern26, lambda p, q, v, x, u : Int(ExpandToSum(u, x)**p*ExpandToSum(v, x)**q, x)) rubi.add(rule26) pattern27 = Pattern(Integral(u_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: BinomialQ(u, x)), CustomConstraint(lambda x, u: Not(BinomialMatchQ(u, x)))) rule27 = ReplacementRule(pattern27, lambda p, x, u : Int(ExpandToSum(u, x)**p, x)) rubi.add(rule27) pattern28 = Pattern(Integral(u_**WC('p', S(1))*(x_*WC('c', S(1)))**WC('m', S(1)), x_), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: BinomialQ(u, x)), CustomConstraint(lambda x, u: Not(BinomialMatchQ(u, x)))) rule28 = ReplacementRule(pattern28, lambda p, x, u, m, c : Int((c*x)**m*ExpandToSum(u, x)**p, x)) rubi.add(rule28) pattern29 = Pattern(Integral(u_**WC('p', S(1))*v_**WC('q', S(1)), x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda v, x, u: BinomialQ(List(u, v), x)), CustomConstraint(lambda v, x, u: ZeroQ(BinomialDegree(u, x) - BinomialDegree(v, x))), CustomConstraint(lambda v, x, u: Not(BinomialMatchQ(List(u, v), x)))) rule29 = ReplacementRule(pattern29, lambda p, q, v, x, u : Int(ExpandToSum(u, x)**p*ExpandToSum(v, x)**q, x)) rubi.add(rule29) pattern30 = Pattern(Integral(u_**WC('p', S(1))*v_**WC('q', S(1))*x_**WC('m', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda v, x, u: BinomialQ(List(u, v), x)), CustomConstraint(lambda v, x, u: ZeroQ(BinomialDegree(u, x) - BinomialDegree(v, x))), CustomConstraint(lambda v, x, u: Not(BinomialMatchQ(List(u, v), x)))) rule30 = ReplacementRule(pattern30, lambda p, q, v, x, u, m : Int(x**m*ExpandToSum(u, x)**p*ExpandToSum(v, x)**q, x)) rubi.add(rule30) pattern31 = Pattern(Integral(u_**WC('m', S(1))*v_**WC('p', S(1))*w_**WC('q', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda w, v, x, u: BinomialQ(List(u, v, w), x)), CustomConstraint(lambda v, x, u: ZeroQ(BinomialDegree(u, x) - BinomialDegree(v, x))), CustomConstraint(lambda w, x, u: ZeroQ(BinomialDegree(u, x) - BinomialDegree(w, x))), CustomConstraint(lambda w, v, x, u: Not(BinomialMatchQ(List(u, v, w), x)))) rule31 = ReplacementRule(pattern31, lambda p, q, w, v, x, u, m : Int(ExpandToSum(u, x)**m*ExpandToSum(v, x)**p*ExpandToSum(w, x)**q, x)) rubi.add(rule31) pattern32 = Pattern(Integral(u_**WC('p', S(1))*v_**WC('q', S(1))*x_**WC('m', S(1))*z_**WC('r', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda r, x: FreeQ(r, x)), CustomConstraint(lambda z, v, x, u: BinomialQ(List(u, v, z), x)), CustomConstraint(lambda v, x, u: ZeroQ(BinomialDegree(u, x) - BinomialDegree(v, x))), CustomConstraint(lambda z, x, u: ZeroQ(BinomialDegree(u, x) - BinomialDegree(z, x))), CustomConstraint(lambda z, v, x, u: Not(BinomialMatchQ(List(u, v, z), x)))) rule32 = ReplacementRule(pattern32, lambda r, p, q, v, x, u, m, z : Int(x**m*ExpandToSum(u, x)**p*ExpandToSum(v, x)**q*ExpandToSum(z, x)**r, x)) rubi.add(rule32) pattern33 = Pattern(Integral(u_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: GeneralizedBinomialQ(u, x)), CustomConstraint(lambda x, u: Not(GeneralizedBinomialMatchQ(u, x)))) rule33 = ReplacementRule(pattern33, lambda p, x, u : Int(ExpandToSum(u, x)**p, x)) rubi.add(rule33) pattern34 = Pattern(Integral(u_**WC('p', S(1))*x_**WC('m', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: GeneralizedBinomialQ(u, x)), CustomConstraint(lambda x, u: Not(GeneralizedBinomialMatchQ(u, x)))) rule34 = ReplacementRule(pattern34, lambda p, x, u, m : Int(x**m*ExpandToSum(u, x)**p, x)) rubi.add(rule34) pattern35 = Pattern(Integral(u_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: TrinomialQ(u, x)), CustomConstraint(lambda x, u: Not(TrinomialMatchQ(u, x)))) rule35 = ReplacementRule(pattern35, lambda p, x, u : Int(ExpandToSum(u, x)**p, x)) rubi.add(rule35) pattern36 = Pattern(Integral(u_**WC('p', S(1))*(x_*WC('d', S(1)))**WC('m', S(1)), x_), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: TrinomialQ(u, x)), CustomConstraint(lambda x, u: Not(TrinomialMatchQ(u, x)))) rule36 = ReplacementRule(pattern36, lambda p, x, u, m, d : Int((d*x)**m*ExpandToSum(u, x)**p, x)) rubi.add(rule36) pattern37 = Pattern(Integral(u_**WC('q', S(1))*v_**WC('p', S(1)), x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda x, u: BinomialQ(u, x)), CustomConstraint(lambda v, x: TrinomialQ(v, x)), CustomConstraint(lambda v, x, u: Not(BinomialMatchQ(u, x) & TrinomialMatchQ(v, x)))) rule37 = ReplacementRule(pattern37, lambda p, q, v, x, u : Int(ExpandToSum(u, x)**q*ExpandToSum(v, x)**p, x)) rubi.add(rule37) pattern38 = Pattern(Integral(u_**WC('q', S(1))*v_**WC('p', S(1)), x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda x, u: BinomialQ(u, x)), CustomConstraint(lambda v, x: BinomialQ(v, x)), CustomConstraint(lambda v, x, u: Not(BinomialMatchQ(u, x) & BinomialMatchQ(v, x)))) rule38 = ReplacementRule(pattern38, lambda p, q, v, x, u : Int(ExpandToSum(u, x)**q*ExpandToSum(v, x)**p, x)) rubi.add(rule38) pattern39 = Pattern(Integral(u_**WC('p', S(1))*x_**WC('m', S(1))*z_**WC('q', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda z, x: BinomialQ(z, x)), CustomConstraint(lambda x, u: TrinomialQ(u, x)), CustomConstraint(lambda z, x, u: Not(BinomialMatchQ(z, x) & TrinomialMatchQ(u, x)))) rule39 = ReplacementRule(pattern39, lambda p, q, x, u, m, z : Int(x**m*ExpandToSum(u, x)**p*ExpandToSum(z, x)**q, x)) rubi.add(rule39) pattern40 = Pattern(Integral(u_**WC('p', S(1))*x_**WC('m', S(1))*z_**WC('q', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda z, x: BinomialQ(z, x)), CustomConstraint(lambda x, u: BinomialQ(u, x)), CustomConstraint(lambda z, x, u: Not(BinomialMatchQ(u, x) & BinomialMatchQ(z, x)))) rule40 = ReplacementRule(pattern40, lambda p, q, x, u, m, z : Int(x**m*ExpandToSum(u, x)**p*ExpandToSum(z, x)**q, x)) rubi.add(rule40) pattern41 = Pattern(Integral(u_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: GeneralizedTrinomialQ(u, x)), CustomConstraint(lambda x, u: Not(GeneralizedTrinomialMatchQ(u, x)))) rule41 = ReplacementRule(pattern41, lambda p, x, u : Int(ExpandToSum(u, x)**p, x)) rubi.add(rule41) pattern42 = Pattern(Integral(u_**WC('p', S(1))*x_**WC('m', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: GeneralizedTrinomialQ(u, x)), CustomConstraint(lambda x, u: Not(GeneralizedTrinomialMatchQ(u, x)))) rule42 = ReplacementRule(pattern42, lambda p, x, u, m : Int(x**m*ExpandToSum(u, x)**p, x)) rubi.add(rule42) pattern43 = Pattern(Integral(u_**WC('p', S(1))*z_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda z, x: BinomialQ(z, x)), CustomConstraint(lambda x, u: GeneralizedTrinomialQ(u, x)), CustomConstraint(lambda z, x, u: ZeroQ(BinomialDegree(z, x) - GeneralizedTrinomialDegree(u, x))), CustomConstraint(lambda z, x, u: Not(BinomialMatchQ(z, x) & GeneralizedTrinomialMatchQ(u, x)))) rule43 = ReplacementRule(pattern43, lambda z, p, x, u : Int(ExpandToSum(u, x)**p*ExpandToSum(z, x), x)) rubi.add(rule43) pattern44 = Pattern(Integral(u_**WC('p', S(1))*x_**WC('m', S(1))*z_, x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda z, x: BinomialQ(z, x)), CustomConstraint(lambda x, u: GeneralizedTrinomialQ(u, x)), CustomConstraint(lambda z, x, u: ZeroQ(BinomialDegree(z, x) - GeneralizedTrinomialDegree(u, x))), CustomConstraint(lambda z, x, u: Not(BinomialMatchQ(z, x) & GeneralizedTrinomialMatchQ(u, x)))) rule44 = ReplacementRule(pattern44, lambda p, x, u, m, z : Int(x**m*ExpandToSum(u, x)**p*ExpandToSum(z, x), x)) rubi.add(rule44) pattern45 = Pattern(Integral(x_**WC('m', S(1))*(e_ + x_**WC('n', S(1))*WC('h', S(1)) + x_**WC('q', S(1))*WC('f', S(1)) + x_**WC('r', S(1))*WC('g', S(1)))/(a_ + x_**WC('n', S(1))*WC('c', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n, q: ZeroQ(-n/S(4) + q)), CustomConstraint(lambda n, r: ZeroQ(-S(3)*n/S(4) + r)), CustomConstraint(lambda n, m: ZeroQ(S(4)*m - n + S(4))), CustomConstraint(lambda h, a, e, c: ZeroQ(a*h + c*e))) rule45 = ReplacementRule(pattern45, lambda r, n, a, q, g, f, x, m, h, e, c : (-S(2)*a*g - S(4)*a*h*x**(n/S(4)) + S(2)*c*f*x**(n/S(2)))/(a*c*n*sqrt(a + c*x**n))) rubi.add(rule45) pattern46 = Pattern(Integral((d_*x_)**WC('m', S(1))*(e_ + x_**WC('n', S(1))*WC('h', S(1)) + x_**WC('q', S(1))*WC('f', S(1)) + x_**WC('r', S(1))*WC('g', S(1)))/(a_ + x_**WC('n', S(1))*WC('c', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n, m: ZeroQ(S(4)*m - n + S(4))), CustomConstraint(lambda n, q: ZeroQ(-n/S(4) + q)), CustomConstraint(lambda n, r: ZeroQ(-S(3)*n/S(4) + r)), CustomConstraint(lambda h, a, e, c: ZeroQ(a*h + c*e))) rule46 = ReplacementRule(pattern46, lambda r, e, n, a, q, g, f, x, m, h, d, c : x**(-m)*(d*x)**m*Int(x**m*(e + f*x**(n/S(4)) + g*x**(S(3)*n/S(4)) + h*x**n)/(a + c*x**n)**(S(3)/2), x)) rubi.add(rule46) pattern47 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**m_*(a_ + x_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda p: FractionQ(p)), CustomConstraint(lambda m: NegativeIntegerQ(m + S(1))), ) def With47(p, Pq, a, x, m, b, c): n = Denominator(p) return n*Subst(Int(x**(n*p + n + S(-1))*(-a*c/b + c*x**n/b)**m*ReplaceAll(Pq, Rule(x, -a/b + x**n/b)), x), x, (a + b*x)**(1/n))/b rule47 = ReplacementRule(pattern47, lambda p, Pq, a, x, m, b, c : With47(p, Pq, a, x, m, b, c)) rubi.add(rule47) pattern48 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda m: NonzeroQ(m + S(1))), CustomConstraint(lambda n, m: PositiveIntegerQ(n/(m + S(1)))), CustomConstraint(lambda Pq, x, m: PolyQ(Pq, x**(m + S(1))))) rule48 = ReplacementRule(pattern48, lambda p, n, Pq, a, x, m, b : Subst(Int((a + b*x**(n/(m + S(1))))**p*SubstFor(x**(m + S(1)), Pq, x), x), x, x**(m + S(1)))/(m + S(1))) rubi.add(rule48) pattern49 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n, p: PositiveIntegerQ(n, p)), CustomConstraint(lambda n, Pq, x: NonzeroQ(Coeff(Pq, x, n + S(-1))))) rule49 = ReplacementRule(pattern49, lambda p, n, Pq, a, x, b : Int((a + b*x**n)**p*ExpandToSum(Pq - x**(n + S(-1))*Coeff(Pq, x, n + S(-1)), x), x) + (a + b*x**n)**(p + S(1))*Coeff(Pq, x, n + S(-1))/(b*n*(p + S(1)))) rubi.add(rule49) pattern50 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n, p: PositiveIntegerQ(p) | ZeroQ(n + S(-1)))) rule50 = ReplacementRule(pattern50, lambda p, n, Pq, a, x, m, b, c : Int(ExpandIntegrand(Pq*(c*x)**m*(a + b*x**n)**p, x), x)) rubi.add(rule50) pattern51 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n, p: PositiveIntegerQ(p) | ZeroQ(n + S(-1)))) rule51 = ReplacementRule(pattern51, lambda p, n, Pq, a, x, b : Int(ExpandIntegrand(Pq*(a + b*x**n)**p, x), x)) rubi.add(rule51) pattern52 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n))) rule52 = ReplacementRule(pattern52, lambda p, n, Pq, a, x, m, b : Subst(Int(x**(S(-1) + (m + S(1))/n)*(a + b*x)**p*SubstFor(x**n, Pq, x), x), x, x**n)/n) rubi.add(rule52) pattern53 = Pattern(Integral(Pq_*(c_*x_)**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n))) rule53 = ReplacementRule(pattern53, lambda p, n, Pq, a, x, m, b, c : c**IntPart(m)*x**(-FracPart(m))*(c*x)**FracPart(m)*Int(Pq*x**m*(a + b*x**n)**p, x)) rubi.add(rule53) pattern54 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n, m: ZeroQ(m - n + S(1))), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1)))) rule54 = ReplacementRule(pattern54, lambda p, n, Pq, a, x, m, b : Pq*(a + b*x**n)**(p + S(1))/(b*n*(p + S(1))) - Int((a + b*x**n)**(p + S(1))*D(Pq, x), x)/(b*n*(p + S(1)))) rubi.add(rule54) pattern55 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda Pq, x: ZeroQ(Coeff(Pq, x, S(0))))) rule55 = ReplacementRule(pattern55, lambda p, n, Pq, a, x, m, b, d : Int((d*x)**(m + S(1))*(a + b*x**n)**p*ExpandToSum(Pq/x, x), x)/d) rubi.add(rule55) pattern56 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda Pq, x: ZeroQ(Coeff(Pq, x, S(0)))), CustomConstraint(lambda Pq: SumQ(Pq))) rule56 = ReplacementRule(pattern56, lambda p, n, Pq, a, x, b : Int(x*(a + b*x**n)**p*ExpandToSum(Pq/x, x), x)) rubi.add(rule56) pattern57 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p, m: RationalQ(m, p)), CustomConstraint(lambda p: Greater(p, S(0))), CustomConstraint(lambda Pq, x, m: Less(m + Expon(Pq, x) + S(1), S(0))), ) def With57(p, n, Pq, a, x, m, b): u = IntHide(Pq*x**m, x) return -b*n*p*Int(x**(m + n)*(a + b*x**n)**(p + S(-1))*ExpandToSum(u*x**(-m + S(-1)), x), x) + u*(a + b*x**n)**p rule57 = ReplacementRule(pattern57, lambda p, n, Pq, a, x, m, b : With57(p, n, Pq, a, x, m, b)) rubi.add(rule57) pattern58 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n/S(2) + S(-1)/2)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Greater(p, S(0))), ) def With58(p, n, Pq, a, x, m, b, c): q = Expon(Pq, x) i = Symbol('i') return a*n*p*Int((c*x)**m*(a + b*x**n)**(p + S(-1))*Sum(x**i*Coeff(Pq, x, i)/(i + m + n*p + S(1)), List(i, S(0), q)), x) + (c*x)**m*(a + b*x**n)**p*Sum(x**(i + S(1))*Coeff(Pq, x, i)/(i + m + n*p + S(1)), List(i, S(0), q)) rule58 = ReplacementRule(pattern58, lambda p, n, Pq, a, x, m, b, c : With58(p, n, Pq, a, x, m, b, c)) rubi.add(rule58) pattern59 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n/S(2) + S(-1)/2)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Greater(p, S(0))), ) def With59(p, n, Pq, a, x, b): q = Expon(Pq, x) i = Symbol('i') return a*n*p*Int((a + b*x**n)**(p + S(-1))*Sum(x**i*Coeff(Pq, x, i)/(i + n*p + S(1)), List(i, S(0), q)), x) + (a + b*x**n)**p*Sum(x**(i + S(1))*Coeff(Pq, x, i)/(i + n*p + S(1)), List(i, S(0), q)) rule59 = ReplacementRule(pattern59, lambda p, n, Pq, a, x, b : With59(p, n, Pq, a, x, b)) rubi.add(rule59) pattern60 = Pattern(Integral(Pq_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda b, n, Pq, a, i, x, p, q: Equal(q, n + S(-1)))) def With60(p, n, Pq, a, x, b): q = Expon(Pq, x) i = Symbol('i') return Int((a + b*x**n)**(p + S(1))*Sum(x**i*(i + n*(p + S(1)) + S(1))*Coeff(Pq, x, i), List(i, S(0), q + S(-1))), x)/(a*n*(p + S(1))) + (a + b*x**n)**(p + S(1))*(a*Coeff(Pq, x, q) - b*x*ExpandToSum(Pq - x**q*Coeff(Pq, x, q), x))/(a*b*n*(p + S(1))) rule60 = ReplacementRule(pattern60, lambda p, n, Pq, a, x, b : With60(p, n, Pq, a, x, b)) rubi.add(rule60) pattern61 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda n, Pq, x: Less(Expon(Pq, x), n + S(-1)))) rule61 = ReplacementRule(pattern61, lambda p, n, Pq, a, x, b : -Pq*x*(a + b*x**n)**(p + S(1))/(a*n*(p + S(1))) + Int((a + b*x**n)**(p + S(1))*ExpandToSum(Pq*n*(p + S(1)) + D(Pq*x, x), x), x)/(a*n*(p + S(1)))) rubi.add(rule61) pattern62 = Pattern(Integral((d_ + x_**S(4)*WC('g', S(1)) + x_**S(3)*WC('f', S(1)) + x_*WC('e', S(1)))/(a_ + x_**S(4)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, a, d, g: ZeroQ(a*g + b*d))) rule62 = ReplacementRule(pattern62, lambda a, f, x, b, d, e, g : (-S(2)*a*f - S(4)*a*g*x + S(2)*b*e*x**S(2))/(S(4)*a*b*sqrt(a + b*x**S(4)))) rubi.add(rule62) pattern63 = Pattern(Integral((d_ + x_**S(4)*WC('g', S(1)) + x_**S(3)*WC('f', S(1)))/(a_ + x_**S(4)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, a, d, g: ZeroQ(a*g + b*d))) rule63 = ReplacementRule(pattern63, lambda a, f, x, b, d, g : (-f - S(2)*g*x)/(S(2)*b*sqrt(a + b*x**S(4)))) rubi.add(rule63) pattern64 = Pattern(Integral((d_ + x_**S(4)*WC('g', S(1)) + x_*WC('e', S(1)))/(a_ + x_**S(4)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, a, d, g: ZeroQ(a*g + b*d))) rule64 = ReplacementRule(pattern64, lambda a, x, b, d, e, g : -x*(S(2)*a*g - b*e*x)/(S(2)*a*b*sqrt(a + b*x**S(4)))) rubi.add(rule64) pattern65 = Pattern(Integral(x_**S(2)*(x_**S(4)*WC('h', S(1)) + x_*WC('f', S(1)) + WC('e', S(0)))/(a_ + x_**S(4)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, h, a, e: ZeroQ(-S(3)*a*h + b*e))) rule65 = ReplacementRule(pattern65, lambda a, f, x, b, h, e : (-f + S(2)*h*x**S(3))/(S(2)*b*sqrt(a + b*x**S(4)))) rubi.add(rule65) pattern66 = Pattern(Integral(x_**S(2)*(x_**S(4)*WC('h', S(1)) + WC('e', S(0)))/(a_ + x_**S(4)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, h, a, e: ZeroQ(-S(3)*a*h + b*e))) rule66 = ReplacementRule(pattern66, lambda a, x, b, h, e : h*x**S(3)/(b*sqrt(a + b*x**S(4)))) rubi.add(rule66) pattern67 = Pattern(Integral((d_ + x_**S(6)*WC('h', S(1)) + x_**S(4)*WC('g', S(1)) + x_**S(3)*WC('f', S(1)) + x_**S(2)*WC('e', S(1)))/(a_ + x_**S(4)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, h, a, e: ZeroQ(-S(3)*a*h + b*e)), CustomConstraint(lambda b, a, d, g: ZeroQ(a*g + b*d))) rule67 = ReplacementRule(pattern67, lambda a, f, x, b, d, h, e, g : (-a*f + S(2)*a*h*x**S(3) + S(2)*b*d*x)/(S(2)*a*b*sqrt(a + b*x**S(4)))) rubi.add(rule67) pattern68 = Pattern(Integral((d_ + x_**S(6)*WC('h', S(1)) + x_**S(4)*WC('g', S(1)) + x_**S(2)*WC('e', S(1)))/(a_ + x_**S(4)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, h, a, e: ZeroQ(-S(3)*a*h + b*e)), CustomConstraint(lambda b, a, d, g: ZeroQ(a*g + b*d))) rule68 = ReplacementRule(pattern68, lambda a, x, b, d, h, e, g : x*(a*h*x**S(2) + b*d)/(a*b*sqrt(a + b*x**S(4)))) rubi.add(rule68) pattern69 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda b, n, Q, Pq, a, i, x, p, q, R: GreaterEqual(q, n))) def With69(p, n, Pq, a, x, b): q = Expon(Pq, x) return Module(List(Set(Q, PolynomialQuotient(Pq*b**(Floor((q + S(-1))/n) + S(1)), a + b*x**n, x)), Set(R, PolynomialRemainder(Pq*b**(Floor((q + S(-1))/n) + S(1)), a + b*x**n, x)), i), -R*b**(-Floor((q + S(-1))/n) + S(-1))*x*(a + b*x**n)**(p + S(1))/(a*n*(p + S(1))) + b**(-Floor((q + S(-1))/n) + S(-1))*Int((a + b*x**n)**(p + S(1))*ExpandToSum(Q*a*n*(p + S(1)) + R*n*(p + S(1)) + D(R*x, x), x), x)/(a*n*(p + S(1)))) rule69 = ReplacementRule(pattern69, lambda p, n, Pq, a, x, b : With69(p, n, Pq, a, x, b)) rubi.add(rule69) pattern70 = Pattern(Integral(Pq_*x_**m_*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda m: NegativeIntegerQ(m)), ) def With70(p, n, Pq, a, x, m, b): q = Expon(Pq, x) return Module(List(Set(Q, PolynomialQuotient(Pq*a*b**(Floor((q + S(-1))/n) + S(1))*x**m, a + b*x**n, x)), Set(R, PolynomialRemainder(Pq*a*b**(Floor((q + S(-1))/n) + S(1))*x**m, a + b*x**n, x)), i), -R*b**(-Floor((q + S(-1))/n) + S(-1))*x*(a + b*x**n)**(p + S(1))/(a**S(2)*n*(p + S(1))) + b**(-Floor((q + S(-1))/n) + S(-1))*Int(x**m*(a + b*x**n)**(p + S(1))*ExpandToSum(Q*n*x**(-m)*(p + S(1)) + Sum(x**(i - m)*(i + n*(p + S(1)) + S(1))*Coeff(R, x, i)/a, List(i, S(0), n + S(-1))), x), x)/(a*n*(p + S(1)))) rule70 = ReplacementRule(pattern70, lambda p, n, Pq, a, x, m, b : With70(p, n, Pq, a, x, m, b)) rubi.add(rule70) pattern71 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda m: IntegerQ(m)), CustomConstraint(lambda b, n, Pq, m, a, x, p, g: Unequal(g, S(1)))) def With71(p, n, Pq, a, x, m, b): g = GCD(m + S(1), n) return Subst(Int(x**(S(-1) + (m + S(1))/g)*(a + b*x**(n/g))**p*ReplaceAll(Pq, Rule(x, x**(1/g))), x), x, x**g)/g rule71 = ReplacementRule(pattern71, lambda p, n, Pq, a, x, m, b : With71(p, n, Pq, a, x, m, b)) rubi.add(rule71) pattern72 = Pattern(Integral((A_ + x_*WC('B', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda B, b, a, A: ZeroQ(-A**S(3)*b + B**S(3)*a))) rule72 = ReplacementRule(pattern72, lambda a, x, A, B, b : B**S(3)*Int(1/(A**S(2) - A*B*x + B**S(2)*x**S(2)), x)/b) rubi.add(rule72) pattern73 = Pattern(Integral((A_ + x_*WC('B', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda B, b, a, A: NonzeroQ(-A**S(3)*b + B**S(3)*a)), CustomConstraint(lambda b, a: PosQ(a/b)), ) def With73(a, x, A, B, b): r = Numerator(Rt(a/b, S(3))) s = Denominator(Rt(a/b, S(3))) return -r*(-A*s + B*r)*Int(1/(r + s*x), x)/(S(3)*a*s) + r*Int((r*(S(2)*A*s + B*r) + s*x*(-A*s + B*r))/(r**S(2) - r*s*x + s**S(2)*x**S(2)), x)/(S(3)*a*s) rule73 = ReplacementRule(pattern73, lambda a, x, A, B, b : With73(a, x, A, B, b)) rubi.add(rule73) pattern74 = Pattern(Integral((A_ + x_*WC('B', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda B, b, a, A: NonzeroQ(-A**S(3)*b + B**S(3)*a)), CustomConstraint(lambda b, a: NegQ(a/b)), ) def With74(a, x, A, B, b): r = Numerator(Rt(-a/b, S(3))) s = Denominator(Rt(-a/b, S(3))) return r*(A*s + B*r)*Int(1/(r - s*x), x)/(S(3)*a*s) - r*Int((r*(-S(2)*A*s + B*r) - s*x*(A*s + B*r))/(r**S(2) + r*s*x + s**S(2)*x**S(2)), x)/(S(3)*a*s) rule74 = ReplacementRule(pattern74, lambda a, x, A, B, b : With74(a, x, A, B, b)) rubi.add(rule74) pattern75 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, C, A: ZeroQ(-A*C + B**S(2))), CustomConstraint(lambda B, b, a, C: ZeroQ(B**S(3)*b + C**S(3)*a))) rule75 = ReplacementRule(pattern75, lambda a, C, x, A, B, b : -C**S(2)*Int(1/(B - C*x), x)/b) rubi.add(rule75) pattern76 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A*b**(S(2)/3) - B*a**(S(1)/3)*b**(S(1)/3) - S(2)*C*a**(S(2)/3))), ) def With76(a, C, x, A, B, b): q = a**(S(1)/3)/b**(S(1)/3) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule76 = ReplacementRule(pattern76, lambda a, C, x, A, B, b : With76(a, C, x, A, B, b)) rubi.add(rule76) pattern77 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*a**(S(1)/3)*b**(S(1)/3) + S(2)*C*a**(S(2)/3))), ) def With77(a, C, x, B, b): q = a**(S(1)/3)/b**(S(1)/3) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule77 = ReplacementRule(pattern77, lambda a, C, x, B, b : With77(a, C, x, B, b)) rubi.add(rule77) pattern78 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A*b**(S(2)/3) - S(2)*C*a**(S(2)/3))), ) def With78(a, C, x, A, b): q = a**(S(1)/3)/b**(S(1)/3) return C*q*Int(1/(q**S(2) - q*x + x**S(2)), x)/b + C*Int(1/(q + x), x)/b rule78 = ReplacementRule(pattern78, lambda a, C, x, A, b : With78(a, C, x, A, b)) rubi.add(rule78) pattern79 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A*(-b)**(S(2)/3) - B*(-a)**(S(1)/3)*(-b)**(S(1)/3) - S(2)*C*(-a)**(S(2)/3))), ) def With79(a, C, x, A, B, b): q = (-a)**(S(1)/3)/(-b)**(S(1)/3) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule79 = ReplacementRule(pattern79, lambda a, C, x, A, B, b : With79(a, C, x, A, B, b)) rubi.add(rule79) pattern80 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*(-a)**(S(1)/3)*(-b)**(S(1)/3) + S(2)*C*(-a)**(S(2)/3))), ) def With80(a, C, x, B, b): q = (-a)**(S(1)/3)/(-b)**(S(1)/3) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule80 = ReplacementRule(pattern80, lambda a, C, x, B, b : With80(a, C, x, B, b)) rubi.add(rule80) pattern81 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A*(-b)**(S(2)/3) - S(2)*C*(-a)**(S(2)/3))), ) def With81(a, C, x, A, b): q = (-a)**(S(1)/3)/(-b)**(S(1)/3) return C*q*Int(1/(q**S(2) - q*x + x**S(2)), x)/b + C*Int(1/(q + x), x)/b rule81 = ReplacementRule(pattern81, lambda a, C, x, A, b : With81(a, C, x, A, b)) rubi.add(rule81) pattern82 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A*b**(S(2)/3) + B*b**(S(1)/3)*(-a)**(S(1)/3) - S(2)*C*(-a)**(S(2)/3))), ) def With82(a, C, x, A, B, b): q = (-a)**(S(1)/3)/b**(S(1)/3) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule82 = ReplacementRule(pattern82, lambda a, C, x, A, B, b : With82(a, C, x, A, B, b)) rubi.add(rule82) pattern83 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*b**(S(1)/3)*(-a)**(S(1)/3) - S(2)*C*(-a)**(S(2)/3))), ) def With83(a, C, x, B, b): q = (-a)**(S(1)/3)/b**(S(1)/3) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule83 = ReplacementRule(pattern83, lambda a, C, x, B, b : With83(a, C, x, B, b)) rubi.add(rule83) pattern84 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A*b**(S(2)/3) - S(2)*C*(-a)**(S(2)/3))), ) def With84(a, C, x, A, b): q = (-a)**(S(1)/3)/b**(S(1)/3) return -C*q*Int(1/(q**S(2) + q*x + x**S(2)), x)/b - C*Int(1/(q - x), x)/b rule84 = ReplacementRule(pattern84, lambda a, C, x, A, b : With84(a, C, x, A, b)) rubi.add(rule84) pattern85 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A*(-b)**(S(2)/3) + B*a**(S(1)/3)*(-b)**(S(1)/3) - S(2)*C*a**(S(2)/3))), ) def With85(a, C, x, A, B, b): q = a**(S(1)/3)/(-b)**(S(1)/3) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule85 = ReplacementRule(pattern85, lambda a, C, x, A, B, b : With85(a, C, x, A, B, b)) rubi.add(rule85) pattern86 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*a**(S(1)/3)*(-b)**(S(1)/3) - S(2)*C*a**(S(2)/3))), ) def With86(a, C, x, B, b): q = a**(S(1)/3)/(-b)**(S(1)/3) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule86 = ReplacementRule(pattern86, lambda a, C, x, B, b : With86(a, C, x, B, b)) rubi.add(rule86) pattern87 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A*(-b)**(S(2)/3) - S(2)*C*a**(S(2)/3))), ) def With87(a, C, x, A, b): q = a**(S(1)/3)/(-b)**(S(1)/3) return -C*q*Int(1/(q**S(2) + q*x + x**S(2)), x)/b - C*Int(1/(q - x), x)/b rule87 = ReplacementRule(pattern87, lambda a, C, x, A, b : With87(a, C, x, A, b)) rubi.add(rule87) pattern88 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A - B*(a/b)**(S(1)/3) - S(2)*C*(a/b)**(S(2)/3))), ) def With88(a, C, x, A, B, b): q = (a/b)**(S(1)/3) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule88 = ReplacementRule(pattern88, lambda a, C, x, A, B, b : With88(a, C, x, A, B, b)) rubi.add(rule88) pattern89 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*(a/b)**(S(1)/3) + S(2)*C*(a/b)**(S(2)/3))), ) def With89(a, C, x, B, b): q = (a/b)**(S(1)/3) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule89 = ReplacementRule(pattern89, lambda a, C, x, B, b : With89(a, C, x, B, b)) rubi.add(rule89) pattern90 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A - S(2)*C*(a/b)**(S(2)/3))), ) def With90(a, C, x, A, b): q = (a/b)**(S(1)/3) return C*q*Int(1/(q**S(2) - q*x + x**S(2)), x)/b + C*Int(1/(q + x), x)/b rule90 = ReplacementRule(pattern90, lambda a, C, x, A, b : With90(a, C, x, A, b)) rubi.add(rule90) pattern91 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A - B*Rt(a/b, S(3)) - S(2)*C*Rt(a/b, S(3))**S(2))), ) def With91(a, C, x, A, B, b): q = Rt(a/b, S(3)) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule91 = ReplacementRule(pattern91, lambda a, C, x, A, B, b : With91(a, C, x, A, B, b)) rubi.add(rule91) pattern92 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*Rt(a/b, S(3)) + S(2)*C*Rt(a/b, S(3))**S(2))), ) def With92(a, C, x, B, b): q = Rt(a/b, S(3)) return C*Int(1/(q + x), x)/b + (B + C*q)*Int(1/(q**S(2) - q*x + x**S(2)), x)/b rule92 = ReplacementRule(pattern92, lambda a, C, x, B, b : With92(a, C, x, B, b)) rubi.add(rule92) pattern93 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A - S(2)*C*Rt(a/b, S(3))**S(2))), ) def With93(a, C, x, A, b): q = Rt(a/b, S(3)) return C*q*Int(1/(q**S(2) - q*x + x**S(2)), x)/b + C*Int(1/(q + x), x)/b rule93 = ReplacementRule(pattern93, lambda a, C, x, A, b : With93(a, C, x, A, b)) rubi.add(rule93) pattern94 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A + B*(-a/b)**(S(1)/3) - S(2)*C*(-a/b)**(S(2)/3))), ) def With94(a, C, x, A, B, b): q = (-a/b)**(S(1)/3) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule94 = ReplacementRule(pattern94, lambda a, C, x, A, B, b : With94(a, C, x, A, B, b)) rubi.add(rule94) pattern95 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*(-a/b)**(S(1)/3) - S(2)*C*(-a/b)**(S(2)/3))), ) def With95(a, C, x, B, b): q = (-a/b)**(S(1)/3) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule95 = ReplacementRule(pattern95, lambda a, C, x, B, b : With95(a, C, x, B, b)) rubi.add(rule95) pattern96 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A - S(2)*C*(-a/b)**(S(2)/3))), ) def With96(a, C, x, A, b): q = (-a/b)**(S(1)/3) return -C*q*Int(1/(q**S(2) + q*x + x**S(2)), x)/b - C*Int(1/(q - x), x)/b rule96 = ReplacementRule(pattern96, lambda a, C, x, A, b : With96(a, C, x, A, b)) rubi.add(rule96) pattern97 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A + B*Rt(-a/b, S(3)) - S(2)*C*Rt(-a/b, S(3))**S(2))), ) def With97(a, C, x, A, B, b): q = Rt(-a/b, S(3)) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule97 = ReplacementRule(pattern97, lambda a, C, x, A, B, b : With97(a, C, x, A, B, b)) rubi.add(rule97) pattern98 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*Rt(-a/b, S(3)) - S(2)*C*Rt(-a/b, S(3))**S(2))), ) def With98(a, C, x, B, b): q = Rt(-a/b, S(3)) return -C*Int(1/(q - x), x)/b + (B - C*q)*Int(1/(q**S(2) + q*x + x**S(2)), x)/b rule98 = ReplacementRule(pattern98, lambda a, C, x, B, b : With98(a, C, x, B, b)) rubi.add(rule98) pattern99 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A - S(2)*C*Rt(-a/b, S(3))**S(2))), ) def With99(a, C, x, A, b): q = Rt(-a/b, S(3)) return -C*q*Int(1/(q**S(2) + q*x + x**S(2)), x)/b - C*Int(1/(q - x), x)/b rule99 = ReplacementRule(pattern99, lambda a, C, x, A, b : With99(a, C, x, A, b)) rubi.add(rule99) pattern100 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, A: Not(RationalQ(a/b)) | ZeroQ(-A**S(3)*b + B**S(3)*a))) rule100 = ReplacementRule(pattern100, lambda a, C, x, A, B, b : C*Int(x**S(2)/(a + b*x**S(3)), x) + Int((A + B*x)/(a + b*x**S(3)), x)) rubi.add(rule100) pattern101 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a: Not(RationalQ(a/b)))) rule101 = ReplacementRule(pattern101, lambda a, C, x, B, b : B*Int(x/(a + b*x**S(3)), x) + C*Int(x**S(2)/(a + b*x**S(3)), x)) rubi.add(rule101) pattern102 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: Not(RationalQ(a, b, A, C)))) rule102 = ReplacementRule(pattern102, lambda a, C, x, A, b : A*Int(1/(a + b*x**S(3)), x) + C*Int(x**S(2)/(a + b*x**S(3)), x)) rubi.add(rule102) pattern103 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A - B*(a/b)**(S(1)/3) + C*(a/b)**(S(2)/3))), ) def With103(a, C, x, A, B, b): q = (a/b)**(S(1)/3) return q**S(2)*Int((A + C*q*x)/(q**S(2) - q*x + x**S(2)), x)/a rule103 = ReplacementRule(pattern103, lambda a, C, x, A, B, b : With103(a, C, x, A, B, b)) rubi.add(rule103) pattern104 = Pattern(Integral(x_*(x_*WC('C', S(1)) + WC('B', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*(a/b)**(S(1)/3) - C*(a/b)**(S(2)/3))), ) def With104(a, C, x, B, b): q = (a/b)**(S(1)/3) return C*q**S(3)*Int(x/(q**S(2) - q*x + x**S(2)), x)/a rule104 = ReplacementRule(pattern104, lambda a, C, x, B, b : With104(a, C, x, B, b)) rubi.add(rule104) pattern105 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A + C*(a/b)**(S(2)/3))), ) def With105(a, C, x, A, b): q = (a/b)**(S(1)/3) return q**S(2)*Int((A + C*q*x)/(q**S(2) - q*x + x**S(2)), x)/a rule105 = ReplacementRule(pattern105, lambda a, C, x, A, b : With105(a, C, x, A, b)) rubi.add(rule105) pattern106 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda a, C, A, B, b: ZeroQ(A + B*(-a/b)**(S(1)/3) + C*(-a/b)**(S(2)/3))), ) def With106(a, C, x, A, B, b): q = (-a/b)**(S(1)/3) return q*Int((A*q + x*(A + B*q))/(q**S(2) + q*x + x**S(2)), x)/a rule106 = ReplacementRule(pattern106, lambda a, C, x, A, B, b : With106(a, C, x, A, B, b)) rubi.add(rule106) pattern107 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, C: ZeroQ(B*(-a/b)**(S(1)/3) + C*(-a/b)**(S(2)/3))), ) def With107(a, C, x, B, b): q = (-a/b)**(S(1)/3) return B*q**S(2)*Int(x/(q**S(2) + q*x + x**S(2)), x)/a rule107 = ReplacementRule(pattern107, lambda a, C, x, B, b : With107(a, C, x, B, b)) rubi.add(rule107) pattern108 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a, C, A: ZeroQ(A + C*(-a/b)**(S(2)/3))), ) def With108(a, C, x, A, b): q = (-a/b)**(S(1)/3) return A*q*Int((q + x)/(q**S(2) + q*x + x**S(2)), x)/a rule108 = ReplacementRule(pattern108, lambda a, C, x, A, b : With108(a, C, x, A, b)) rubi.add(rule108) pattern109 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, A: NonzeroQ(-A**S(3)*b + B**S(3)*a)), CustomConstraint(lambda b, a: RationalQ(a/b)), CustomConstraint(lambda b, a: Greater(a/b, S(0))), CustomConstraint(lambda C, a, x, q, B, A: NonzeroQ(A - B*q + C*q**S(2)))) def With109(a, C, x, A, B, b): q = (a/b)**(S(1)/3) return q*(A - B*q + C*q**S(2))*Int(1/(q + x), x)/(S(3)*a) + q*Int((q*(S(2)*A + B*q - C*q**S(2)) - x*(A - B*q - S(2)*C*q**S(2)))/(q**S(2) - q*x + x**S(2)), x)/(S(3)*a) rule109 = ReplacementRule(pattern109, lambda a, C, x, A, B, b : With109(a, C, x, A, B, b)) rubi.add(rule109) pattern110 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a: RationalQ(a/b)), CustomConstraint(lambda b, a: Greater(a/b, S(0))), CustomConstraint(lambda C, a, x, q, B: NonzeroQ(B*q - C*q**S(2)))) def With110(a, C, x, B, b): q = (a/b)**(S(1)/3) return -q*(B*q - C*q**S(2))*Int(1/(q + x), x)/(S(3)*a) + q*Int((q*(B*q - C*q**S(2)) + x*(B*q + S(2)*C*q**S(2)))/(q**S(2) - q*x + x**S(2)), x)/(S(3)*a) rule110 = ReplacementRule(pattern110, lambda a, C, x, B, b : With110(a, C, x, B, b)) rubi.add(rule110) pattern111 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a: RationalQ(a/b)), CustomConstraint(lambda b, a: Greater(a/b, S(0))), CustomConstraint(lambda C, a, x, q, A: NonzeroQ(A + C*q**S(2)))) def With111(a, C, x, A, b): q = (a/b)**(S(1)/3) return q*(A + C*q**S(2))*Int(1/(q + x), x)/(S(3)*a) + q*Int((q*(S(2)*A - C*q**S(2)) - x*(A - S(2)*C*q**S(2)))/(q**S(2) - q*x + x**S(2)), x)/(S(3)*a) rule111 = ReplacementRule(pattern111, lambda a, C, x, A, b : With111(a, C, x, A, b)) rubi.add(rule111) pattern112 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda B, b, a, A: NonzeroQ(-A**S(3)*b + B**S(3)*a)), CustomConstraint(lambda b, a: RationalQ(a/b)), CustomConstraint(lambda b, a: Less(a/b, S(0))), CustomConstraint(lambda C, a, x, q, B, A: NonzeroQ(A + B*q + C*q**S(2)))) def With112(a, C, x, A, B, b): q = (-a/b)**(S(1)/3) return q*(A + B*q + C*q**S(2))*Int(1/(q - x), x)/(S(3)*a) + q*Int((q*(S(2)*A - B*q - C*q**S(2)) + x*(A + B*q - S(2)*C*q**S(2)))/(q**S(2) + q*x + x**S(2)), x)/(S(3)*a) rule112 = ReplacementRule(pattern112, lambda a, C, x, A, B, b : With112(a, C, x, A, B, b)) rubi.add(rule112) pattern113 = Pattern(Integral(x_*(B_ + x_*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a: RationalQ(a/b)), CustomConstraint(lambda b, a: Less(a/b, S(0))), CustomConstraint(lambda C, a, x, q, B: NonzeroQ(B*q + C*q**S(2)))) def With113(a, C, x, B, b): q = (-a/b)**(S(1)/3) return q*(B*q + C*q**S(2))*Int(1/(q - x), x)/(S(3)*a) + q*Int((-q*(B*q + C*q**S(2)) + x*(B*q - S(2)*C*q**S(2)))/(q**S(2) + q*x + x**S(2)), x)/(S(3)*a) rule113 = ReplacementRule(pattern113, lambda a, C, x, B, b : With113(a, C, x, B, b)) rubi.add(rule113) pattern114 = Pattern(Integral((A_ + x_**S(2)*WC('C', S(1)))/(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, a: RationalQ(a/b)), CustomConstraint(lambda b, a: Less(a/b, S(0))), CustomConstraint(lambda C, a, x, q, A: NonzeroQ(A + C*q**S(2)))) def With114(a, C, x, A, b): q = (-a/b)**(S(1)/3) return q*(A + C*q**S(2))*Int(1/(q - x), x)/(S(3)*a) + q*Int((q*(S(2)*A - C*q**S(2)) + x*(A - S(2)*C*q**S(2)))/(q**S(2) + q*x + x**S(2)), x)/(S(3)*a) rule114 = ReplacementRule(pattern114, lambda a, C, x, A, b : With114(a, C, x, A, b)) rubi.add(rule114) pattern115 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))/(a_ + x_**n_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n/S(2))), CustomConstraint(lambda n, Pq, x: Less(Expon(Pq, x), n)), CustomConstraint(lambda v, x: SumQ(v))) def With115(n, Pq, a, x, m, b, c): v = Sum(c**(-ii)*(c*x)**(ii + m)*(x**(n/S(2))*Coeff(Pq, x, ii + n/S(2)) + Coeff(Pq, x, ii))/(a + b*x**n), List(ii, S(0), n/S(2) + S(-1))) return Int(v, x) rule115 = ReplacementRule(pattern115, lambda n, Pq, a, x, m, b, c : With115(n, Pq, a, x, m, b, c)) rubi.add(rule115) pattern116 = Pattern(Integral(Pq_/(a_ + x_**n_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n/S(2))), CustomConstraint(lambda n, Pq, x: Less(Expon(Pq, x), n)), CustomConstraint(lambda v, x: SumQ(v))) def With116(n, Pq, a, x, b): v = Sum(x**ii*(x**(n/S(2))*Coeff(Pq, x, ii + n/S(2)) + Coeff(Pq, x, ii))/(a + b*x**n), List(ii, S(0), n/S(2) + S(-1))) return Int(v, x) rule116 = ReplacementRule(pattern116, lambda n, Pq, a, x, b : With116(n, Pq, a, x, b)) rubi.add(rule116) pattern117 = Pattern(Integral((c_ + x_*WC('d', S(1)))/sqrt(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b, a, d, c: ZeroQ(c*Rt(b/a, S(3)) - d*(-sqrt(S(3)) + S(1)))), ) def With117(a, x, b, d, c): r = Numer(Rt(b/a, S(3))) s = Denom(Rt(b/a, S(3))) return -S(3)**(S(1)/4)*d*s*sqrt((r**S(2)*x**S(2) - r*s*x + s**S(2))/(r*x + s*(S(1) + sqrt(S(3))))**S(2))*sqrt(-sqrt(S(3)) + S(2))*(r*x + s)*EllipticE(asin((r*x + s*(-sqrt(S(3)) + S(1)))/(r*x + s*(S(1) + sqrt(S(3))))), S(-7) - S(4)*sqrt(S(3)))/(r**S(2)*sqrt(s*(r*x + s)/(r*x + s*(S(1) + sqrt(S(3))))**S(2))*sqrt(a + b*x**S(3))) + S(2)*d*s**S(3)*sqrt(a + b*x**S(3))/(a*r**S(2)*(r*x + s*(S(1) + sqrt(S(3))))) rule117 = ReplacementRule(pattern117, lambda a, x, b, d, c : With117(a, x, b, d, c)) rubi.add(rule117) pattern118 = Pattern(Integral((c_ + x_*WC('d', S(1)))/sqrt(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b, a, d, c: NonzeroQ(c*Rt(b/a, S(3)) - d*(-sqrt(S(3)) + S(1)))), ) def With118(a, x, b, d, c): r = Numer(Rt(b/a, S(3))) s = Denom(Rt(b/a, S(3))) return d*Int((r*x + s*(-sqrt(S(3)) + S(1)))/sqrt(a + b*x**S(3)), x)/r + (c*r - d*s*(-sqrt(S(3)) + S(1)))*Int(1/sqrt(a + b*x**S(3)), x)/r rule118 = ReplacementRule(pattern118, lambda a, x, b, d, c : With118(a, x, b, d, c)) rubi.add(rule118) pattern119 = Pattern(Integral((c_ + x_*WC('d', S(1)))/sqrt(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b, a, d, c: ZeroQ(c*Rt(b/a, S(3)) - d*(S(1) + sqrt(S(3))))), ) def With119(a, x, b, d, c): r = Numer(Rt(b/a, S(3))) s = Denom(Rt(b/a, S(3))) return S(3)**(S(1)/4)*d*s*sqrt((r**S(2)*x**S(2) - r*s*x + s**S(2))/(r*x + s*(-sqrt(S(3)) + S(1)))**S(2))*sqrt(sqrt(S(3)) + S(2))*(r*x + s)*EllipticE(asin((r*x + s*(S(1) + sqrt(S(3))))/(r*x + s*(-sqrt(S(3)) + S(1)))), S(-7) + S(4)*sqrt(S(3)))/(r**S(2)*sqrt(-s*(r*x + s)/(r*x + s*(-sqrt(S(3)) + S(1)))**S(2))*sqrt(a + b*x**S(3))) + S(2)*d*s**S(3)*sqrt(a + b*x**S(3))/(a*r**S(2)*(r*x + s*(-sqrt(S(3)) + S(1)))) rule119 = ReplacementRule(pattern119, lambda a, x, b, d, c : With119(a, x, b, d, c)) rubi.add(rule119) pattern120 = Pattern(Integral((c_ + x_*WC('d', S(1)))/sqrt(a_ + x_**S(3)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b, a, d, c: NonzeroQ(c*Rt(b/a, S(3)) - d*(S(1) + sqrt(S(3))))), ) def With120(a, x, b, d, c): r = Numer(Rt(b/a, S(3))) s = Denom(Rt(b/a, S(3))) return d*Int((r*x + s*(S(1) + sqrt(S(3))))/sqrt(a + b*x**S(3)), x)/r + (c*r - d*s*(S(1) + sqrt(S(3))))*Int(1/sqrt(a + b*x**S(3)), x)/r rule120 = ReplacementRule(pattern120, lambda a, x, b, d, c : With120(a, x, b, d, c)) rubi.add(rule120) pattern121 = Pattern(Integral((c_ + x_**S(4)*WC('d', S(1)))/sqrt(a_ + x_**S(6)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda b, a, d, c: ZeroQ(S(2)*c*Rt(b/a, S(3))**S(2) - d*(-sqrt(S(3)) + S(1)))), ) def With121(a, x, b, d, c): r = Numer(Rt(b/a, S(3))) s = Denom(Rt(b/a, S(3))) return -S(3)**(S(1)/4)*d*s*x*sqrt((r**S(2)*x**S(4) - r*s*x**S(2) + s**S(2))/(r*x**S(2)*(S(1) + sqrt(S(3))) + s)**S(2))*(r*x**S(2) + s)*EllipticE(acos((r*x**S(2)*(-sqrt(S(3)) + S(1)) + s)/(r*x**S(2)*(S(1) + sqrt(S(3))) + s)), sqrt(S(3))/S(4) + S(1)/2)/(S(2)*r**S(2)*sqrt(r*x**S(2)*(r*x**S(2) + s)/(r*x**S(2)*(S(1) + sqrt(S(3))) + s)**S(2))*sqrt(a + b*x**S(6))) + d*s**S(3)*x*(S(1) + sqrt(S(3)))*sqrt(a + b*x**S(6))/(S(2)*a*r**S(2)*(r*x**S(2)*(S(1) + sqrt(S(3))) + s)) rule121 = ReplacementRule(pattern121, lambda a, x, b, d, c : With121(a, x, b, d, c)) rubi.add(rule121) pattern122 = Pattern(Integral((c_ + x_**S(4)*WC('d', S(1)))/sqrt(a_ + x_**S(6)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda b, a, d, c: NonzeroQ(S(2)*c*Rt(b/a, S(3))**S(2) - d*(-sqrt(S(3)) + S(1)))), ) def With122(a, x, b, d, c): q = Rt(b/a, S(3)) return d*Int((S(2)*q**S(2)*x**S(4) - sqrt(S(3)) + S(1))/sqrt(a + b*x**S(6)), x)/(S(2)*q**S(2)) + (S(2)*c*q**S(2) - d*(-sqrt(S(3)) + S(1)))*Int(1/sqrt(a + b*x**S(6)), x)/(S(2)*q**S(2)) rule122 = ReplacementRule(pattern122, lambda a, x, b, d, c : With122(a, x, b, d, c)) rubi.add(rule122) pattern123 = Pattern(Integral((c_ + x_**S(2)*WC('d', S(1)))/sqrt(a_ + x_**S(8)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda b, a, d, c: ZeroQ(-a*d**S(4) + b*c**S(4)))) rule123 = ReplacementRule(pattern123, lambda a, x, b, d, c : -c*d*x**S(3)*sqrt(-(c - d*x**S(2))**S(2)/(c*d*x**S(2)))*sqrt(-d**S(2)*(a + b*x**S(8))/(b*c**S(2)*x**S(4)))*EllipticF(asin(sqrt((sqrt(S(2))*c**S(2) + S(2)*c*d*x**S(2) + sqrt(S(2))*d**S(2)*x**S(4))/(c*d*x**S(2)))/S(2)), S(-2) + S(2)*sqrt(S(2)))/(sqrt(sqrt(S(2)) + S(2))*sqrt(a + b*x**S(8))*(c - d*x**S(2)))) rubi.add(rule123) pattern124 = Pattern(Integral((c_ + x_**S(2)*WC('d', S(1)))/sqrt(a_ + x_**S(8)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d**S(4) + b*c**S(4)))) rule124 = ReplacementRule(pattern124, lambda a, x, b, d, c : -(-c*Rt(b/a, S(4)) + d)*Int((-x**S(2)*Rt(b/a, S(4)) + S(1))/sqrt(a + b*x**S(8)), x)/(S(2)*Rt(b/a, S(4))) + (c*Rt(b/a, S(4)) + d)*Int((x**S(2)*Rt(b/a, S(4)) + S(1))/sqrt(a + b*x**S(8)), x)/(S(2)*Rt(b/a, S(4)))) rubi.add(rule124) pattern125 = Pattern(Integral(Pq_/(x_*sqrt(a_ + x_**n_*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda Pq, x: NonzeroQ(Coeff(Pq, x, S(0))))) rule125 = ReplacementRule(pattern125, lambda n, Pq, a, x, b : Coeff(Pq, x, S(0))*Int(S(1)/(x*sqrt(a + b*x**n)), x) + Int(ExpandToSum((Pq - Coeff(Pq, x, S(0)))/x, x)/sqrt(a + b*x**n), x)) rubi.add(rule125) pattern126 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n/S(2))), CustomConstraint(lambda n, Pq, x: Not(PolyQ(Pq, x**(n/S(2))))), ) def With126(p, n, Pq, a, x, m, b, c): q = Expon(Pq, x) j = Symbol('j') k = Symbol('k') return Int(Sum(c**(-j)*(c*x)**(j + m)*(a + b*x**n)**p*Sum(x**(k*n/S(2))*Coeff(Pq, x, j + k*n/S(2)), List(k, S(0), S(1) + S(2)*(-j + q)/n)), List(j, S(0), n/S(2) + S(-1))), x) rule126 = ReplacementRule(pattern126, lambda p, n, Pq, a, x, m, b, c : With126(p, n, Pq, a, x, m, b, c)) rubi.add(rule126) pattern127 = Pattern(Integral(Pq_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n/S(2))), CustomConstraint(lambda n, Pq, x: Not(PolyQ(Pq, x**(n/S(2))))), ) def With127(p, n, Pq, a, x, b): q = Expon(Pq, x) j = Symbol('j') k = Symbol('k') return Int(Sum(x**j*(a + b*x**n)**p*Sum(x**(k*n/S(2))*Coeff(Pq, x, j + k*n/S(2)), List(k, S(0), S(1) + S(2)*(-j + q)/n)), List(j, S(0), n/S(2) + S(-1))), x) rule127 = ReplacementRule(pattern127, lambda p, n, Pq, a, x, b : With127(p, n, Pq, a, x, b)) rubi.add(rule127) pattern128 = Pattern(Integral(Pq_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda n, Pq, x: Equal(Expon(Pq, x), n + S(-1)))) rule128 = ReplacementRule(pattern128, lambda p, n, Pq, a, x, b : Coeff(Pq, x, n + S(-1))*Int(x**(n + S(-1))*(a + b*x**n)**p, x) + Int((a + b*x**n)**p*ExpandToSum(Pq - x**(n + S(-1))*Coeff(Pq, x, n + S(-1)), x), x)) rubi.add(rule128) pattern129 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))/(a_ + x_**n_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: IntegerQ(n))) rule129 = ReplacementRule(pattern129, lambda n, Pq, a, x, m, b, c : Int(ExpandIntegrand(Pq*(c*x)**m/(a + b*x**n), x), x)) rubi.add(rule129) pattern130 = Pattern(Integral(Pq_/(a_ + x_**n_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: IntegerQ(n))) rule130 = ReplacementRule(pattern130, lambda n, Pq, a, x, b : Int(ExpandIntegrand(Pq/(a + b*x**n), x), x)) rubi.add(rule130) pattern131 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**m_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda m: RationalQ(m)), CustomConstraint(lambda m: Less(m, S(-1))), CustomConstraint(lambda n, Pq, x: LessEqual(n + S(-1), Expon(Pq, x))), CustomConstraint(lambda b, n, Pq, m, Pq0, a, x, p, c: NonzeroQ(Pq0))) def With131(p, n, Pq, a, x, m, b, c): Pq0 = Coeff(Pq, x, S(0)) return Pq0*(c*x)**(m + S(1))*(a + b*x**n)**(p + S(1))/(a*c*(m + S(1))) + Int((c*x)**(m + S(1))*(a + b*x**n)**p*ExpandToSum(-S(2)*Pq0*b*x**(n + S(-1))*(m + n*(p + S(1)) + S(1)) + S(2)*a*(Pq - Pq0)*(m + S(1))/x, x), x)/(S(2)*a*c*(m + S(1))) rule131 = ReplacementRule(pattern131, lambda p, n, Pq, a, x, m, b, c : With131(p, n, Pq, a, x, m, b, c)) rubi.add(rule131) pattern132 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda Pqq, b, n, Pq, m, a, x, p, q, c: GreaterEqual(-n + q, S(0)) & NonzeroQ(m + n*p + q + S(1)) & (IntegerQ(S(2)*p) | IntegerQ(p + (q + S(1))/(S(2)*n))))) def With132(p, n, Pq, a, x, m, b, c): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), Pqq*c**(n - q + S(-1))*(c*x)**(m - n + q + S(1))*(a + b*x**n)**(p + S(1))/(b*(m + n*p + q + S(1))) + Int((c*x)**m*(a + b*x**n)**p*ExpandToSum(-Pqq*a*x**(-n + q)*(m - n + q + S(1)) + b*(Pq - Pqq*x**q)*(m + n*p + q + S(1)), x), x)/(b*(m + n*p + q + S(1)))) rule132 = ReplacementRule(pattern132, lambda p, n, Pq, a, x, m, b, c : With132(p, n, Pq, a, x, m, b, c)) rubi.add(rule132) pattern133 = Pattern(Integral(Pq_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda Pqq, b, n, Pq, a, x, p, q: GreaterEqual(-n + q, S(0)) & NonzeroQ(n*p + q + S(1)) & (IntegerQ(S(2)*p) | IntegerQ(p + (q + S(1))/(S(2)*n))))) def With133(p, n, Pq, a, x, b): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), Pqq*x**(-n + q + S(1))*(a + b*x**n)**(p + S(1))/(b*(n*p + q + S(1))) + Int((a + b*x**n)**p*ExpandToSum(-Pqq*a*x**(-n + q)*(-n + q + S(1)) + b*(Pq - Pqq*x**q)*(n*p + q + S(1)), x), x)/(b*(n*p + q + S(1)))) rule133 = ReplacementRule(pattern133, lambda p, n, Pq, a, x, b : With133(p, n, Pq, a, x, b)) rubi.add(rule133) pattern134 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: NegativeIntegerQ(n)), CustomConstraint(lambda m: IntegerQ(m)), ) def With134(p, n, Pq, a, x, m, b): q = Expon(Pq, x) return -Subst(Int(x**(-m - q + S(-2))*(a + b*x**(-n))**p*ExpandToSum(x**q*ReplaceAll(Pq, Rule(x, 1/x)), x), x), x, 1/x) rule134 = ReplacementRule(pattern134, lambda p, n, Pq, a, x, m, b : With134(p, n, Pq, a, x, m, b)) rubi.add(rule134) pattern135 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: NegativeIntegerQ(n)), CustomConstraint(lambda m: FractionQ(m)), ) def With135(p, n, Pq, a, x, m, b, c): g = Denominator(m) q = Expon(Pq, x) return -g*Subst(Int(x**(-g*(m + q + S(1)) + S(-1))*(a + b*c**(-n)*x**(-g*n))**p*ExpandToSum(x**(g*q)*ReplaceAll(Pq, Rule(x, x**(-g)/c)), x), x), x, (c*x)**(-S(1)/g))/c rule135 = ReplacementRule(pattern135, lambda p, n, Pq, a, x, m, b, c : With135(p, n, Pq, a, x, m, b, c)) rubi.add(rule135) pattern136 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**m_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: NegativeIntegerQ(n)), CustomConstraint(lambda m: Not(RationalQ(m))), ) def With136(p, n, Pq, a, x, m, b, c): q = Expon(Pq, x) return -(c*x)**m*(1/x)**m*Subst(Int(x**(-m - q + S(-2))*(a + b*x**(-n))**p*ExpandToSum(x**q*ReplaceAll(Pq, Rule(x, 1/x)), x), x), x, 1/x) rule136 = ReplacementRule(pattern136, lambda p, n, Pq, a, x, m, b, c : With136(p, n, Pq, a, x, m, b, c)) rubi.add(rule136) pattern137 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: FractionQ(n)), ) def With137(p, n, Pq, a, x, m, b): g = Denominator(n) return g*Subst(Int(x**(g*(m + S(1)) + S(-1))*(a + b*x**(g*n))**p*ReplaceAll(Pq, Rule(x, x**g)), x), x, x**(1/g)) rule137 = ReplacementRule(pattern137, lambda p, n, Pq, a, x, m, b : With137(p, n, Pq, a, x, m, b)) rubi.add(rule137) pattern138 = Pattern(Integral(Pq_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: FractionQ(n)), ) def With138(p, n, Pq, a, x, b): g = Denominator(n) return g*Subst(Int(x**(g + S(-1))*(a + b*x**(g*n))**p*ReplaceAll(Pq, Rule(x, x**g)), x), x, x**(1/g)) rule138 = ReplacementRule(pattern138, lambda p, n, Pq, a, x, b : With138(p, n, Pq, a, x, b)) rubi.add(rule138) pattern139 = Pattern(Integral(Pq_*(c_*x_)**m_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda n: FractionQ(n))) rule139 = ReplacementRule(pattern139, lambda p, n, Pq, a, x, m, b, c : c**IntPart(m)*x**(-FracPart(m))*(c*x)**FracPart(m)*Int(Pq*x**m*(a + b*x**n)**p, x)) rubi.add(rule139) pattern140 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule140 = ReplacementRule(pattern140, lambda p, n, Pq, a, x, m, b : Subst(Int((a + b*x**(n/(m + S(1))))**p*ReplaceAll(SubstFor(x**n, Pq, x), Rule(x, x**(n/(m + S(1))))), x), x, x**(m + S(1)))/(m + S(1))) rubi.add(rule140) pattern141 = Pattern(Integral(Pq_*(c_*x_)**m_*(a_ + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule141 = ReplacementRule(pattern141, lambda p, n, Pq, a, x, m, b, c : c**IntPart(m)*x**(-FracPart(m))*(c*x)**FracPart(m)*Int(Pq*x**m*(a + b*x**n)**p, x)) rubi.add(rule141) pattern142 = Pattern(Integral((A_ + x_**WC('m', S(1))*WC('B', S(1)))*(a_ + x_**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, m: ZeroQ(m - n + S(1)))) rule142 = ReplacementRule(pattern142, lambda p, n, a, m, x, A, B, b : A*Int((a + b*x**n)**p, x) + B*Int(x**m*(a + b*x**n)**p, x)) rubi.add(rule142) pattern143 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x) | PolyQ(Pq, x**n))) rule143 = ReplacementRule(pattern143, lambda p, n, Pq, a, x, m, b, c : Int(ExpandIntegrand(Pq*(c*x)**m*(a + b*x**n)**p, x), x)) rubi.add(rule143) pattern144 = Pattern(Integral(Pq_*(a_ + x_**n_*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x) | PolyQ(Pq, x**n))) rule144 = ReplacementRule(pattern144, lambda p, n, Pq, a, x, b : Int(ExpandIntegrand(Pq*(a + b*x**n)**p, x), x)) rubi.add(rule144) pattern145 = Pattern(Integral(Pq_*u_**WC('m', S(1))*(a_ + v_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda v, x, u: LinearPairQ(u, v, x)), CustomConstraint(lambda n, Pq, v: PolyQ(Pq, v**n))) rule145 = ReplacementRule(pattern145, lambda p, n, Pq, a, v, x, u, m, b : u**m*v**(-m)*Subst(Int(x**m*(a + b*x**n)**p*SubstFor(v, Pq, x), x), x, v)/Coeff(v, x, S(1))) rubi.add(rule145) pattern146 = Pattern(Integral(Pq_*(a_ + v_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda v, x: LinearQ(v, x)), CustomConstraint(lambda n, Pq, v: PolyQ(Pq, v**n))) rule146 = ReplacementRule(pattern146, lambda p, n, Pq, a, v, x, b : Subst(Int((a + b*x**n)**p*SubstFor(v, Pq, x), x), x, v)/Coeff(v, x, S(1))) rubi.add(rule146) pattern147 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a1_ + x_**WC('n', S(1))*WC('b1', S(1)))**WC('p', S(1))*(a2_ + x_**WC('n', S(1))*WC('b2', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a1, x: FreeQ(a1, x)), CustomConstraint(lambda b1, x: FreeQ(b1, x)), CustomConstraint(lambda a2, x: FreeQ(a2, x)), CustomConstraint(lambda b2, x: FreeQ(b2, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda a2, b2, a1, b1: ZeroQ(a1*b2 + a2*b1)), CustomConstraint(lambda a2, a1, p: IntegerQ(p) | (PositiveQ(a1) & PositiveQ(a2)))) rule147 = ReplacementRule(pattern147, lambda b2, p, n, Pq, a2, a1, x, b1, m, c : Int(Pq*(c*x)**m*(a1*a2 + b1*b2*x**(S(2)*n))**p, x)) rubi.add(rule147) pattern148 = Pattern(Integral(Pq_*(a1_ + x_**WC('n', S(1))*WC('b1', S(1)))**WC('p', S(1))*(a2_ + x_**WC('n', S(1))*WC('b2', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a1, x: FreeQ(a1, x)), CustomConstraint(lambda b1, x: FreeQ(b1, x)), CustomConstraint(lambda a2, x: FreeQ(a2, x)), CustomConstraint(lambda b2, x: FreeQ(b2, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda a2, b2, a1, b1: ZeroQ(a1*b2 + a2*b1)), CustomConstraint(lambda a2, a1, p: IntegerQ(p) | (PositiveQ(a1) & PositiveQ(a2)))) rule148 = ReplacementRule(pattern148, lambda b2, p, n, Pq, a2, a1, x, b1 : Int(Pq*(a1*a2 + b1*b2*x**(S(2)*n))**p, x)) rubi.add(rule148) pattern149 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(a1_ + x_**WC('n', S(1))*WC('b1', S(1)))**WC('p', S(1))*(a2_ + x_**WC('n', S(1))*WC('b2', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a1, x: FreeQ(a1, x)), CustomConstraint(lambda b1, x: FreeQ(b1, x)), CustomConstraint(lambda a2, x: FreeQ(a2, x)), CustomConstraint(lambda b2, x: FreeQ(b2, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda a2, b2, a1, b1: ZeroQ(a1*b2 + a2*b1))) rule149 = ReplacementRule(pattern149, lambda b2, p, n, Pq, a2, a1, x, b1, m, c : (a1 + b1*x**n)**FracPart(p)*(a2 + b2*x**n)**FracPart(p)*(a1*a2 + b1*b2*x**(S(2)*n))**(-FracPart(p))*Int(Pq*(c*x)**m*(a1*a2 + b1*b2*x**(S(2)*n))**p, x)) rubi.add(rule149) pattern150 = Pattern(Integral(Pq_*(a1_ + x_**WC('n', S(1))*WC('b1', S(1)))**WC('p', S(1))*(a2_ + x_**WC('n', S(1))*WC('b2', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a1, x: FreeQ(a1, x)), CustomConstraint(lambda b1, x: FreeQ(b1, x)), CustomConstraint(lambda a2, x: FreeQ(a2, x)), CustomConstraint(lambda b2, x: FreeQ(b2, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda a2, b2, a1, b1: ZeroQ(a1*b2 + a2*b1))) rule150 = ReplacementRule(pattern150, lambda b2, p, n, Pq, a2, a1, x, b1 : (a1 + b1*x**n)**FracPart(p)*(a2 + b2*x**n)**FracPart(p)*(a1*a2 + b1*b2*x**(S(2)*n))**(-FracPart(p))*Int(Pq*(a1*a2 + b1*b2*x**(S(2)*n))**p, x)) rubi.add(rule150) pattern151 = Pattern(Integral((a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('p', S(1))*(e_ + x_**WC('n', S(1))*WC('f', S(1)) + x_**WC('n2', S(1))*WC('g', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda p, n, a, f, b, d, e, c: ZeroQ(a*c*f - e*(a*d + b*c)*(n*(p + S(1)) + S(1)))), CustomConstraint(lambda e, p, c, n, a, b, d, g: ZeroQ(a*c*g - b*d*e*(S(2)*n*(p + S(1)) + S(1))))) rule151 = ReplacementRule(pattern151, lambda n2, e, p, c, n, a, f, x, b, d, g : e*x*(a + b*x**n)**(p + S(1))*(c + d*x**n)**(p + S(1))/(a*c)) rubi.add(rule151) pattern152 = Pattern(Integral((a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('p', S(1))*(e_ + x_**WC('n2', S(1))*WC('g', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, p: ZeroQ(n*(p + S(1)) + S(1))), CustomConstraint(lambda e, p, c, n, a, b, d, g: ZeroQ(a*c*g - b*d*e*(S(2)*n*(p + S(1)) + S(1))))) rule152 = ReplacementRule(pattern152, lambda n2, e, p, c, n, a, x, b, d, g : e*x*(a + b*x**n)**(p + S(1))*(c + d*x**n)**(p + S(1))/(a*c)) rubi.add(rule152) pattern153 = Pattern(Integral((x_*WC('h', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('p', S(1))*(e_ + x_**WC('n', S(1))*WC('f', S(1)) + x_**WC('n2', S(1))*WC('g', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda p, n, a, f, m, b, d, e, c: ZeroQ(a*c*f*(m + S(1)) - e*(a*d + b*c)*(m + n*(p + S(1)) + S(1)))), CustomConstraint(lambda e, p, c, n, a, m, b, d, g: ZeroQ(a*c*g*(m + S(1)) - b*d*e*(m + S(2)*n*(p + S(1)) + S(1)))), CustomConstraint(lambda m: NonzeroQ(m + S(1)))) rule153 = ReplacementRule(pattern153, lambda n2, e, p, c, n, a, f, x, m, b, h, d, g : e*(h*x)**(m + S(1))*(a + b*x**n)**(p + S(1))*(c + d*x**n)**(p + S(1))/(a*c*h*(m + S(1)))) rubi.add(rule153) pattern154 = Pattern(Integral((x_*WC('h', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('p', S(1))*(e_ + x_**WC('n2', S(1))*WC('g', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, p, m: ZeroQ(m + n*(p + S(1)) + S(1))), CustomConstraint(lambda e, p, c, n, a, m, b, d, g: ZeroQ(a*c*g*(m + S(1)) - b*d*e*(m + S(2)*n*(p + S(1)) + S(1)))), CustomConstraint(lambda m: NonzeroQ(m + S(1)))) rule154 = ReplacementRule(pattern154, lambda n2, e, p, c, n, a, x, m, b, h, d, g : e*(h*x)**(m + S(1))*(a + b*x**n)**(p + S(1))*(c + d*x**n)**(p + S(1))/(a*c*h*(m + S(1)))) rubi.add(rule154) pattern155 = Pattern(Integral((A_ + x_**WC('m', S(1))*WC('B', S(1)))*(c_ + x_**n_*WC('d', S(1)))**WC('q', S(1))*(x_**n_*WC('b', S(1)) + WC('a', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda n, m: ZeroQ(m - n + S(1)))) rule155 = ReplacementRule(pattern155, lambda p, n, a, q, x, A, m, B, b, d, c : A*Int((a + b*x**n)**p*(c + d*x**n)**q, x) + B*Int(x**m*(a + b*x**n)**p*(c + d*x**n)**q, x)) rubi.add(rule155) pattern156 = Pattern(Integral(Px_**WC('q', S(1))*((c_ + x_*WC('d', S(1)))**n_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Px, x: PolynomialQ(Px, x)), CustomConstraint(lambda q: IntegerQ(q)), CustomConstraint(lambda n: RationalQ(n)), ) def With156(p, n, a, Px, q, x, b, d, c): k = Denominator(n) return k*Subst(Int(SimplifyIntegrand(x**(k + S(-1))*(a + b*x**(k*n))**p*ReplaceAll(Px, Rule(x, -c/d + x**k/d))**q, x), x), x, (c + d*x)**(1/k))/d rule156 = ReplacementRule(pattern156, lambda p, n, a, Px, q, x, b, d, c : With156(p, n, a, Px, q, x, b, d, c)) rubi.add(rule156) pattern157 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda n, m: ZeroQ(m - n + S(1)))) rule157 = ReplacementRule(pattern157, lambda n2, p, n, Pq, a, x, m, b, c : Subst(Int((a + b*x + c*x**S(2))**p*SubstFor(x**n, Pq, x), x), x, x**n)/n) rubi.add(rule157) pattern158 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda p: PositiveIntegerQ(p))) rule158 = ReplacementRule(pattern158, lambda n2, p, n, Pq, a, x, m, b, d, c : Int(ExpandIntegrand(Pq*(d*x)**m*(a + b*x**n + c*x**(S(2)*n))**p, x), x)) rubi.add(rule158) pattern159 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda p: PositiveIntegerQ(p))) rule159 = ReplacementRule(pattern159, lambda n2, p, n, Pq, a, x, b, c : Int(ExpandIntegrand(Pq*(a + b*x**n + c*x**(S(2)*n))**p, x), x)) rubi.add(rule159) pattern160 = Pattern(Integral((a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1))*(d_ + x_**WC('n', S(1))*WC('e', S(1)) + x_**WC('n2', S(1))*WC('f', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda e, p, n, a, b, d: ZeroQ(a*e - b*d*(n*(p + S(1)) + S(1)))), CustomConstraint(lambda p, n, a, f, d, c: ZeroQ(a*f - c*d*(S(2)*n*(p + S(1)) + S(1))))) rule160 = ReplacementRule(pattern160, lambda n2, p, n, a, f, x, b, d, e, c : d*x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))/a) rubi.add(rule160) pattern161 = Pattern(Integral((d_ + x_**WC('n2', S(1))*WC('f', S(1)))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, p: ZeroQ(n*(p + S(1)) + S(1))), CustomConstraint(lambda f, a, d, c: ZeroQ(a*f + c*d))) rule161 = ReplacementRule(pattern161, lambda n2, p, n, a, f, x, b, d, c : d*x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))/a) rubi.add(rule161) pattern162 = Pattern(Integral((x_*WC('g', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1))*(d_ + x_**WC('n', S(1))*WC('e', S(1)) + x_**WC('n2', S(1))*WC('f', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda e, p, n, a, m, b, d: ZeroQ(a*e*(m + S(1)) - b*d*(m + n*(p + S(1)) + S(1)))), CustomConstraint(lambda p, n, a, f, m, d, c: ZeroQ(a*f*(m + S(1)) - c*d*(m + S(2)*n*(p + S(1)) + S(1)))), CustomConstraint(lambda m: NonzeroQ(m + S(1)))) rule162 = ReplacementRule(pattern162, lambda n2, p, n, a, g, f, x, m, b, d, e, c : d*(g*x)**(m + S(1))*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))/(a*g*(m + S(1)))) rubi.add(rule162) pattern163 = Pattern(Integral((x_*WC('g', S(1)))**WC('m', S(1))*(d_ + x_**WC('n2', S(1))*WC('f', S(1)))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, p, m: ZeroQ(m + n*(p + S(1)) + S(1))), CustomConstraint(lambda f, a, d, c: ZeroQ(a*f + c*d)), CustomConstraint(lambda m: NonzeroQ(m + S(1)))) rule163 = ReplacementRule(pattern163, lambda n2, p, n, a, g, f, x, m, b, d, c : d*(g*x)**(m + S(1))*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))/(a*g*(m + S(1)))) rubi.add(rule163) pattern164 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: ZeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: Not(IntegerQ(S(2)*p)))) rule164 = ReplacementRule(pattern164, lambda n2, p, n, Pq, a, x, m, b, d, c : (S(4)*c)**(-IntPart(p))*(b + S(2)*c*x**n)**(-S(2)*FracPart(p))*(a + b*x**n + c*x**(S(2)*n))**FracPart(p)*Int(Pq*(d*x)**m*(b + S(2)*c*x**n)**(S(2)*p), x)) rubi.add(rule164) pattern165 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: ZeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: Not(IntegerQ(S(2)*p)))) rule165 = ReplacementRule(pattern165, lambda n2, p, n, Pq, a, x, b, c : (S(4)*c)**(-IntPart(p))*(b + S(2)*c*x**n)**(-S(2)*FracPart(p))*(a + b*x**n + c*x**(S(2)*n))**FracPart(p)*Int(Pq*(b + S(2)*c*x**n)**(S(2)*p), x)) rubi.add(rule165) pattern166 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n))) rule166 = ReplacementRule(pattern166, lambda n2, p, n, Pq, a, x, m, b, c : Subst(Int(x**(S(-1) + (m + S(1))/n)*(a + b*x + c*x**S(2))**p*SubstFor(x**n, Pq, x), x), x, x**n)/n) rubi.add(rule166) pattern167 = Pattern(Integral(Pq_*(d_*x_)**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n))) rule167 = ReplacementRule(pattern167, lambda n2, p, n, Pq, a, x, m, b, d, c : x**(-m)*(d*x)**m*Int(Pq*x**m*(a + b*x**n + c*x**(S(2)*n))**p, x)) rubi.add(rule167) pattern168 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda Pq, x: ZeroQ(Coeff(Pq, x, S(0))))) rule168 = ReplacementRule(pattern168, lambda n2, p, n, Pq, a, x, m, b, d, c : Int((d*x)**(m + S(1))*(a + b*x**n + c*x**(S(2)*n))**p*ExpandToSum(Pq/x, x), x)/d) rubi.add(rule168) pattern169 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda Pq, x: ZeroQ(Coeff(Pq, x, S(0)))), CustomConstraint(lambda Pq: SumQ(Pq))) rule169 = ReplacementRule(pattern169, lambda n2, p, n, Pq, a, x, b, c : Int(x*(a + b*x**n + c*x**(S(2)*n))**p*ExpandToSum(Pq/x, x), x)) rubi.add(rule169) pattern170 = Pattern(Integral((a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1))*(d_ + x_**n_*WC('e', S(1)) + x_**WC('n2', S(1))*WC('f', S(1)) + x_**WC('n3', S(1))*WC('g', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p, n, a, g, b, d, e, c: ZeroQ(a**S(2)*g*(n + S(1)) - c*(a*e - b*d*(n*(p + S(1)) + S(1)))*(n*(S(2)*p + S(3)) + S(1)))), CustomConstraint(lambda e, p, n, a, f, b, d, c: ZeroQ(a**S(2)*f*(n + S(1)) - a*c*d*(n + S(1))*(S(2)*n*(p + S(1)) + S(1)) - b*(a*e - b*d*(n*(p + S(1)) + S(1)))*(n*(p + S(2)) + S(1))))) rule170 = ReplacementRule(pattern170, lambda n2, n3, p, n, a, g, f, x, b, d, e, c : x*(S(3)*a*d - x**S(2)*(-a*e + S(2)*b*d*p + S(3)*b*d))*(a + b*x**S(2) + c*x**S(4))**(p + S(1))/(S(3)*a**S(2))) rubi.add(rule170) pattern171 = Pattern(Integral((a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1))*(d_ + x_**WC('n2', S(1))*WC('f', S(1)) + x_**WC('n3', S(1))*WC('g', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p, n, a, g, b, d, c: ZeroQ(a**S(2)*g*(n + S(1)) + b*c*d*(n*(p + S(1)) + S(1))*(n*(S(2)*p + S(3)) + S(1)))), CustomConstraint(lambda p, n, a, f, b, d, c: ZeroQ(a**S(2)*f*(n + S(1)) - a*c*d*(n + S(1))*(S(2)*n*(p + S(1)) + S(1)) + b**S(2)*d*(n*(p + S(1)) + S(1))*(n*(p + S(2)) + S(1))))) rule171 = ReplacementRule(pattern171, lambda n2, n3, p, n, a, g, f, x, b, d, c : x*(S(3)*a*d - x**S(2)*(S(2)*b*d*p + S(3)*b*d))*(a + b*x**S(2) + c*x**S(4))**(p + S(1))/(S(3)*a**S(2))) rubi.add(rule171) pattern172 = Pattern(Integral((a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1))*(d_ + x_**n_*WC('e', S(1)) + x_**WC('n3', S(1))*WC('g', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p, n, a, g, b, d, e, c: ZeroQ(a**S(2)*g*(n + S(1)) - c*(a*e - b*d*(n*(p + S(1)) + S(1)))*(n*(S(2)*p + S(3)) + S(1)))), CustomConstraint(lambda e, p, n, a, b, d, c: ZeroQ(a*c*d*(n + S(1))*(S(2)*n*(p + S(1)) + S(1)) + b*(a*e - b*d*(n*(p + S(1)) + S(1)))*(n*(p + S(2)) + S(1))))) rule172 = ReplacementRule(pattern172, lambda n2, n3, p, c, n, a, x, b, d, e, g : x*(S(3)*a*d - x**S(2)*(-a*e + S(2)*b*d*p + S(3)*b*d))*(a + b*x**S(2) + c*x**S(4))**(p + S(1))/(S(3)*a**S(2))) rubi.add(rule172) pattern173 = Pattern(Integral((d_ + x_**WC('n3', S(1))*WC('g', S(1)))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p, n, a, g, b, d, c: ZeroQ(a**S(2)*g*(n + S(1)) + b*c*d*(n*(p + S(1)) + S(1))*(n*(S(2)*p + S(3)) + S(1)))), CustomConstraint(lambda p, n, a, b, d, c: ZeroQ(a*c*d*(n + S(1))*(S(2)*n*(p + S(1)) + S(1)) - b**S(2)*d*(n*(p + S(1)) + S(1))*(n*(p + S(2)) + S(1))))) rule173 = ReplacementRule(pattern173, lambda n2, n3, p, n, a, g, x, b, d, c : x*(S(3)*a*d - x**S(2)*(S(2)*b*d*p + S(3)*b*d))*(a + b*x**S(2) + c*x**S(4))**(p + S(1))/(S(3)*a**S(2))) rubi.add(rule173) pattern174 = Pattern(Integral(x_**WC('m', S(1))*(e_ + x_**WC('q', S(1))*WC('f', S(1)) + x_**WC('r', S(1))*WC('g', S(1)) + x_**WC('s', S(1))*WC('h', S(1)))/(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, q: ZeroQ(-n/S(2) + q)), CustomConstraint(lambda n, r: ZeroQ(-S(3)*n/S(2) + r)), CustomConstraint(lambda n, s: ZeroQ(-S(2)*n + s)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n, m: ZeroQ(S(2)*m - n + S(2))), CustomConstraint(lambda h, a, e, c: ZeroQ(a*h + c*e))) rule174 = ReplacementRule(pattern174, lambda n2, r, n, a, q, g, f, s, x, m, b, h, e, c : (-S(2)*c*x**n*(-b*g + S(2)*c*f) - S(2)*c*(-S(2)*a*g + b*f) - S(2)*h*x**(n/S(2))*(-S(4)*a*c + b**S(2)))/(c*n*(-S(4)*a*c + b**S(2))*sqrt(a + b*x**n + c*x**(S(2)*n)))) rubi.add(rule174) pattern175 = Pattern(Integral((d_*x_)**WC('m', S(1))*(e_ + x_**WC('q', S(1))*WC('f', S(1)) + x_**WC('r', S(1))*WC('g', S(1)) + x_**WC('s', S(1))*WC('h', S(1)))/(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, q: ZeroQ(-n/S(2) + q)), CustomConstraint(lambda n, r: ZeroQ(-S(3)*n/S(2) + r)), CustomConstraint(lambda n, s: ZeroQ(-S(2)*n + s)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n, m: ZeroQ(S(2)*m - n + S(2))), CustomConstraint(lambda h, a, e, c: ZeroQ(a*h + c*e))) rule175 = ReplacementRule(pattern175, lambda n2, r, e, n, a, q, g, f, s, x, m, b, h, d, c : x**(-m)*(d*x)**m*Int(x**m*(e + f*x**(n/S(2)) + g*x**(S(3)*n/S(2)) + h*x**(S(2)*n))/(a + b*x**n + c*x**(S(2)*n))**(S(3)/2), x)) rubi.add(rule175) pattern176 = Pattern(Integral(Pq_*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda b, n, Pq, a, i, x, p, q, c: Less(q, S(2)*n))) def With176(n2, p, n, Pq, a, x, b, c): q = Expon(Pq, x) i = Symbol('i') return -x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Sum(c*x**(i + n)*(-S(2)*a*Coeff(Pq, x, i + n) + b*Coeff(Pq, x, i)) + x**i*(-a*b*Coeff(Pq, x, i + n) + (-S(2)*a*c + b**S(2))*Coeff(Pq, x, i)), List(i, S(0), n + S(-1)))/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2))) + Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Sum(c*x**(i + n)*(-S(2)*a*Coeff(Pq, x, i + n) + b*Coeff(Pq, x, i))*(i + n*(S(2)*p + S(3)) + S(1)) + x**i*(-a*b*(i + S(1))*Coeff(Pq, x, i + n) + (-S(2)*a*c*(i + S(2)*n*(p + S(1)) + S(1)) + b**S(2)*(i + n*(p + S(1)) + S(1)))*Coeff(Pq, x, i)), List(i, S(0), n + S(-1))), x)/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2))) rule176 = ReplacementRule(pattern176, lambda n2, p, n, Pq, a, x, b, c : With176(n2, p, n, Pq, a, x, b, c)) rubi.add(rule176) pattern177 = Pattern(Integral((d_ + x_**S(4)*WC('g', S(1)) + x_**S(3)*WC('f', S(1)) + x_*WC('e', S(1)))/(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda g, a, d, c: ZeroQ(a*g + c*d))) rule177 = ReplacementRule(pattern177, lambda c, a, f, x, b, d, e, g : (-c*x**S(2)*(-b*f + S(2)*c*e) - c*(-S(2)*a*f + b*e) - g*x*(-S(4)*a*c + b**S(2)))/(c*(-S(4)*a*c + b**S(2))*sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule177) pattern178 = Pattern(Integral((d_ + x_**S(4)*WC('g', S(1)) + x_**S(3)*WC('f', S(1)))/(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda g, a, d, c: ZeroQ(a*g + c*d))) rule178 = ReplacementRule(pattern178, lambda c, a, f, x, b, d, g : (S(2)*a*c*f + b*c*f*x**S(2) - g*x*(-S(4)*a*c + b**S(2)))/(c*(-S(4)*a*c + b**S(2))*sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule178) pattern179 = Pattern(Integral((d_ + x_**S(4)*WC('g', S(1)) + x_*WC('e', S(1)))/(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda g, a, d, c: ZeroQ(a*g + c*d))) rule179 = ReplacementRule(pattern179, lambda c, a, x, b, d, e, g : (-b*c*e - S(2)*c**S(2)*e*x**S(2) - g*x*(-S(4)*a*c + b**S(2)))/(c*(-S(4)*a*c + b**S(2))*sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule179) pattern180 = Pattern(Integral(x_**S(2)*(x_**S(4)*WC('h', S(1)) + x_**S(2)*WC('g', S(1)) + x_*WC('f', S(1)) + WC('e', S(0)))/(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda h, a, e, c: ZeroQ(-S(3)*a*h + c*e)), CustomConstraint(lambda g, h, b, c: ZeroQ(-S(2)*b*h + c*g))) rule180 = ReplacementRule(pattern180, lambda c, a, f, x, b, h, e, g : (S(2)*a**S(2)*c*f + a*b*c*f*x**S(2) + a*h*x**S(3)*(-S(4)*a*c + b**S(2)))/(a*c*(-S(4)*a*c + b**S(2))*sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule180) pattern181 = Pattern(Integral(x_**S(2)*(x_**S(4)*WC('h', S(1)) + x_**S(2)*WC('g', S(1)) + WC('e', S(0)))/(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda h, a, e, c: ZeroQ(-S(3)*a*h + c*e)), CustomConstraint(lambda g, h, b, c: ZeroQ(-S(2)*b*h + c*g))) rule181 = ReplacementRule(pattern181, lambda c, a, x, b, h, e, g : h*x**S(3)/(c*sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule181) pattern182 = Pattern(Integral((d_ + x_**S(6)*WC('h', S(1)) + x_**S(4)*WC('g', S(1)) + x_**S(3)*WC('f', S(1)) + x_**S(2)*WC('e', S(1)))/(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda h, a, e, c: ZeroQ(-S(3)*a*h + c*e)), CustomConstraint(lambda a, g, b, d, e, c: ZeroQ(S(3)*a*g - S(2)*b*e + S(3)*c*d))) rule182 = ReplacementRule(pattern182, lambda c, a, f, x, b, d, h, e, g : (S(2)*a**S(2)*c*f + a*b*c*f*x**S(2) + a*h*x**S(3)*(-S(4)*a*c + b**S(2)) + c*d*x*(-S(4)*a*c + b**S(2)))/(a*c*(-S(4)*a*c + b**S(2))*sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule182) pattern183 = Pattern(Integral((d_ + x_**S(6)*WC('h', S(1)) + x_**S(3)*WC('f', S(1)) + x_**S(2)*WC('e', S(1)))/(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))**(S(3)/2), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda h, a, e, c: ZeroQ(-S(3)*a*h + c*e)), CustomConstraint(lambda b, e, d, c: ZeroQ(-S(2)*b*e + S(3)*c*d))) rule183 = ReplacementRule(pattern183, lambda a, f, x, b, d, h, e, c : (S(2)*a**S(2)*c*f + a*b*c*f*x**S(2) + a*h*x**S(3)*(-S(4)*a*c + b**S(2)) + c*d*x*(-S(4)*a*c + b**S(2)))/(a*c*(-S(4)*a*c + b**S(2))*sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule183) pattern184 = Pattern(Integral(Pq_*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda b, n, Q, Pq, a, i, x, p, q, c, R: GreaterEqual(q, S(2)*n))) def With184(n2, p, n, Pq, a, x, b, c): q = Expon(Pq, x) return Module(List(Set(Q, PolynomialQuotient(Pq*(b*c)**(Floor((q + S(-1))/n) + S(1)), a + b*x**n + c*x**(S(2)*n), x)), Set(R, PolynomialRemainder(Pq*(b*c)**(Floor((q + S(-1))/n) + S(1)), a + b*x**n + c*x**(S(2)*n), x)), i), -x*(b*c)**(-Floor((q + S(-1))/n) + S(-1))*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Sum(c*x**(i + n)*(-S(2)*a*Coeff(R, x, i + n) + b*Coeff(R, x, i)) + x**i*(-a*b*Coeff(R, x, i + n) + (-S(2)*a*c + b**S(2))*Coeff(R, x, i)), List(i, S(0), n + S(-1)))/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2))) + (b*c)**(-Floor((q + S(-1))/n) + S(-1))*Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*ExpandToSum(Q*a*n*(p + S(1))*(-S(4)*a*c + b**S(2)) + Sum(c*x**(i + n)*(-S(2)*a*Coeff(R, x, i + n) + b*Coeff(R, x, i))*(i + n*(S(2)*p + S(3)) + S(1)) + x**i*(-a*b*(i + S(1))*Coeff(R, x, i + n) + (-S(2)*a*c*(i + S(2)*n*(p + S(1)) + S(1)) + b**S(2)*(i + n*(p + S(1)) + S(1)))*Coeff(R, x, i)), List(i, S(0), n + S(-1))), x), x)/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rule184 = ReplacementRule(pattern184, lambda n2, p, n, Pq, a, x, b, c : With184(n2, p, n, Pq, a, x, b, c)) rubi.add(rule184) pattern185 = Pattern(Integral(Pq_*x_**m_*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda m: NegativeIntegerQ(m)), CustomConstraint(lambda b, n, Q, Pq, m, a, i, x, p, q, c, R: GreaterEqual(q, S(2)*n))) def With185(n2, p, n, Pq, a, x, m, b, c): q = Expon(Pq, x) return Module(List(Set(Q, PolynomialQuotient(Pq*a*x**m*(b*c)**(Floor((q + S(-1))/n) + S(1)), a + b*x**n + c*x**(S(2)*n), x)), Set(R, PolynomialRemainder(Pq*a*x**m*(b*c)**(Floor((q + S(-1))/n) + S(1)), a + b*x**n + c*x**(S(2)*n), x)), i), (b*c)**(-Floor((q + S(-1))/n) + S(-1))*Int(x**m*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*ExpandToSum(Q*n*x**(-m)*(p + S(1))*(-S(4)*a*c + b**S(2)) + Sum(c*x**(i - m + n)*(-S(2)*Coeff(R, x, i + n) + b*Coeff(R, x, i)/a)*(i + n*(S(2)*p + S(3)) + S(1)) + x**(i - m)*(-b*(i + S(1))*Coeff(R, x, i + n) + (-S(2)*c*(i + S(2)*n*(p + S(1)) + S(1)) + b**S(2)*(i + n*(p + S(1)) + S(1))/a)*Coeff(R, x, i)), List(i, S(0), n + S(-1))), x), x)/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2))) - x*(b*c)**(-Floor((q + S(-1))/n) + S(-1))*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Sum(c*x**(i + n)*(-S(2)*a*Coeff(R, x, i + n) + b*Coeff(R, x, i)) + x**i*(-a*b*Coeff(R, x, i + n) + (-S(2)*a*c + b**S(2))*Coeff(R, x, i)), List(i, S(0), n + S(-1)))/(a**S(2)*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rule185 = ReplacementRule(pattern185, lambda n2, p, n, Pq, a, x, m, b, c : With185(n2, p, n, Pq, a, x, m, b, c)) rubi.add(rule185) pattern186 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda m: IntegerQ(m)), CustomConstraint(lambda b, n, Pq, m, a, x, p, g, c: Unequal(g, S(1)))) def With186(n2, p, n, Pq, a, x, m, b, c): g = GCD(m + S(1), n) return Subst(Int(x**(S(-1) + (m + S(1))/g)*(a + b*x**(n/g) + c*x**(S(2)*n/g))**p*ReplaceAll(Pq, Rule(x, x**(1/g))), x), x, x**g)/g rule186 = ReplacementRule(pattern186, lambda n2, p, n, Pq, a, x, m, b, c : With186(n2, p, n, Pq, a, x, m, b, c)) rubi.add(rule186) pattern187 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))/(a_ + x_**n2_*WC('c', S(1)) + x_**WC('n', S(1))*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda b, a, c: NiceSqrtQ(-S(4)*a*c + b**S(2)))) rule187 = ReplacementRule(pattern187, lambda n2, n, Pq, a, x, m, b, d, c : Int(ExpandIntegrand(Pq*(d*x)**m/(a + b*x**n + c*x**(S(2)*n)), x), x)) rubi.add(rule187) pattern188 = Pattern(Integral(Pq_/(a_ + x_**n2_*WC('c', S(1)) + x_**WC('n', S(1))*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda n, Pq, a, x, b, c: Less(Expon(Pq, x), n) | NiceSqrtQ(-S(4)*a*c + b**S(2)))) rule188 = ReplacementRule(pattern188, lambda n2, n, Pq, a, x, b, c : Int(ExpandIntegrand(Pq/(a + b*x**n + c*x**(S(2)*n)), x), x)) rubi.add(rule188) pattern189 = Pattern(Integral(Pq_*(a_ + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda Pqq, b, Pq, a, x, p, q, c: Equal(S(2)*p + q + S(1), S(0)))) def With189(p, Pq, a, x, b, c): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), Pqq*c**p*log(a + b*x + c*x**S(2))/S(2) + Int((a + b*x + c*x**S(2))**p*ExpandToSum(S(2)*Pq - Pqq*c**p*(b + S(2)*c*x)*(a + b*x + c*x**S(2))**(-p + S(-1)), x), x)/S(2)) rule189 = ReplacementRule(pattern189, lambda p, Pq, a, x, b, c : With189(p, Pq, a, x, b, c)) rubi.add(rule189) pattern190 = Pattern(Integral(Pq_*(a_ + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)/2)), CustomConstraint(lambda c: PosQ(c)), CustomConstraint(lambda Pqq, b, Pq, a, x, p, q, c: Equal(S(2)*p + q + S(1), S(0)))) def With190(p, Pq, a, x, b, c): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), Pqq*c**p*atanh((b + S(2)*c*x)/(S(2)*sqrt(a + b*x + c*x**S(2))*Rt(c, S(2)))) + Int((a + b*x + c*x**S(2))**p*ExpandToSum(Pq - Pqq*c**(p + S(1)/2)*(a + b*x + c*x**S(2))**(-p + S(-1)/2), x), x)) rule190 = ReplacementRule(pattern190, lambda p, Pq, a, x, b, c : With190(p, Pq, a, x, b, c)) rubi.add(rule190) pattern191 = Pattern(Integral(Pq_*(a_ + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)/2)), CustomConstraint(lambda c: NegQ(c)), CustomConstraint(lambda Pqq, b, Pq, a, x, p, q, c: Equal(S(2)*p + q + S(1), S(0)))) def With191(p, Pq, a, x, b, c): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), -Pqq*(-c)**p*atan((b + S(2)*c*x)/(S(2)*sqrt(a + b*x + c*x**S(2))*Rt(-c, S(2)))) + Int((a + b*x + c*x**S(2))**p*ExpandToSum(Pq - Pqq*(-c)**(p + S(1)/2)*(a + b*x + c*x**S(2))**(-p + S(-1)/2), x), x)) rule191 = ReplacementRule(pattern191, lambda p, Pq, a, x, b, c : With191(p, Pq, a, x, b, c)) rubi.add(rule191) pattern192 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**n2_*WC('c', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda d, Pqq, b, n, Pq, m, a, x, p, q, c: GreaterEqual(q, S(2)*n) & Unequal(m + S(2)*n*p + q + S(1), S(0)) & (IntegerQ(S(2)*p) | (Equal(n, S(1)) & IntegerQ(S(4)*p)) | IntegerQ(p + (q + S(1))/(S(2)*n))))) def With192(n2, p, n, Pq, a, x, m, b, d, c): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), Pqq*d**(S(2)*n - q + S(-1))*(d*x)**(m - S(2)*n + q + S(1))*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))/(c*(m + S(2)*n*p + q + S(1))) + Int((d*x)**m*(a + b*x**n + c*x**(S(2)*n))**p*ExpandToSum(Pq - Pqq*x**q - Pqq*(a*x**(-S(2)*n + q)*(m - S(2)*n + q + S(1)) + b*x**(-n + q)*(m + n*(p + S(-1)) + q + S(1)))/(c*(m + S(2)*n*p + q + S(1))), x), x)) rule192 = ReplacementRule(pattern192, lambda n2, p, n, Pq, a, x, m, b, d, c : With192(n2, p, n, Pq, a, x, m, b, d, c)) rubi.add(rule192) pattern193 = Pattern(Integral(Pq_*(a_ + x_**n2_*WC('c', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda Pqq, b, n, Pq, a, x, p, q, c: GreaterEqual(q, S(2)*n) & Unequal(S(2)*n*p + q + S(1), S(0)) & (IntegerQ(S(2)*p) | (Equal(n, S(1)) & IntegerQ(S(4)*p)) | IntegerQ(p + (q + S(1))/(S(2)*n))))) def With193(n2, p, n, Pq, a, x, b, c): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), Pqq*x**(-S(2)*n + q + S(1))*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))/(c*(S(2)*n*p + q + S(1))) + Int((a + b*x**n + c*x**(S(2)*n))**p*ExpandToSum(Pq - Pqq*x**q - Pqq*(a*x**(-S(2)*n + q)*(-S(2)*n + q + S(1)) + b*x**(-n + q)*(n*(p + S(-1)) + q + S(1)))/(c*(S(2)*n*p + q + S(1))), x), x)) rule193 = ReplacementRule(pattern193, lambda n2, p, n, Pq, a, x, b, c : With193(n2, p, n, Pq, a, x, b, c)) rubi.add(rule193) pattern194 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda n, Pq, x: Not(PolyQ(Pq, x**n))), ) def With194(n2, p, n, Pq, a, x, m, b, d, c): q = Expon(Pq, x) j = Symbol('j') k = Symbol('k') return Int(Sum(d**(-j)*(d*x)**(j + m)*(a + b*x**n + c*x**(S(2)*n))**p*Sum(x**(k*n)*Coeff(Pq, x, j + k*n), List(k, S(0), S(1) + (-j + q)/n)), List(j, S(0), n + S(-1))), x) rule194 = ReplacementRule(pattern194, lambda n2, p, n, Pq, a, x, m, b, d, c : With194(n2, p, n, Pq, a, x, m, b, d, c)) rubi.add(rule194) pattern195 = Pattern(Integral(Pq_*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n)), CustomConstraint(lambda n, Pq, x: Not(PolyQ(Pq, x**n))), ) def With195(n2, p, n, Pq, a, x, b, c): q = Expon(Pq, x) j = Symbol('j') k = Symbol('k') return Int(Sum(x**j*(a + b*x**n + c*x**(S(2)*n))**p*Sum(x**(k*n)*Coeff(Pq, x, j + k*n), List(k, S(0), S(1) + (-j + q)/n)), List(j, S(0), n + S(-1))), x) rule195 = ReplacementRule(pattern195, lambda n2, p, n, Pq, a, x, b, c : With195(n2, p, n, Pq, a, x, b, c)) rubi.add(rule195) pattern196 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))/(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n))) rule196 = ReplacementRule(pattern196, lambda n2, n, Pq, a, x, m, b, d, c : Int(RationalFunctionExpand(Pq*(d*x)**m/(a + b*x**n + c*x**(S(2)*n)), x), x)) rubi.add(rule196) pattern197 = Pattern(Integral(Pq_/(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: PositiveIntegerQ(n))) rule197 = ReplacementRule(pattern197, lambda n2, n, Pq, a, x, b, c : Int(RationalFunctionExpand(Pq/(a + b*x**n + c*x**(S(2)*n)), x), x)) rubi.add(rule197) pattern198 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: NegativeIntegerQ(n)), CustomConstraint(lambda m: IntegerQ(m)), ) def With198(n2, p, n, Pq, a, x, m, b, c): q = Expon(Pq, x) return -Subst(Int(x**(-m - q + S(-2))*(a + b*x**(-n) + c*x**(-S(2)*n))**p*ExpandToSum(x**q*ReplaceAll(Pq, Rule(x, 1/x)), x), x), x, 1/x) rule198 = ReplacementRule(pattern198, lambda n2, p, n, Pq, a, x, m, b, c : With198(n2, p, n, Pq, a, x, m, b, c)) rubi.add(rule198) pattern199 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: NegativeIntegerQ(n)), CustomConstraint(lambda m: FractionQ(m)), ) def With199(n2, p, n, Pq, a, x, m, b, d, c): g = Denominator(m) q = Expon(Pq, x) return -g*Subst(Int(x**(-g*(m + q + S(1)) + S(-1))*(a + b*d**(-n)*x**(-g*n) + c*d**(-S(2)*n)*x**(-S(2)*g*n))**p*ExpandToSum(x**(g*q)*ReplaceAll(Pq, Rule(x, x**(-g)/d)), x), x), x, (d*x)**(-S(1)/g))/d rule199 = ReplacementRule(pattern199, lambda n2, p, n, Pq, a, x, m, b, d, c : With199(n2, p, n, Pq, a, x, m, b, d, c)) rubi.add(rule199) pattern200 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**m_*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: NegativeIntegerQ(n)), CustomConstraint(lambda m: Not(RationalQ(m))), ) def With200(n2, p, n, Pq, a, x, m, b, d, c): q = Expon(Pq, x) return -(d*x)**m*(1/x)**m*Subst(Int(x**(-m - q + S(-2))*(a + b*x**(-n) + c*x**(-S(2)*n))**p*ExpandToSum(x**q*ReplaceAll(Pq, Rule(x, 1/x)), x), x), x, 1/x) rule200 = ReplacementRule(pattern200, lambda n2, p, n, Pq, a, x, m, b, d, c : With200(n2, p, n, Pq, a, x, m, b, d, c)) rubi.add(rule200) pattern201 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: FractionQ(n)), ) def With201(n2, p, n, Pq, a, x, m, b, c): g = Denominator(n) return g*Subst(Int(x**(g*(m + S(1)) + S(-1))*(a + b*x**(g*n) + c*x**(S(2)*g*n))**p*ReplaceAll(Pq, Rule(x, x**g)), x), x, x**(1/g)) rule201 = ReplacementRule(pattern201, lambda n2, p, n, Pq, a, x, m, b, c : With201(n2, p, n, Pq, a, x, m, b, c)) rubi.add(rule201) pattern202 = Pattern(Integral(Pq_*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: FractionQ(n)), ) def With202(n2, p, n, Pq, a, x, b, c): g = Denominator(n) return g*Subst(Int(x**(g + S(-1))*(a + b*x**(g*n) + c*x**(S(2)*g*n))**p*ReplaceAll(Pq, Rule(x, x**g)), x), x, x**(1/g)) rule202 = ReplacementRule(pattern202, lambda n2, p, n, Pq, a, x, b, c : With202(n2, p, n, Pq, a, x, b, c)) rubi.add(rule202) pattern203 = Pattern(Integral(Pq_*(d_*x_)**m_*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: FractionQ(n)), CustomConstraint(lambda m: PositiveIntegerQ(m + S(1)/2))) rule203 = ReplacementRule(pattern203, lambda n2, p, n, Pq, a, x, m, b, d, c : d**(m + S(-1)/2)*sqrt(d*x)*Int(Pq*x**m*(a + b*x**n + c*x**(S(2)*n))**p, x)/sqrt(x)) rubi.add(rule203) pattern204 = Pattern(Integral(Pq_*(d_*x_)**m_*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: FractionQ(n)), CustomConstraint(lambda m: NegativeIntegerQ(m + S(-1)/2))) rule204 = ReplacementRule(pattern204, lambda n2, p, n, Pq, a, x, m, b, d, c : d**(m + S(1)/2)*sqrt(x)*Int(Pq*x**m*(a + b*x**n + c*x**(S(2)*n))**p, x)/sqrt(d*x)) rubi.add(rule204) pattern205 = Pattern(Integral(Pq_*(d_*x_)**m_*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n: FractionQ(n))) rule205 = ReplacementRule(pattern205, lambda n2, p, n, Pq, a, x, m, b, d, c : x**(-m)*(d*x)**m*Int(Pq*x**m*(a + b*x**n + c*x**(S(2)*n))**p, x)) rubi.add(rule205) pattern206 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule206 = ReplacementRule(pattern206, lambda n2, p, n, Pq, a, x, m, b, c : Subst(Int((a + b*x**(n/(m + S(1))) + c*x**(S(2)*n/(m + S(1))))**p*ReplaceAll(SubstFor(x**n, Pq, x), Rule(x, x**(n/(m + S(1))))), x), x, x**(m + S(1)))/(m + S(1))) rubi.add(rule206) pattern207 = Pattern(Integral(Pq_*(d_*x_)**m_*(a_ + x_**n_*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule207 = ReplacementRule(pattern207, lambda n2, p, n, Pq, a, x, m, b, d, c : x**(-m)*(d*x)**m*Int(Pq*x**m*(a + b*x**n + c*x**(S(2)*n))**p, x)) rubi.add(rule207) pattern208 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))/(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), ) def With208(n2, n, Pq, a, x, m, b, d, c): q = Rt(-S(4)*a*c + b**S(2), S(2)) return S(2)*c*Int(Pq*(d*x)**m/(b + S(2)*c*x**n - q), x)/q - S(2)*c*Int(Pq*(d*x)**m/(b + S(2)*c*x**n + q), x)/q rule208 = ReplacementRule(pattern208, lambda n2, n, Pq, a, x, m, b, d, c : With208(n2, n, Pq, a, x, m, b, d, c)) rubi.add(rule208) pattern209 = Pattern(Integral(Pq_/(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), ) def With209(n2, n, Pq, a, x, b, c): q = Rt(-S(4)*a*c + b**S(2), S(2)) return S(2)*c*Int(Pq/(b + S(2)*c*x**n - q), x)/q - S(2)*c*Int(Pq/(b + S(2)*c*x**n + q), x)/q rule209 = ReplacementRule(pattern209, lambda n2, n, Pq, a, x, b, c : With209(n2, n, Pq, a, x, b, c)) rubi.add(rule209) pattern210 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule210 = ReplacementRule(pattern210, lambda n2, p, n, Pq, a, x, m, b, d, c : Int(ExpandIntegrand(Pq*(d*x)**m*(a + b*x**n + c*x**(S(2)*n))**p, x), x)) rubi.add(rule210) pattern211 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule211 = ReplacementRule(pattern211, lambda n2, p, n, Pq, a, x, b, c : Int(ExpandIntegrand(Pq*(a + b*x**n + c*x**(S(2)*n))**p, x), x)) rubi.add(rule211) pattern212 = Pattern(Integral(Pq_*(x_*WC('d', S(1)))**WC('m', S(1))*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x) | PolyQ(Pq, x**n))) rule212 = ReplacementRule(pattern212, lambda n2, p, n, Pq, a, x, m, b, d, c : Int(Pq*(d*x)**m*(a + b*x**n + c*x**(S(2)*n))**p, x)) rubi.add(rule212) pattern213 = Pattern(Integral(Pq_*(a_ + x_**WC('n', S(1))*WC('b', S(1)) + x_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x) | PolyQ(Pq, x**n))) rule213 = ReplacementRule(pattern213, lambda n2, p, n, Pq, a, x, b, c : Int(Pq*(a + b*x**n + c*x**(S(2)*n))**p, x)) rubi.add(rule213) pattern214 = Pattern(Integral(Pq_*u_**WC('m', S(1))*(a_ + v_**n_*WC('b', S(1)) + v_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda v, x, u: LinearPairQ(u, v, x)), CustomConstraint(lambda n, Pq, v: PolyQ(Pq, v**n))) rule214 = ReplacementRule(pattern214, lambda n2, p, n, Pq, a, v, x, u, m, b, c : u**m*v**(-m)*Subst(Int(x**m*(a + b*x**n + c*x**(S(2)*n))**p*SubstFor(v, Pq, x), x), x, v)/Coefficient(v, x, S(1))) rubi.add(rule214) pattern215 = Pattern(Integral(Pq_*(a_ + v_**n_*WC('b', S(1)) + v_**WC('n2', S(1))*WC('c', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda v, x: LinearQ(v, x)), CustomConstraint(lambda n, Pq, v: PolyQ(Pq, v**n))) rule215 = ReplacementRule(pattern215, lambda n2, p, n, Pq, a, v, x, b, c : Subst(Int((a + b*x**n + c*x**(S(2)*n))**p*SubstFor(v, Pq, x), x), x, v)/Coefficient(v, x, S(1))) rubi.add(rule215) pattern216 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, p, j: ZeroQ(j*p + j - n + S(1)))) rule216 = ReplacementRule(pattern216, lambda p, n, a, x, j, b : x**(-n + S(1))*(a*x**j + b*x**n)**(p + S(1))/(b*(-j + n)*(p + S(1)))) rubi.add(rule216) pattern217 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, p, j: NegativeIntegerQ((j - n*p - n + S(-1))/(j - n))), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1)))) rule217 = ReplacementRule(pattern217, lambda p, n, a, x, j, b : -x**(-j + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(-j + n)*(p + S(1))) + (-j + n*p + n + S(1))*Int(x**(-j)*(a*x**j + b*x**n)**(p + S(1)), x)/(a*(-j + n)*(p + S(1)))) rubi.add(rule217) pattern218 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, p, j: NegativeIntegerQ((j - n*p - n + S(-1))/(j - n))), CustomConstraint(lambda p, j: NonzeroQ(j*p + S(1)))) rule218 = ReplacementRule(pattern218, lambda p, n, a, x, j, b : -b*(-j + n*p + n + S(1))*Int(x**(-j + n)*(a*x**j + b*x**n)**p, x)/(a*(j*p + S(1))) + x**(-j + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(j*p + S(1)))) rubi.add(rule218) pattern219 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, p, j: RationalQ(j, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda p: Greater(p, S(0))), CustomConstraint(lambda p, j: Less(j*p + S(1), S(0)))) rule219 = ReplacementRule(pattern219, lambda p, n, a, x, j, b : -b*p*(-j + n)*Int(x**n*(a*x**j + b*x**n)**(p + S(-1)), x)/(j*p + S(1)) + x*(a*x**j + b*x**n)**p/(j*p + S(1))) rubi.add(rule219) pattern220 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, p, j: RationalQ(j, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda p: Greater(p, S(0))), CustomConstraint(lambda n, p: NonzeroQ(n*p + S(1)))) rule220 = ReplacementRule(pattern220, lambda p, n, a, x, j, b : a*p*(-j + n)*Int(x**j*(a*x**j + b*x**n)**(p + S(-1)), x)/(n*p + S(1)) + x*(a*x**j + b*x**n)**p/(n*p + S(1))) rubi.add(rule220) pattern221 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, p, j: RationalQ(j, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda n, p, j: Greater(j*p + S(1), -j + n))) rule221 = ReplacementRule(pattern221, lambda p, n, a, x, j, b : x**(-n + S(1))*(a*x**j + b*x**n)**(p + S(1))/(b*(-j + n)*(p + S(1))) - (j*p + j - n + S(1))*Int(x**(-n)*(a*x**j + b*x**n)**(p + S(1)), x)/(b*(-j + n)*(p + S(1)))) rubi.add(rule221) pattern222 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, p, j: RationalQ(j, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda p: Less(p, S(-1)))) rule222 = ReplacementRule(pattern222, lambda p, n, a, x, j, b : -x**(-j + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(-j + n)*(p + S(1))) + (-j + n*p + n + S(1))*Int(x**(-j)*(a*x**j + b*x**n)**(p + S(1)), x)/(a*(-j + n)*(p + S(1)))) rubi.add(rule222) pattern223 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p: PositiveIntegerQ(p + S(1)/2)), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda p, j: ZeroQ(j*p + S(1)))) rule223 = ReplacementRule(pattern223, lambda p, n, a, x, j, b : a*Int(x**j*(a*x**j + b*x**n)**(p + S(-1)), x) + x*(a*x**j + b*x**n)**p/(p*(-j + n))) rubi.add(rule223) pattern224 = Pattern(Integral(1/sqrt(x_**S(2)*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n: NonzeroQ(n + S(-2)))) rule224 = ReplacementRule(pattern224, lambda n, b, a, x : S(2)*Subst(Int(1/(-a*x**S(2) + S(1)), x), x, x/sqrt(a*x**S(2) + b*x**n))/(-n + S(2))) rubi.add(rule224) pattern225 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)/2)), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda p, j: ZeroQ(j*p + S(1)))) rule225 = ReplacementRule(pattern225, lambda p, n, a, x, j, b : -x**(-j + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(-j + n)*(p + S(1))) + (-j + n*p + n + S(1))*Int(x**(-j)*(a*x**j + b*x**n)**(p + S(1)), x)/(a*(-j + n)*(p + S(1)))) rubi.add(rule225) pattern226 = Pattern(Integral(1/sqrt(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda n, j: RationalQ(j, n)), CustomConstraint(lambda n, j: Less(S(2)*n + S(-2), j, n))) rule226 = ReplacementRule(pattern226, lambda n, a, x, j, b : -a*(-j + S(2)*n + S(-2))*Int(x**(j - n)/sqrt(a*x**j + b*x**n), x)/(b*(n + S(-2))) - S(2)*x**(-n + S(1))*sqrt(a*x**j + b*x**n)/(b*(n + S(-2)))) rubi.add(rule226) pattern227 = Pattern(Integral((x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: PosQ(-j + n))) rule227 = ReplacementRule(pattern227, lambda p, n, a, x, j, b : x**(-j*FracPart(p))*(a + b*x**(-j + n))**(-FracPart(p))*(a*x**j + b*x**n)**FracPart(p)*Int(x**(j*p)*(a + b*x**(-j + n))**p, x)) rubi.add(rule227) pattern228 = Pattern(Integral((u_**WC('j', S(1))*WC('a', S(1)) + u_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: LinearQ(u, x)), CustomConstraint(lambda x, u: NonzeroQ(u - x))) rule228 = ReplacementRule(pattern228, lambda p, n, a, x, u, j, b : Subst(Int((a*x**j + b*x**n)**p, x), x, u)/Coefficient(u, x, S(1))) rubi.add(rule228) pattern229 = Pattern(Integral(x_**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: ZeroQ(m - n + S(1)))) rule229 = ReplacementRule(pattern229, lambda p, n, a, m, x, j, b : Subst(Int((a*x**(j/n) + b*x)**p, x), x, x**n)/n) rubi.add(rule229) pattern230 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, p, j, m: ZeroQ(-j + m + n*p + n + S(1))), CustomConstraint(lambda c, j: IntegerQ(j) | PositiveQ(c))) rule230 = ReplacementRule(pattern230, lambda p, j, n, a, x, m, b, c : -c**(j + S(-1))*(c*x)**(-j + m + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(-j + n)*(p + S(1)))) rubi.add(rule230) pattern231 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, p, j, m: NegativeIntegerQ((j - m - n*p - n + S(-1))/(j - n))), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda c, j: IntegerQ(j) | PositiveQ(c))) rule231 = ReplacementRule(pattern231, lambda p, j, n, a, x, m, b, c : c**j*(-j + m + n*p + n + S(1))*Int((c*x)**(-j + m)*(a*x**j + b*x**n)**(p + S(1)), x)/(a*(-j + n)*(p + S(1))) - c**(j + S(-1))*(c*x)**(-j + m + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(-j + n)*(p + S(1)))) rubi.add(rule231) pattern232 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, p, j, m: NegativeIntegerQ((j - m - n*p - n + S(-1))/(j - n))), CustomConstraint(lambda p, j, m: NonzeroQ(j*p + m + S(1))), CustomConstraint(lambda n, c, j: PositiveQ(c) | IntegersQ(j, n))) rule232 = ReplacementRule(pattern232, lambda p, j, n, a, x, m, b, c : -b*c**(j - n)*(-j + m + n*p + n + S(1))*Int((c*x)**(-j + m + n)*(a*x**j + b*x**n)**p, x)/(a*(j*p + m + S(1))) + c**(j + S(-1))*(c*x)**(-j + m + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(j*p + m + S(1)))) rubi.add(rule232) pattern233 = Pattern(Integral((c_*x_)**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, p, j, m: NegativeIntegerQ((j - m - n*p - n + S(-1))/(j - n)))) rule233 = ReplacementRule(pattern233, lambda p, n, a, m, x, j, b, c : c**IntPart(m)*x**(-FracPart(m))*(c*x)**FracPart(m)*Int(x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule233) pattern234 = Pattern(Integral(x_**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n)), CustomConstraint(lambda n: NonzeroQ(n**S(2) + S(-1)))) rule234 = ReplacementRule(pattern234, lambda p, n, a, m, x, j, b : Subst(Int(x**(S(-1) + (m + S(1))/n)*(a*x**(j/n) + b*x)**p, x), x, x**n)/n) rubi.add(rule234) pattern235 = Pattern(Integral((c_*x_)**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n)), CustomConstraint(lambda n: NonzeroQ(n**S(2) + S(-1)))) rule235 = ReplacementRule(pattern235, lambda p, n, a, m, x, j, b, c : c**IntPart(m)*x**(-FracPart(m))*(c*x)**FracPart(m)*Int(x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule235) pattern236 = Pattern(Integral((x_*WC('c', S(1)))**m_*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, m, p, j: RationalQ(j, m, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda n, c, j: PositiveQ(c) | IntegersQ(j, n)), CustomConstraint(lambda p: Greater(p, S(0))), CustomConstraint(lambda p, j, m: Less(j*p + m + S(1), S(0)))) rule236 = ReplacementRule(pattern236, lambda p, n, a, m, x, j, b, c : -b*c**(-n)*p*(-j + n)*Int((c*x)**(m + n)*(a*x**j + b*x**n)**(p + S(-1)), x)/(j*p + m + S(1)) + (c*x)**(m + S(1))*(a*x**j + b*x**n)**p/(c*(j*p + m + S(1)))) rubi.add(rule236) pattern237 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, p, j: RationalQ(j, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda n, c, j: PositiveQ(c) | IntegersQ(j, n)), CustomConstraint(lambda p: Greater(p, S(0))), CustomConstraint(lambda n, p, m: NonzeroQ(m + n*p + S(1)))) rule237 = ReplacementRule(pattern237, lambda p, j, n, a, x, m, b, c : a*c**(-j)*p*(-j + n)*Int((c*x)**(j + m)*(a*x**j + b*x**n)**(p + S(-1)), x)/(m + n*p + S(1)) + (c*x)**(m + S(1))*(a*x**j + b*x**n)**p/(c*(m + n*p + S(1)))) rubi.add(rule237) pattern238 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, m, p, j: RationalQ(j, m, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda n, c, j: PositiveQ(c) | IntegersQ(j, n)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda n, p, j, m: Greater(j*p + m + S(1), -j + n))) rule238 = ReplacementRule(pattern238, lambda p, j, n, a, x, m, b, c : -c**n*(j*p + j + m - n + S(1))*Int((c*x)**(m - n)*(a*x**j + b*x**n)**(p + S(1)), x)/(b*(-j + n)*(p + S(1))) + c**(n + S(-1))*(c*x)**(m - n + S(1))*(a*x**j + b*x**n)**(p + S(1))/(b*(-j + n)*(p + S(1)))) rubi.add(rule238) pattern239 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, p, j: RationalQ(j, n, p)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda n, c, j: PositiveQ(c) | IntegersQ(j, n)), CustomConstraint(lambda p: Less(p, S(-1)))) rule239 = ReplacementRule(pattern239, lambda p, j, n, a, x, m, b, c : c**j*(-j + m + n*p + n + S(1))*Int((c*x)**(-j + m)*(a*x**j + b*x**n)**(p + S(1)), x)/(a*(-j + n)*(p + S(1))) - c**(j + S(-1))*(c*x)**(-j + m + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(-j + n)*(p + S(1)))) rubi.add(rule239) pattern240 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: RationalQ(j, n)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda n, c, j: PositiveQ(c) | IntegersQ(j, n)), CustomConstraint(lambda n, p, j, m: PositiveQ(j*p + j + m - n + S(1))), CustomConstraint(lambda n, p, m: NonzeroQ(m + n*p + S(1)))) rule240 = ReplacementRule(pattern240, lambda p, j, n, a, x, m, b, c : -a*c**(-j + n)*(j*p + j + m - n + S(1))*Int((c*x)**(j + m - n)*(a*x**j + b*x**n)**p, x)/(b*(m + n*p + S(1))) + c**(n + S(-1))*(c*x)**(m - n + S(1))*(a*x**j + b*x**n)**(p + S(1))/(b*(m + n*p + S(1)))) rubi.add(rule240) pattern241 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: RationalQ(j, n)), CustomConstraint(lambda n, j: Less(S(0), j, n)), CustomConstraint(lambda n, c, j: PositiveQ(c) | IntegersQ(j, n)), CustomConstraint(lambda p, j, m: NegativeQ(j*p + m + S(1)))) rule241 = ReplacementRule(pattern241, lambda p, j, n, a, x, m, b, c : -b*c**(j - n)*(-j + m + n*p + n + S(1))*Int((c*x)**(-j + m + n)*(a*x**j + b*x**n)**p, x)/(a*(j*p + m + S(1))) + c**(j + S(-1))*(c*x)**(-j + m + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(j*p + m + S(1)))) rubi.add(rule241) pattern242 = Pattern(Integral(x_**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda m: NonzeroQ(m + S(1))), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule242 = ReplacementRule(pattern242, lambda p, n, a, m, x, j, b : Subst(Int((a*x**(j/(m + S(1))) + b*x**(n/(m + S(1))))**p, x), x, x**(m + S(1)))/(m + S(1))) rubi.add(rule242) pattern243 = Pattern(Integral((c_*x_)**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda m: NonzeroQ(m + S(1))), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule243 = ReplacementRule(pattern243, lambda p, n, a, m, x, j, b, c : c**IntPart(m)*x**(-FracPart(m))*(c*x)**FracPart(m)*Int(x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule243) pattern244 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p: PositiveIntegerQ(p + S(1)/2)), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda p, j, m: ZeroQ(j*p + m + S(1))), CustomConstraint(lambda c, j: IntegerQ(j) | PositiveQ(c))) rule244 = ReplacementRule(pattern244, lambda p, j, n, a, x, m, b, c : a*c**(-j)*Int((c*x)**(j + m)*(a*x**j + b*x**n)**(p + S(-1)), x) + (c*x)**(m + S(1))*(a*x**j + b*x**n)**p/(c*p*(-j + n))) rubi.add(rule244) pattern245 = Pattern(Integral(x_**WC('m', S(1))/sqrt(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda j, m: ZeroQ(-j/S(2) + m + S(1))), CustomConstraint(lambda n, j: NonzeroQ(-j + n))) rule245 = ReplacementRule(pattern245, lambda n, a, m, x, j, b : -S(2)*Subst(Int(1/(-a*x**S(2) + S(1)), x), x, x**(j/S(2))/sqrt(a*x**j + b*x**n))/(-j + n)) rubi.add(rule245) pattern246 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)/2)), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda p, j, m: ZeroQ(j*p + m + S(1))), CustomConstraint(lambda c, j: IntegerQ(j) | PositiveQ(c))) rule246 = ReplacementRule(pattern246, lambda p, j, n, a, x, m, b, c : c**j*(-j + m + n*p + n + S(1))*Int((c*x)**(-j + m)*(a*x**j + b*x**n)**(p + S(1)), x)/(a*(-j + n)*(p + S(1))) - c**(j + S(-1))*(c*x)**(-j + m + S(1))*(a*x**j + b*x**n)**(p + S(1))/(a*(-j + n)*(p + S(1)))) rubi.add(rule246) pattern247 = Pattern(Integral((c_*x_)**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: IntegerQ(p + S(1)/2)), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda p, j, m: ZeroQ(j*p + m + S(1)))) rule247 = ReplacementRule(pattern247, lambda p, n, a, m, x, j, b, c : c**IntPart(m)*x**(-FracPart(m))*(c*x)**FracPart(m)*Int(x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule247) pattern248 = Pattern(Integral((x_*WC('c', S(1)))**WC('m', S(1))*(x_**WC('j', S(1))*WC('a', S(1)) + x_**WC('n', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: PosQ(-j + n))) rule248 = ReplacementRule(pattern248, lambda p, j, n, a, x, m, b, c : c**IntPart(m)*x**(-j*FracPart(p) - FracPart(m))*(c*x)**FracPart(m)*(a + b*x**(-j + n))**(-FracPart(p))*(a*x**j + b*x**n)**FracPart(p)*Int(x**(j*p + m)*(a + b*x**(-j + n))**p, x)) rubi.add(rule248) pattern249 = Pattern(Integral(u_**WC('m', S(1))*(v_**WC('j', S(1))*WC('a', S(1)) + v_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda v, x, u: LinearPairQ(u, v, x))) rule249 = ReplacementRule(pattern249, lambda p, n, a, m, v, x, u, j, b : u**m*v**(-m)*Subst(Int(x**m*(a*x**j + b*x**n)**p, x), x, v)/Coefficient(v, x, S(1))) rubi.add(rule249) pattern250 = Pattern(Integral(x_**WC('m', S(1))*(c_ + x_**n_*WC('d', S(1)))**WC('q', S(1))*(x_**j_*WC('a', S(1)) + x_**WC('k', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda k, x: FreeQ(k, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda k, j: NonzeroQ(-j + k)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, k: IntegerQ(k/n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n)), CustomConstraint(lambda n: NonzeroQ(n**S(2) + S(-1)))) rule250 = ReplacementRule(pattern250, lambda p, j, n, a, k, q, x, m, b, d, c : Subst(Int(x**(S(-1) + (m + S(1))/n)*(c + d*x)**q*(a*x**(j/n) + b*x**(k/n))**p, x), x, x**n)/n) rubi.add(rule250) pattern251 = Pattern(Integral((e_*x_)**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('q', S(1))*(x_**j_*WC('a', S(1)) + x_**WC('k', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda k, x: FreeQ(k, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda k, j: NonzeroQ(-j + k)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, k: IntegerQ(k/n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n)), CustomConstraint(lambda n: NonzeroQ(n**S(2) + S(-1)))) rule251 = ReplacementRule(pattern251, lambda e, p, j, n, k, a, q, x, m, b, d, c : e**IntPart(m)*x**(-FracPart(m))*(e*x)**FracPart(m)*Int(x**m*(c + d*x**n)**q*(a*x**j + b*x**k)**p, x)) rubi.add(rule251) pattern252 = Pattern(Integral((x_*WC('e', S(1)))**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))*(x_**WC('jn', S(1))*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, jn, j: ZeroQ(jn - j - n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda p, n, a, m, j, b, d, c: ZeroQ(a*d*(j*p + m + S(1)) - b*c*(m + n + p*(j + n) + S(1)))), CustomConstraint(lambda e, j: IntegersQ(j) | PositiveQ(e)), CustomConstraint(lambda p, j, m: NonzeroQ(j*p + m + S(1)))) rule252 = ReplacementRule(pattern252, lambda p, n, a, m, jn, x, j, b, d, e, c : c*e**(j + S(-1))*(e*x)**(-j + m + S(1))*(a*x**j + b*x**(j + n))**(p + S(1))/(a*(j*p + m + S(1)))) rubi.add(rule252) pattern253 = Pattern(Integral((x_*WC('e', S(1)))**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))*(x_**WC('jn', S(1))*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n, jn, j: ZeroQ(jn - j - n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda m, p, j: RationalQ(j, m, p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda m, j: Inequality(S(0), Less, j, LessEqual, m)), CustomConstraint(lambda e, j: IntegerQ(j) | PositiveQ(e))) rule253 = ReplacementRule(pattern253, lambda p, n, a, m, jn, x, j, b, d, e, c : -e**j*(a*d*(j*p + m + S(1)) - b*c*(m + n + p*(j + n) + S(1)))*Int((e*x)**(-j + m)*(a*x**j + b*x**(j + n))**(p + S(1)), x)/(a*b*n*(p + S(1))) - e**(j + S(-1))*(e*x)**(-j + m + S(1))*(-a*d + b*c)*(a*x**j + b*x**(j + n))**(p + S(1))/(a*b*n*(p + S(1)))) rubi.add(rule253) pattern254 = Pattern(Integral((x_*WC('e', S(1)))**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))*(x_**WC('jn', S(1))*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, jn, j: ZeroQ(jn - j - n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda n, m: RationalQ(m, n)), CustomConstraint(lambda n: Greater(n, S(0))), CustomConstraint(lambda n, p, j, m: Less(j*p + m, S(-1)) | (Less(p, S(0)) & IntegersQ(m + S(-1)/2, p + S(-1)/2) & Less(m, -n*p + S(-1)))), CustomConstraint(lambda n, e, j: PositiveQ(e) | IntegersQ(j, n)), CustomConstraint(lambda p, j, m: NonzeroQ(j*p + m + S(1))), CustomConstraint(lambda n, p, j, m: NonzeroQ(j*p + m - n + S(1)))) rule254 = ReplacementRule(pattern254, lambda p, n, a, m, jn, x, j, b, d, e, c : c*e**(j + S(-1))*(e*x)**(-j + m + S(1))*(a*x**j + b*x**(j + n))**(p + S(1))/(a*(j*p + m + S(1))) + e**(-n)*(a*d*(j*p + m + S(1)) - b*c*(m + n + p*(j + n) + S(1)))*Int((e*x)**(m + n)*(a*x**j + b*x**(j + n))**p, x)/(a*(j*p + m + S(1)))) rubi.add(rule254) pattern255 = Pattern(Integral((x_*WC('e', S(1)))**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))*(x_**WC('jn', S(1))*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, jn, j: ZeroQ(jn - j - n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda n, p, j, m: NonzeroQ(m + n + p*(j + n) + S(1))), CustomConstraint(lambda e, j: IntegerQ(j) | PositiveQ(e))) rule255 = ReplacementRule(pattern255, lambda p, n, a, m, jn, x, j, b, d, e, c : d*e**(j + S(-1))*(e*x)**(-j + m + S(1))*(a*x**j + b*x**(j + n))**(p + S(1))/(b*(m + n + p*(j + n) + S(1))) - (a*d*(j*p + m + S(1)) - b*c*(m + n + p*(j + n) + S(1)))*Int((e*x)**m*(a*x**j + b*x**(j + n))**p, x)/(b*(m + n + p*(j + n) + S(1)))) rubi.add(rule255) pattern256 = Pattern(Integral(x_**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('q', S(1))*(x_**j_*WC('a', S(1)) + x_**WC('k', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda k, x: FreeQ(k, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda k, j: NonzeroQ(-j + k)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, k: IntegerQ(k/n)), CustomConstraint(lambda m: NonzeroQ(m + S(1))), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule256 = ReplacementRule(pattern256, lambda p, j, n, k, a, q, x, m, b, d, c : Subst(Int((c + d*x**(n/(m + S(1))))**q*(a*x**(j/(m + S(1))) + b*x**(k/(m + S(1))))**p, x), x, x**(m + S(1)))/(m + S(1))) rubi.add(rule256) pattern257 = Pattern(Integral((e_*x_)**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('q', S(1))*(x_**j_*WC('a', S(1)) + x_**WC('k', S(1))*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda k, x: FreeQ(k, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda k, j: NonzeroQ(-j + k)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, k: IntegerQ(k/n)), CustomConstraint(lambda m: NonzeroQ(m + S(1))), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule257 = ReplacementRule(pattern257, lambda e, p, j, n, k, a, q, x, m, b, d, c : e**IntPart(m)*x**(-FracPart(m))*(e*x)**FracPart(m)*Int(x**m*(c + d*x**n)**q*(a*x**j + b*x**k)**p, x)) rubi.add(rule257) pattern258 = Pattern(Integral((x_*WC('e', S(1)))**WC('m', S(1))*(c_ + x_**WC('n', S(1))*WC('d', S(1)))**WC('q', S(1))*(x_**WC('jn', S(1))*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda q, x: FreeQ(q, x)), CustomConstraint(lambda n, jn, j: ZeroQ(jn - j - n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda n, j: Not(ZeroQ(j + S(-1)) & ZeroQ(n + S(-1))))) rule258 = ReplacementRule(pattern258, lambda p, n, a, q, m, jn, x, j, b, d, e, c : e**IntPart(m)*x**(-j*FracPart(p) - FracPart(m))*(e*x)**FracPart(m)*(a + b*x**n)**(-FracPart(p))*(a*x**j + b*x**(j + n))**FracPart(p)*Int(x**(j*p + m)*(a + b*x**n)**p*(c + d*x**n)**q, x)) rubi.add(rule258) pattern259 = Pattern(Integral(Pq_*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: RationalQ(j, n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n: Less(S(-1), n, S(1))), ) def With259(p, n, Pq, a, x, j, b): d = Denominator(n) return d*Subst(Int(x**(d + S(-1))*(a*x**(d*j) + b*x**(d*n))**p*ReplaceAll(SubstFor(x**n, Pq, x), Rule(x, x**(d*n))), x), x, x**(1/d)) rule259 = ReplacementRule(pattern259, lambda p, n, Pq, a, x, j, b : With259(p, n, Pq, a, x, j, b)) rubi.add(rule259) pattern260 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n))) rule260 = ReplacementRule(pattern260, lambda p, n, Pq, a, m, x, j, b : Subst(Int(x**(S(-1) + (m + S(1))/n)*(a*x**(j/n) + b*x)**p*SubstFor(x**n, Pq, x), x), x, x**n)/n) rubi.add(rule260) pattern261 = Pattern(Integral(Pq_*(c_*x_)**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n)), CustomConstraint(lambda m: RationalQ(m)), CustomConstraint(lambda m: Greater(m**S(2), S(1)))) rule261 = ReplacementRule(pattern261, lambda p, n, Pq, a, m, x, j, b, c : c**(Quotient(m, sign(m))*sign(m))*x**(-Mod(m, sign(m)))*(c*x)**Mod(m, sign(m))*Int(Pq*x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule261) pattern262 = Pattern(Integral(Pq_*(c_*x_)**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n))) rule262 = ReplacementRule(pattern262, lambda p, n, Pq, a, m, x, j, b, c : x**(-m)*(c*x)**m*Int(Pq*x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule262) pattern263 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: PositiveIntegerQ(j, n, j/n)), CustomConstraint(lambda m: IntegerQ(m)), CustomConstraint(lambda b, n, Pq, m, j, a, x, p, g: Unequal(g, S(1)))) def With263(p, n, Pq, a, m, x, j, b): g = GCD(m + S(1), n) return Subst(Int(x**(S(-1) + (m + S(1))/g)*(a*x**(j/g) + b*x**(n/g))**p*ReplaceAll(Pq, Rule(x, x**(1/g))), x), x, x**g)/g rule263 = ReplacementRule(pattern263, lambda p, n, Pq, a, m, x, j, b : With263(p, n, Pq, a, m, x, j, b)) rubi.add(rule263) pattern264 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda Pq, x: PolyQ(Pq, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: PositiveIntegerQ(j, n)), CustomConstraint(lambda n, j: Less(j, n)), CustomConstraint(lambda Pqq, b, n, Pq, m, j, a, x, p, q, c: Greater(q, n + S(-1)) & Unequal(m + n*p + q + S(1), S(0)) & (IntegerQ(S(2)*p) | IntegerQ(p + (q + S(1))/(S(2)*n))))) def With264(p, j, n, Pq, a, x, m, b, c): q = Expon(Pq, x) return With(List(Set(Pqq, Coeff(Pq, x, q))), Pqq*c**(n - q + S(-1))*(c*x)**(m - n + q + S(1))*(a*x**j + b*x**n)**(p + S(1))/(b*(m + n*p + q + S(1))) + Int((c*x)**m*(a*x**j + b*x**n)**p*ExpandToSum(Pq - Pqq*a*x**(-n + q)*(m - n + q + S(1))/(b*(m + n*p + q + S(1))) - Pqq*x**q, x), x)) rule264 = ReplacementRule(pattern264, lambda p, j, n, Pq, a, x, m, b, c : With264(p, j, n, Pq, a, x, m, b, c)) rubi.add(rule264) pattern265 = Pattern(Integral(Pq_*x_**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule265 = ReplacementRule(pattern265, lambda p, n, Pq, a, m, x, j, b : Subst(Int((a*x**(j/(m + S(1))) + b*x**(n/(m + S(1))))**p*ReplaceAll(SubstFor(x**n, Pq, x), Rule(x, x**(n/(m + S(1))))), x), x, x**(m + S(1)))/(m + S(1))) rubi.add(rule265) pattern266 = Pattern(Integral(Pq_*(c_*x_)**m_*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n))), CustomConstraint(lambda m: RationalQ(m)), CustomConstraint(lambda m: Greater(m**S(2), S(1)))) rule266 = ReplacementRule(pattern266, lambda p, n, Pq, a, m, x, j, b, c : c**(Quotient(m, sign(m))*sign(m))*x**(-Mod(m, sign(m)))*(c*x)**Mod(m, sign(m))*Int(Pq*x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule266) pattern267 = Pattern(Integral(Pq_*(c_*x_)**m_*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n)), CustomConstraint(lambda n, j: IntegerQ(j/n)), CustomConstraint(lambda n, m: IntegerQ(n/(m + S(1)))), CustomConstraint(lambda n: Not(IntegerQ(n)))) rule267 = ReplacementRule(pattern267, lambda p, n, Pq, a, m, x, j, b, c : x**(-m)*(c*x)**m*Int(Pq*x**m*(a*x**j + b*x**n)**p, x)) rubi.add(rule267) pattern268 = Pattern(Integral(Pq_*(x_*WC('c', S(1)))**WC('m', S(1))*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x) | PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n))) rule268 = ReplacementRule(pattern268, lambda p, j, n, Pq, a, x, m, b, c : Int(ExpandIntegrand(Pq*(c*x)**m*(a*x**j + b*x**n)**p, x), x)) rubi.add(rule268) pattern269 = Pattern(Integral(Pq_*(x_**n_*WC('b', S(1)) + x_**WC('j', S(1))*WC('a', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda n, Pq, x: PolyQ(Pq, x) | PolyQ(Pq, x**n)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda n, j: NonzeroQ(-j + n))) rule269 = ReplacementRule(pattern269, lambda p, n, Pq, a, x, j, b : Int(ExpandIntegrand(Pq*(a*x**j + b*x**n)**p, x), x)) rubi.add(rule269) pattern270 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, a, d: ZeroQ(S(27)*a**S(2)*d + S(4)*b**S(3)))) rule270 = ReplacementRule(pattern270, lambda p, a, x, b, d : S(3)**(-S(3)*p)*a**(-S(2)*p)*Int((S(3)*a - b*x)**p*(S(3)*a + S(2)*b*x)**(S(2)*p), x)) rubi.add(rule270) pattern271 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: PositiveIntegerQ(p)), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3)))) rule271 = ReplacementRule(pattern271, lambda p, a, x, b, d : Int(ExpandToSum((a + b*x + d*x**S(3))**p, x), x)) rubi.add(rule271) pattern272 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), CustomConstraint(lambda x, p, u: ProductQ(NonfreeFactors(u, x)))) def With272(p, a, x, b, d): u = Factor(a + b*x + d*x**S(3)) return FreeFactors(u, x)**p*Int(DistributeDegree(NonfreeFactors(u, x), p), x) rule272 = ReplacementRule(pattern272, lambda p, a, x, b, d : With272(p, a, x, b, d)) rubi.add(rule272) pattern273 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), ) def With273(p, a, x, b, d): r = Rt(-S(27)*a*d**S(2) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*b**S(3)*d), S(3)) return S(3)**(-S(3)*p)*d**(-S(2)*p)*Int((-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d - S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p, x) rule273 = ReplacementRule(pattern273, lambda p, a, x, b, d : With273(p, a, x, b, d)) rubi.add(rule273) pattern274 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d: ZeroQ(S(27)*a**S(2)*d + S(4)*b**S(3)))) rule274 = ReplacementRule(pattern274, lambda p, a, x, b, d : (S(3)*a - b*x)**(-p)*(S(3)*a + S(2)*b*x)**(-S(2)*p)*(a + b*x + d*x**S(3))**p*Int((S(3)*a - b*x)**p*(S(3)*a + S(2)*b*x)**(S(2)*p), x)) rubi.add(rule274) pattern275 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), CustomConstraint(lambda d, a, b, x, p, u: ProductQ(u))) def With275(p, a, x, b, d): u = NonfreeFactors(Factor(a + b*x + d*x**S(3)), x) return (a + b*x + d*x**S(3))**p*Int(DistributeDegree(u, p), x)/DistributeDegree(u, p) rule275 = ReplacementRule(pattern275, lambda p, a, x, b, d : With275(p, a, x, b, d)) rubi.add(rule275) pattern276 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), ) def With276(p, a, x, b, d): r = Rt(-S(27)*a*d**S(2) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*b**S(3)*d), S(3)) return (-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d - S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**(-p)*(a + b*x + d*x**S(3))**p*Int((-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d - S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p, x) rule276 = ReplacementRule(pattern276, lambda p, a, x, b, d : With276(p, a, x, b, d)) rubi.add(rule276) pattern277 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, a, d: ZeroQ(S(27)*a**S(2)*d + S(4)*b**S(3)))) rule277 = ReplacementRule(pattern277, lambda p, a, f, x, m, b, d, e : S(3)**(-S(3)*p)*a**(-S(2)*p)*Int((S(3)*a - b*x)**p*(S(3)*a + S(2)*b*x)**(S(2)*p)*(e + f*x)**m, x)) rubi.add(rule277) pattern278 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: PositiveIntegerQ(p)), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3)))) rule278 = ReplacementRule(pattern278, lambda p, a, f, x, m, b, d, e : Int(ExpandIntegrand((e + f*x)**m*(a + b*x + d*x**S(3))**p, x), x)) rubi.add(rule278) pattern279 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), CustomConstraint(lambda f, e, x, p, u, m: ProductQ(NonfreeFactors(u, x)))) def With279(p, a, f, x, m, b, d, e): u = Factor(a + b*x + d*x**S(3)) return FreeFactors(u, x)**p*Int((e + f*x)**m*DistributeDegree(NonfreeFactors(u, x), p), x) rule279 = ReplacementRule(pattern279, lambda p, a, f, x, m, b, d, e : With279(p, a, f, x, m, b, d, e)) rubi.add(rule279) pattern280 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), ) def With280(p, a, f, x, m, b, d, e): r = Rt(-S(27)*a*d**S(2) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*b**S(3)*d), S(3)) return S(3)**(-S(3)*p)*d**(-S(2)*p)*Int((e + f*x)**m*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d - S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p, x) rule280 = ReplacementRule(pattern280, lambda p, a, f, x, m, b, d, e : With280(p, a, f, x, m, b, d, e)) rubi.add(rule280) pattern281 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d: ZeroQ(S(27)*a**S(2)*d + S(4)*b**S(3)))) rule281 = ReplacementRule(pattern281, lambda p, a, f, x, m, b, d, e : (S(3)*a - b*x)**(-p)*(S(3)*a + S(2)*b*x)**(-S(2)*p)*(a + b*x + d*x**S(3))**p*Int((S(3)*a - b*x)**p*(S(3)*a + S(2)*b*x)**(S(2)*p)*(e + f*x)**m, x)) rubi.add(rule281) pattern282 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), CustomConstraint(lambda f, d, b, m, e, a, x, p, u: ProductQ(u))) def With282(p, a, f, x, m, b, d, e): u = NonfreeFactors(Factor(a + b*x + d*x**S(3)), x) return (a + b*x + d*x**S(3))**p*Int((e + f*x)**m*DistributeDegree(u, p), x)/DistributeDegree(u, p) rule282 = ReplacementRule(pattern282, lambda p, a, f, x, m, b, d, e : With282(p, a, f, x, m, b, d, e)) rubi.add(rule282) pattern283 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, a, d: NonzeroQ(S(27)*a**S(2)*d + S(4)*b**S(3))), ) def With283(p, a, f, x, m, b, d, e): r = Rt(-S(27)*a*d**S(2) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*b**S(3)*d), S(3)) return (-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d - S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**(-p)*(a + b*x + d*x**S(3))**p*Int((e + f*x)**m*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(-S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) - S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(S(3)*d*x + S(2)**(S(1)/3)*(S(6)*b*d - S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p, x) rule283 = ReplacementRule(pattern283, lambda p, a, f, x, m, b, d, e : With283(p, a, f, x, m, b, d, e)) rubi.add(rule283) pattern284 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda a, d, c: ZeroQ(S(27)*a*d**S(2) + S(4)*c**S(3)))) rule284 = ReplacementRule(pattern284, lambda p, a, x, d, c : -S(3)**(-S(3)*p)*d**(-S(2)*p)*Int((c - S(3)*d*x)**p*(S(2)*c + S(3)*d*x)**(S(2)*p), x)) rubi.add(rule284) pattern285 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: PositiveIntegerQ(p)), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3)))) rule285 = ReplacementRule(pattern285, lambda p, a, x, d, c : Int(ExpandToSum((a + c*x**S(2) + d*x**S(3))**p, x), x)) rubi.add(rule285) pattern286 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), CustomConstraint(lambda x, p, u: ProductQ(NonfreeFactors(u, x)))) def With286(p, a, x, d, c): u = Factor(a + c*x**S(2) + d*x**S(3)) return FreeFactors(u, x)**p*Int(DistributeDegree(NonfreeFactors(u, x), p), x) rule286 = ReplacementRule(pattern286, lambda p, a, x, d, c : With286(p, a, x, d, c)) rubi.add(rule286) pattern287 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), ) def With287(p, a, x, d, c): r = Rt(-S(27)*a*d**S(2) - S(2)*c**S(3) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*a*c**S(3)), S(3)) return S(3)**(-S(3)*p)*d**(-S(2)*p)*Int((c + S(3)*d*x - S(2)**(S(1)/3)*(S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p, x) rule287 = ReplacementRule(pattern287, lambda p, a, x, d, c : With287(p, a, x, d, c)) rubi.add(rule287) pattern288 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda a, d, c: ZeroQ(S(27)*a*d**S(2) + S(4)*c**S(3)))) rule288 = ReplacementRule(pattern288, lambda p, a, x, d, c : (c - S(3)*d*x)**(-p)*(S(2)*c + S(3)*d*x)**(-S(2)*p)*(a + c*x**S(2) + d*x**S(3))**p*Int((c - S(3)*d*x)**p*(S(2)*c + S(3)*d*x)**(S(2)*p), x)) rubi.add(rule288) pattern289 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), CustomConstraint(lambda d, a, x, p, c, u: ProductQ(u))) def With289(p, a, x, d, c): u = NonfreeFactors(Factor(a + c*x**S(2) + d*x**S(3)), x) return (a + c*x**S(2) + d*x**S(3))**p*Int(DistributeDegree(u, p), x)/DistributeDegree(u, p) rule289 = ReplacementRule(pattern289, lambda p, a, x, d, c : With289(p, a, x, d, c)) rubi.add(rule289) pattern290 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), ) def With290(p, a, x, d, c): r = Rt(-S(27)*a*d**S(2) - S(2)*c**S(3) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*a*c**S(3)), S(3)) return (a + c*x**S(2) + d*x**S(3))**p*(c + S(3)*d*x - S(2)**(S(1)/3)*(S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*Int((c + S(3)*d*x - S(2)**(S(1)/3)*(S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p, x) rule290 = ReplacementRule(pattern290, lambda p, a, x, d, c : With290(p, a, x, d, c)) rubi.add(rule290) pattern291 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda a, d, c: ZeroQ(S(27)*a*d**S(2) + S(4)*c**S(3)))) rule291 = ReplacementRule(pattern291, lambda p, a, f, x, m, d, e, c : -S(3)**(-S(3)*p)*d**(-S(2)*p)*Int((c - S(3)*d*x)**p*(S(2)*c + S(3)*d*x)**(S(2)*p)*(e + f*x)**m, x)) rubi.add(rule291) pattern292 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: PositiveIntegerQ(p)), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3)))) rule292 = ReplacementRule(pattern292, lambda p, a, f, x, m, d, e, c : Int(ExpandIntegrand((e + f*x)**m*(a + c*x**S(2) + d*x**S(3))**p, x), x)) rubi.add(rule292) pattern293 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), CustomConstraint(lambda f, e, x, p, u, m: ProductQ(NonfreeFactors(u, x)))) def With293(p, a, f, x, m, d, e, c): u = Factor(a + c*x**S(2) + d*x**S(3)) return FreeFactors(u, x)**p*Int((e + f*x)**m*DistributeDegree(NonfreeFactors(u, x), p), x) rule293 = ReplacementRule(pattern293, lambda p, a, f, x, m, d, e, c : With293(p, a, f, x, m, d, e, c)) rubi.add(rule293) pattern294 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), ) def With294(p, a, f, x, m, d, e, c): r = Rt(-S(27)*a*d**S(2) - S(2)*c**S(3) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*a*c**S(3)), S(3)) return S(3)**(-S(3)*p)*d**(-S(2)*p)*Int((e + f*x)**m*(c + S(3)*d*x - S(2)**(S(1)/3)*(S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p, x) rule294 = ReplacementRule(pattern294, lambda p, a, f, x, m, d, e, c : With294(p, a, f, x, m, d, e, c)) rubi.add(rule294) pattern295 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda a, d, c: ZeroQ(S(27)*a*d**S(2) + S(4)*c**S(3)))) rule295 = ReplacementRule(pattern295, lambda p, a, f, x, m, d, e, c : (c - S(3)*d*x)**(-p)*(S(2)*c + S(3)*d*x)**(-S(2)*p)*(a + c*x**S(2) + d*x**S(3))**p*Int((c - S(3)*d*x)**p*(S(2)*c + S(3)*d*x)**(S(2)*p)*(e + f*x)**m, x)) rubi.add(rule295) pattern296 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), CustomConstraint(lambda f, d, m, e, a, x, p, c, u: ProductQ(u))) def With296(p, a, f, x, m, d, e, c): u = NonfreeFactors(Factor(a + c*x**S(2) + d*x**S(3)), x) return (a + c*x**S(2) + d*x**S(3))**p*Int((e + f*x)**m*DistributeDegree(u, p), x)/DistributeDegree(u, p) rule296 = ReplacementRule(pattern296, lambda p, a, f, x, m, d, e, c : With296(p, a, f, x, m, d, e, c)) rubi.add(rule296) pattern297 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda a, d, c: NonzeroQ(S(27)*a*d**S(2) + S(4)*c**S(3))), ) def With297(p, a, f, x, m, d, e, c): r = Rt(-S(27)*a*d**S(2) - S(2)*c**S(3) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) + S(4)*a*c**S(3)), S(3)) return (a + c*x**S(2) + d*x**S(3))**p*(c + S(3)*d*x - S(2)**(S(1)/3)*(S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*Int((e + f*x)**m*(c + S(3)*d*x - S(2)**(S(1)/3)*(S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)**(S(1)/3)*r**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p, x) rule297 = ReplacementRule(pattern297, lambda p, a, f, x, m, d, e, c : With297(p, a, f, x, m, d, e, c)) rubi.add(rule297) pattern298 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2)))) rule298 = ReplacementRule(pattern298, lambda p, a, x, b, d, c : S(3)**(-p)*b**(-p)*c**(-p)*Int((b + c*x)**(S(3)*p), x)) rubi.add(rule298) pattern299 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2)))) rule299 = ReplacementRule(pattern299, lambda p, a, x, b, d, c : S(3)**(-p)*b**(-p)*c**(-p)*Subst(Int((S(3)*a*b*c - b**S(3) + c**S(3)*x**S(3))**p, x), x, c/(S(3)*d) + x)) rubi.add(rule299) pattern300 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2))), ) def With300(p, a, x, b, d, c): r = Rt(-S(3)*b*c*d + c**S(3), S(3)) return S(3)**(-p)*b**(-p)*c**(-p)*Int((b + x*(c - r))**p*(b + x*(c + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p*(b + x*(c + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p, x) rule300 = ReplacementRule(pattern300, lambda p, a, x, b, d, c : With300(p, a, x, b, d, c)) rubi.add(rule300) pattern301 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: PositiveIntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2)))) rule301 = ReplacementRule(pattern301, lambda p, a, x, b, d, c : Int(ExpandToSum((a + b*x + c*x**S(2) + d*x**S(3))**p, x), x)) rubi.add(rule301) pattern302 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), CustomConstraint(lambda x, p, u: ProductQ(NonfreeFactors(u, x)))) def With302(p, a, x, b, d, c): u = Factor(a + b*x + c*x**S(2) + d*x**S(3)) return FreeFactors(u, x)**p*Int(DistributeDegree(NonfreeFactors(u, x), p), x) rule302 = ReplacementRule(pattern302, lambda p, a, x, b, d, c : With302(p, a, x, b, d, c)) rubi.add(rule302) pattern303 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2)))) rule303 = ReplacementRule(pattern303, lambda p, a, x, b, d, c : S(3)**(-S(3)*p)*d**(-S(2)*p)*Subst(Int((S(27)*a*d**S(2) - S(9)*b*c*d + S(2)*c**S(3) + S(27)*d**S(3)*x**S(3) - S(9)*d*x*(-S(3)*b*d + c**S(2)))**p, x), x, c/(S(3)*d) + x)) rubi.add(rule303) pattern304 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2)))) rule304 = ReplacementRule(pattern304, lambda p, a, x, b, d, c : (b + c*x)**(-S(3)*p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((b + c*x)**(S(3)*p), x)) rubi.add(rule304) pattern305 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), ) def With305(p, a, x, b, d, c): r = Rt(-S(3)*a*b*c + b**S(3), S(3)) return (b + c*x - r)**(-p)*(b + c*x + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2))**(-p)*(b + c*x + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2))**(-p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((b + c*x - r)**p*(b + c*x + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2))**p*(b + c*x + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2))**p, x) rule305 = ReplacementRule(pattern305, lambda p, a, x, b, d, c : With305(p, a, x, b, d, c)) rubi.add(rule305) pattern306 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2))), ) def With306(p, a, x, b, d, c): r = Rt(-S(3)*b*c*d + c**S(3), S(3)) return (b + x*(c - r))**(-p)*(b + x*(c + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2)))**(-p)*(b + x*(c + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2)))**(-p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((b + x*(c - r))**p*(b + x*(c + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p*(b + x*(c + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p, x) rule306 = ReplacementRule(pattern306, lambda p, a, x, b, d, c : With306(p, a, x, b, d, c)) rubi.add(rule306) pattern307 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), CustomConstraint(lambda d, a, b, x, p, c, u: ProductQ(u))) def With307(p, a, x, b, d, c): u = NonfreeFactors(Factor(a + b*x + c*x**S(2) + d*x**S(3)), x) return (a + b*x + c*x**S(2) + d*x**S(3))**p*Int(DistributeDegree(u, p), x)/DistributeDegree(u, p) rule307 = ReplacementRule(pattern307, lambda p, a, x, b, d, c : With307(p, a, x, b, d, c)) rubi.add(rule307) pattern308 = Pattern(Integral((x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), ) def With308(p, a, x, b, d, c): r = Rt(-S(27)*a*d**S(2) + S(9)*b*c*d - S(2)*c**S(3) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) - S(18)*a*b*c*d + S(4)*a*c**S(3) + S(4)*b**S(3)*d - b**S(2)*c**S(2)), S(3)) return (c + S(3)*d*x - S(2)**(S(1)/3)*(-S(6)*b*d + S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(-ImaginaryI + sqrt(S(3))) - S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(-S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(ImaginaryI + sqrt(S(3))) - S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((c + S(3)*d*x - S(2)**(S(1)/3)*(-S(6)*b*d + S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(-ImaginaryI + sqrt(S(3))) - S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(-S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(ImaginaryI + sqrt(S(3))) - S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p, x) rule308 = ReplacementRule(pattern308, lambda p, a, x, b, d, c : With308(p, a, x, b, d, c)) rubi.add(rule308) pattern309 = Pattern(Integral(u_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: PolyQ(u, x, S(3))), CustomConstraint(lambda x, u: Not(CubicMatchQ(u, x)))) rule309 = ReplacementRule(pattern309, lambda p, x, u : Int(ExpandToSum(u, x)**p, x)) rubi.add(rule309) pattern310 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2)))) rule310 = ReplacementRule(pattern310, lambda p, a, f, x, m, b, d, e, c : S(3)**(-p)*b**(-p)*c**(-p)*Int((b + c*x)**(S(3)*p)*(e + f*x)**m, x)) rubi.add(rule310) pattern311 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), ) def With311(p, a, f, x, m, b, d, e, c): r = Rt(-S(3)*a*b*c + b**S(3), S(3)) return S(3)**(-p)*b**(-p)*c**(-p)*Int((e + f*x)**m*(b + c*x - r)**p*(b + c*x + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2))**p*(b + c*x + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2))**p, x) rule311 = ReplacementRule(pattern311, lambda p, a, f, x, m, b, d, e, c : With311(p, a, f, x, m, b, d, e, c)) rubi.add(rule311) pattern312 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: IntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2))), ) def With312(p, a, f, x, m, b, d, e, c): r = Rt(-S(3)*b*c*d + c**S(3), S(3)) return S(3)**(-p)*b**(-p)*c**(-p)*Int((b + x*(c - r))**p*(b + x*(c + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p*(b + x*(c + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p*(e + f*x)**m, x) rule312 = ReplacementRule(pattern312, lambda p, a, f, x, m, b, d, e, c : With312(p, a, f, x, m, b, d, e, c)) rubi.add(rule312) pattern313 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: PositiveIntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2)))) rule313 = ReplacementRule(pattern313, lambda p, a, f, x, m, b, d, e, c : Int(ExpandIntegrand((e + f*x)**m*(a + b*x + c*x**S(2) + d*x**S(3))**p, x), x)) rubi.add(rule313) pattern314 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), CustomConstraint(lambda f, e, x, p, u, m: ProductQ(NonfreeFactors(u, x)))) def With314(p, a, f, x, m, b, d, e, c): u = Factor(a + b*x + c*x**S(2) + d*x**S(3)) return FreeFactors(u, x)**p*Int((e + f*x)**m*DistributeDegree(NonfreeFactors(u, x), p), x) rule314 = ReplacementRule(pattern314, lambda p, a, f, x, m, b, d, e, c : With314(p, a, f, x, m, b, d, e, c)) rubi.add(rule314) pattern315 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p: NegativeIntegerQ(p)), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2)))) rule315 = ReplacementRule(pattern315, lambda p, a, f, x, m, b, d, e, c : S(3)**(-S(3)*p)*d**(-S(2)*p)*Subst(Int((S(27)*a*d**S(2) - S(9)*b*c*d + S(2)*c**S(3) + S(27)*d**S(3)*x**S(3) - S(9)*d*x*(-S(3)*b*d + c**S(2)))**p, x), x, c/(S(3)*d) + x)) rubi.add(rule315) pattern316 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2)))) rule316 = ReplacementRule(pattern316, lambda p, a, f, x, m, b, d, e, c : (b + c*x)**(-S(3)*p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((b + c*x)**(S(3)*p)*(e + f*x)**m, x)) rubi.add(rule316) pattern317 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: ZeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), ) def With317(p, a, f, x, m, b, d, e, c): r = Rt(-S(3)*a*b*c + b**S(3), S(3)) return (b + c*x - r)**(-p)*(b + c*x + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2))**(-p)*(b + c*x + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2))**(-p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((e + f*x)**m*(b + c*x - r)**p*(b + c*x + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2))**p*(b + c*x + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2))**p, x) rule317 = ReplacementRule(pattern317, lambda p, a, f, x, m, b, d, e, c : With317(p, a, f, x, m, b, d, e, c)) rubi.add(rule317) pattern318 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: ZeroQ(-S(3)*a*c + b**S(2))), ) def With318(p, a, f, x, m, b, d, e, c): r = Rt(-S(3)*b*c*d + c**S(3), S(3)) return (b + x*(c - r))**(-p)*(b + x*(c + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2)))**(-p)*(b + x*(c + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2)))**(-p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((b + x*(c - r))**p*(b + x*(c + r*(-sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p*(b + x*(c + r*(sqrt(S(3))*ImaginaryI + S(1))/S(2)))**p*(e + f*x)**m, x) rule318 = ReplacementRule(pattern318, lambda p, a, f, x, m, b, d, e, c : With318(p, a, f, x, m, b, d, e, c)) rubi.add(rule318) pattern319 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), CustomConstraint(lambda f, d, b, m, e, a, x, p, c, u: ProductQ(u))) def With319(p, a, f, x, m, b, d, e, c): u = NonfreeFactors(Factor(a + b*x + c*x**S(2) + d*x**S(3)), x) return (a + b*x + c*x**S(2) + d*x**S(3))**p*Int((e + f*x)**m*DistributeDegree(u, p), x)/DistributeDegree(u, p) rule319 = ReplacementRule(pattern319, lambda p, a, f, x, m, b, d, e, c : With319(p, a, f, x, m, b, d, e, c)) rubi.add(rule319) pattern320 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))**WC('m', S(1))*(x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda p: Not(IntegerQ(p))), CustomConstraint(lambda b, d, c: NonzeroQ(-S(3)*b*d + c**S(2))), CustomConstraint(lambda b, a, c: NonzeroQ(-S(3)*a*c + b**S(2))), ) def With320(p, a, f, x, m, b, d, e, c): r = Rt(-S(27)*a*d**S(2) + S(9)*b*c*d - S(2)*c**S(3) + S(3)*sqrt(S(3))*d*sqrt(S(27)*a**S(2)*d**S(2) - S(18)*a*b*c*d + S(4)*a*c**S(3) + S(4)*b**S(3)*d - b**S(2)*c**S(2)), S(3)) return (c + S(3)*d*x - S(2)**(S(1)/3)*(-S(6)*b*d + S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(-ImaginaryI + sqrt(S(3))) - S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(c + S(3)*d*x + S(2)**(S(1)/3)*(-S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(ImaginaryI + sqrt(S(3))) - S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**(-p)*(a + b*x + c*x**S(2) + d*x**S(3))**p*Int((e + f*x)**m*(c + S(3)*d*x - S(2)**(S(1)/3)*(-S(6)*b*d + S(2)*c**S(2) + S(2)**(S(1)/3)*r**S(2))/(S(2)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(-ImaginaryI + sqrt(S(3))) - S(6)*b*d*(-sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(-sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p*(c + S(3)*d*x + S(2)**(S(1)/3)*(-S(2)**(S(1)/3)*ImaginaryI*r**S(2)*(ImaginaryI + sqrt(S(3))) - S(6)*b*d*(sqrt(S(3))*ImaginaryI + S(1)) + S(2)*c**S(2)*(sqrt(S(3))*ImaginaryI + S(1)))/(S(4)*r))**p, x) rule320 = ReplacementRule(pattern320, lambda p, a, f, x, m, b, d, e, c : With320(p, a, f, x, m, b, d, e, c)) rubi.add(rule320) pattern321 = Pattern(Integral(u_**WC('m', S(1))*v_**WC('p', S(1)), x_), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: LinearQ(u, x)), CustomConstraint(lambda v, x: PolyQ(v, x, S(3))), CustomConstraint(lambda v, x, u: Not(CubicMatchQ(v, x) & LinearMatchQ(u, x)))) rule321 = ReplacementRule(pattern321, lambda p, v, x, u, m : Int(ExpandToSum(u, x)**m*ExpandToSum(v, x)**p, x)) rubi.add(rule321) pattern322 = Pattern(Integral((f_ + x_**S(2)*WC('g', S(1)))/((d_ + x_**S(2)*WC('d', S(1)) + x_*WC('e', S(1)))*sqrt(a_ + x_**S(4)*WC('a', S(1)) + x_**S(3)*WC('b', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, e, a, d: ZeroQ(-a*e + b*d)), CustomConstraint(lambda f, g: ZeroQ(f + g)), CustomConstraint(lambda a, c: PosQ(a**S(2)*(S(2)*a - c)))) rule322 = ReplacementRule(pattern322, lambda e, a, g, f, x, b, d, c : a*f*atan((a*b*x**S(2) + a*b + x*(S(4)*a**S(2) - S(2)*a*c + b**S(2)))/(S(2)*sqrt(a*x**S(4) + a + b*x**S(3) + b*x + c*x**S(2))*Rt(a**S(2)*(S(2)*a - c), S(2))))/(d*Rt(a**S(2)*(S(2)*a - c), S(2)))) rubi.add(rule322) pattern323 = Pattern(Integral((f_ + x_**S(2)*WC('g', S(1)))/((d_ + x_**S(2)*WC('d', S(1)) + x_*WC('e', S(1)))*sqrt(a_ + x_**S(4)*WC('a', S(1)) + x_**S(3)*WC('b', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda b, e, a, d: ZeroQ(-a*e + b*d)), CustomConstraint(lambda f, g: ZeroQ(f + g)), CustomConstraint(lambda a, c: NegQ(a**S(2)*(S(2)*a - c)))) rule323 = ReplacementRule(pattern323, lambda e, a, g, f, x, b, d, c : -a*f*atanh((a*b*x**S(2) + a*b + x*(S(4)*a**S(2) - S(2)*a*c + b**S(2)))/(S(2)*sqrt(a*x**S(4) + a + b*x**S(3) + b*x + c*x**S(2))*Rt(-a**S(2)*(S(2)*a - c), S(2))))/(d*Rt(-a**S(2)*(S(2)*a - c), S(2)))) rubi.add(rule323) pattern324 = Pattern(Integral((x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda b, e, d, c: ZeroQ(S(8)*b*e**S(2) - S(4)*c*d*e + d**S(3))), CustomConstraint(lambda p: UnsameQ(p, S(2))), CustomConstraint(lambda p: UnsameQ(p, S(3)))) rule324 = ReplacementRule(pattern324, lambda p, a, x, b, d, e, c : Subst(Int(SimplifyIntegrand((a - b*d/(S(8)*e) + d**S(4)/(S(256)*e**S(3)) + e*x**S(4) + x**S(2)*(c - S(3)*d**S(2)/(S(8)*e)))**p, x), x), x, d/(S(4)*e) + x)) rubi.add(rule324) pattern325 = Pattern(Integral(v_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda v, x: PolynomialQ(v, x)), CustomConstraint(lambda v, x: Equal(Exponent(v, x), S(4))), CustomConstraint(lambda p: UnsameQ(p, S(2))), CustomConstraint(lambda p: UnsameQ(p, S(3))), CustomConstraint(lambda e, a, d, b, x, p, c: NonzeroQ(d) & ZeroQ(S(8)*b*e**S(2) - S(4)*c*d*e + d**S(3)))) def With325(v, p, x): a = Coefficient(v, x, S(0)) b = Coefficient(v, x, S(1)) c = Coefficient(v, x, S(2)) d = Coefficient(v, x, S(3)) e = Coefficient(v, x, S(4)) return Subst(Int(SimplifyIntegrand((a - b*d/(S(8)*e) + d**S(4)/(S(256)*e**S(3)) + e*x**S(4) + x**S(2)*(c - S(3)*d**S(2)/(S(8)*e)))**p, x), x), x, d/(S(4)*e) + x) rule325 = ReplacementRule(pattern325, lambda v, p, x : With325(v, p, x)) rubi.add(rule325) pattern326 = Pattern(Integral(u_*(x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: PolynomialQ(u, x)), CustomConstraint(lambda b, e, d, c: ZeroQ(S(8)*b*e**S(2) - S(4)*c*d*e + d**S(3))), CustomConstraint(lambda p: Not(PositiveIntegerQ(p)))) rule326 = ReplacementRule(pattern326, lambda p, a, x, u, b, d, e, c : Subst(Int(SimplifyIntegrand((a - b*d/(S(8)*e) + d**S(4)/(S(256)*e**S(3)) + e*x**S(4) + x**S(2)*(c - S(3)*d**S(2)/(S(8)*e)))**p*ReplaceAll(u, Rule(x, -d/(S(4)*e) + x)), x), x), x, d/(S(4)*e) + x)) rubi.add(rule326) pattern327 = Pattern(Integral(u_*v_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda x, u: PolynomialQ(u, x)), CustomConstraint(lambda v, x: PolynomialQ(v, x)), CustomConstraint(lambda v, x: Equal(Exponent(v, x), S(4))), CustomConstraint(lambda p: Not(PositiveIntegerQ(p))), CustomConstraint(lambda d, b, e, a, x, p, c, u: NonzeroQ(d) & ZeroQ(S(8)*b*e**S(2) - S(4)*c*d*e + d**S(3)))) def With327(v, p, x, u): a = Coefficient(v, x, S(0)) b = Coefficient(v, x, S(1)) c = Coefficient(v, x, S(2)) d = Coefficient(v, x, S(3)) e = Coefficient(v, x, S(4)) return Subst(Int(SimplifyIntegrand((a - b*d/(S(8)*e) + d**S(4)/(S(256)*e**S(3)) + e*x**S(4) + x**S(2)*(c - S(3)*d**S(2)/(S(8)*e)))**p*ReplaceAll(u, Rule(x, -d/(S(4)*e) + x)), x), x), x, d/(S(4)*e) + x) rule327 = ReplacementRule(pattern327, lambda v, p, x, u : With327(v, p, x, u)) rubi.add(rule327) pattern328 = Pattern(Integral((a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda b, a, d, c: ZeroQ(S(8)*a**S(2)*d - S(4)*a*b*c + b**S(3))), CustomConstraint(lambda p: IntegerQ(S(2)*p))) rule328 = ReplacementRule(pattern328, lambda p, a, x, b, d, e, c : -S(16)*a**S(2)*Subst(Int((a*(S(256)*a**S(4)*x**S(4) + S(256)*a**S(3)*e - S(64)*a**S(2)*b*d - S(32)*a**S(2)*x**S(2)*(-S(8)*a*c + S(3)*b**S(2)) + S(16)*a*b**S(2)*c - S(3)*b**S(4))/(-S(4)*a*x + b)**S(4))**p/(-S(4)*a*x + b)**S(2), x), x, 1/x + b/(S(4)*a))) rubi.add(rule328) pattern329 = Pattern(Integral(v_**p_, x_), CustomConstraint(lambda p, x: FreeQ(p, x)), CustomConstraint(lambda v, x: PolynomialQ(v, x)), CustomConstraint(lambda v, x: Equal(Exponent(v, x), S(4))), CustomConstraint(lambda p: IntegerQ(S(2)*p)), CustomConstraint(lambda d, e, a, b, x, p, c: NonzeroQ(a) & NonzeroQ(b) & ZeroQ(S(8)*a**S(2)*d - S(4)*a*b*c + b**S(3)))) def With329(v, p, x): a = Coefficient(v, x, S(0)) b = Coefficient(v, x, S(1)) c = Coefficient(v, x, S(2)) d = Coefficient(v, x, S(3)) e = Coefficient(v, x, S(4)) return -S(16)*a**S(2)*Subst(Int((a*(S(256)*a**S(4)*x**S(4) + S(256)*a**S(3)*e - S(64)*a**S(2)*b*d - S(32)*a**S(2)*x**S(2)*(-S(8)*a*c + S(3)*b**S(2)) + S(16)*a*b**S(2)*c - S(3)*b**S(4))/(-S(4)*a*x + b)**S(4))**p/(-S(4)*a*x + b)**S(2), x), x, 1/x + b/(S(4)*a)) rule329 = ReplacementRule(pattern329, lambda v, p, x : With329(v, p, x)) rubi.add(rule329) pattern330 = Pattern(Integral((x_**S(3)*WC('D', S(1)) + x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda D, x: FreeQ(D, x)), CustomConstraint(lambda b, d: ZeroQ(-b + d)), CustomConstraint(lambda a, e: ZeroQ(-a + e)), CustomConstraint(lambda b, a, x, c: SumQ(Factor(a*x**S(4) + a + b*x**S(3) + b*x + c*x**S(2)))), ) def With330(e, a, C, x, A, B, D, d, b, c): q = sqrt(S(8)*a**S(2) - S(4)*a*c + b**S(2)) return -Int((A*b - A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a - S(2)*C*a + D*b - D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b - q)), x)/q + Int((A*b + A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a - S(2)*C*a + D*b + D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b + q)), x)/q rule330 = ReplacementRule(pattern330, lambda e, a, C, x, A, B, D, d, b, c : With330(e, a, C, x, A, B, D, d, b, c)) rubi.add(rule330) pattern331 = Pattern(Integral((x_**S(3)*WC('D', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda D, x: FreeQ(D, x)), CustomConstraint(lambda b, d: ZeroQ(-b + d)), CustomConstraint(lambda a, e: ZeroQ(-a + e)), CustomConstraint(lambda b, a, x, c: SumQ(Factor(a*x**S(4) + a + b*x**S(3) + b*x + c*x**S(2)))), ) def With331(e, a, x, A, B, D, d, b, c): q = sqrt(S(8)*a**S(2) - S(4)*a*c + b**S(2)) return -Int((A*b - A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a + D*b - D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b - q)), x)/q + Int((A*b + A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a + D*b + D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b + q)), x)/q rule331 = ReplacementRule(pattern331, lambda e, a, x, A, B, D, d, b, c : With331(e, a, x, A, B, D, d, b, c)) rubi.add(rule331) pattern332 = Pattern(Integral(x_**WC('m', S(1))*(x_**S(3)*WC('D', S(1)) + x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda D, x: FreeQ(D, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda b, d: ZeroQ(-b + d)), CustomConstraint(lambda a, e: ZeroQ(-a + e)), CustomConstraint(lambda b, a, x, c: SumQ(Factor(a*x**S(4) + a + b*x**S(3) + b*x + c*x**S(2)))), ) def With332(e, a, C, m, x, A, B, D, d, b, c): q = sqrt(S(8)*a**S(2) - S(4)*a*c + b**S(2)) return -Int(x**m*(A*b - A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a - S(2)*C*a + D*b - D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b - q)), x)/q + Int(x**m*(A*b + A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a - S(2)*C*a + D*b + D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b + q)), x)/q rule332 = ReplacementRule(pattern332, lambda e, a, C, m, x, A, B, D, d, b, c : With332(e, a, C, m, x, A, B, D, d, b, c)) rubi.add(rule332) pattern333 = Pattern(Integral(x_**WC('m', S(1))*(x_**S(3)*WC('D', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda D, x: FreeQ(D, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda b, d: ZeroQ(-b + d)), CustomConstraint(lambda a, e: ZeroQ(-a + e)), CustomConstraint(lambda b, a, x, c: SumQ(Factor(a*x**S(4) + a + b*x**S(3) + b*x + c*x**S(2)))), ) def With333(e, a, m, x, A, B, D, d, b, c): q = sqrt(S(8)*a**S(2) - S(4)*a*c + b**S(2)) return -Int(x**m*(A*b - A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a + D*b - D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b - q)), x)/q + Int(x**m*(A*b + A*q - S(2)*B*a + S(2)*D*a + x*(S(2)*A*a + D*b + D*q))/(S(2)*a*x**S(2) + S(2)*a + x*(b + q)), x)/q rule333 = ReplacementRule(pattern333, lambda e, a, m, x, A, B, D, d, b, c : With333(e, a, m, x, A, B, D, d, b, c)) rubi.add(rule333) pattern334 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda e, C, A, B, b, d, c: ZeroQ(B**S(2)*d - S(2)*B*(S(2)*A*e + C*c) + S(2)*C*(A*d + C*b))), CustomConstraint(lambda e, a, C, A, B, d, c: ZeroQ(-S(4)*A*B*C*d + S(4)*A*e*(S(2)*A*C + B**S(2)) - B**S(3)*d + S(2)*B**S(2)*C*c - S(8)*C**S(3)*a)), CustomConstraint(lambda e, C, A, B, d, c: PosQ(C*(C*(-S(4)*c*e + d**S(2)) + S(2)*e*(-S(4)*A*e + B*d)))), ) def With334(e, a, C, x, A, B, b, d, c): q = Rt(C*(C*(-S(4)*c*e + d**S(2)) + S(2)*e*(-S(4)*A*e + B*d)), S(2)) return -S(2)*C**S(2)*atanh((-B*e + C*d + S(2)*C*e*x)/q)/q + S(2)*C**S(2)*atanh(C*(S(12)*A*B*e - S(4)*A*C*d - S(3)*B**S(2)*d + S(4)*B*C*c + S(8)*C**S(2)*e*x**S(3) + S(4)*C*x**S(2)*(-B*e + S(2)*C*d) + S(4)*C*x*(S(2)*A*e - B*d + S(2)*C*c))/(q*(-S(4)*A*C + B**S(2))))/q rule334 = ReplacementRule(pattern334, lambda e, a, C, x, A, B, b, d, c : With334(e, a, C, x, A, B, b, d, c)) rubi.add(rule334) pattern335 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, d, A, C: ZeroQ(A*d + C*b)), CustomConstraint(lambda a, e, A, C: ZeroQ(-A**S(2)*e + C**S(2)*a)), CustomConstraint(lambda e, C, A, d, c: PosQ(C*(-S(8)*A*e**S(2) + C*(-S(4)*c*e + d**S(2))))), ) def With335(e, a, C, x, A, b, d, c): q = Rt(C*(-S(8)*A*e**S(2) + C*(-S(4)*c*e + d**S(2))), S(2)) return -S(2)*C**S(2)*atanh(C*(d + S(2)*e*x)/q)/q + S(2)*C**S(2)*atanh(C*(A*d - S(2)*C*d*x**S(2) - S(2)*C*e*x**S(3) - S(2)*x*(A*e + C*c))/(A*q))/q rule335 = ReplacementRule(pattern335, lambda e, a, C, x, A, b, d, c : With335(e, a, C, x, A, b, d, c)) rubi.add(rule335) pattern336 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda e, C, A, B, b, d, c: ZeroQ(B**S(2)*d - S(2)*B*(S(2)*A*e + C*c) + S(2)*C*(A*d + C*b))), CustomConstraint(lambda e, a, C, A, B, d, c: ZeroQ(-S(4)*A*B*C*d + S(4)*A*e*(S(2)*A*C + B**S(2)) - B**S(3)*d + S(2)*B**S(2)*C*c - S(8)*C**S(3)*a)), CustomConstraint(lambda e, C, A, B, d, c: NegQ(C*(C*(-S(4)*c*e + d**S(2)) + S(2)*e*(-S(4)*A*e + B*d)))), ) def With336(e, a, C, x, A, B, b, d, c): q = Rt(-C*(C*(-S(4)*c*e + d**S(2)) + S(2)*e*(-S(4)*A*e + B*d)), S(2)) return S(2)*C**S(2)*atan((-B*e + C*d + S(2)*C*e*x)/q)/q - S(2)*C**S(2)*atan(C*(S(12)*A*B*e - S(4)*A*C*d - S(3)*B**S(2)*d + S(4)*B*C*c + S(8)*C**S(2)*e*x**S(3) + S(4)*C*x**S(2)*(-B*e + S(2)*C*d) + S(4)*C*x*(S(2)*A*e - B*d + S(2)*C*c))/(q*(-S(4)*A*C + B**S(2))))/q rule336 = ReplacementRule(pattern336, lambda e, a, C, x, A, B, b, d, c : With336(e, a, C, x, A, B, b, d, c)) rubi.add(rule336) pattern337 = Pattern(Integral((x_**S(2)*WC('C', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda b, d, A, C: ZeroQ(A*d + C*b)), CustomConstraint(lambda a, e, A, C: ZeroQ(-A**S(2)*e + C**S(2)*a)), CustomConstraint(lambda e, C, A, d, c: NegQ(C*(-S(8)*A*e**S(2) + C*(-S(4)*c*e + d**S(2))))), ) def With337(e, a, C, x, A, b, d, c): q = Rt(-C*(-S(8)*A*e**S(2) + C*(-S(4)*c*e + d**S(2))), S(2)) return S(2)*C**S(2)*atan((C*d + S(2)*C*e*x)/q)/q + S(2)*C**S(2)*atan(C*(-A*d + S(2)*C*d*x**S(2) + S(2)*C*e*x**S(3) + S(2)*x*(A*e + C*c))/(A*q))/q rule337 = ReplacementRule(pattern337, lambda e, a, C, x, A, b, d, c : With337(e, a, C, x, A, b, d, c)) rubi.add(rule337) pattern338 = Pattern(Integral((x_**S(3)*WC('D', S(1)) + x_**S(2)*WC('C', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda C, x: FreeQ(C, x)), CustomConstraint(lambda D, x: FreeQ(D, x)), CustomConstraint(lambda b, C, A, B, D, d, e, c: ZeroQ(S(4)*d*(-S(2)*B*e + D*c)**S(2) - S(4)*(-S(2)*B*e + D*c)*(-S(8)*A*e**S(2) - S(4)*C*c*e + S(2)*D*b*e + S(3)*D*c*d) + S(8)*(-S(4)*C*e + S(3)*D*d)*(-A*d*e - C*b*e + D*b*d))), CustomConstraint(lambda b, a, C, A, B, D, d, e, c: ZeroQ(S(8)*a*(-S(4)*C*e + S(3)*D*d)**S(3) - S(8)*c*(-S(2)*B*e + D*c)**S(2)*(-S(4)*C*e + S(3)*D*d) + S(8)*d*(-S(4)*A*e + D*b)*(-S(2)*B*e + D*c)*(-S(4)*C*e + S(3)*D*d) + S(8)*d*(-S(2)*B*e + D*c)**S(3) - S(4)*e*(-S(4)*A*e + D*b)*(S(2)*(-S(4)*A*e + D*b)*(-S(4)*C*e + S(3)*D*d) + S(4)*(-S(2)*B*e + D*c)**S(2))))) rule338 = ReplacementRule(pattern338, lambda e, a, C, x, A, B, D, d, b, c : D*log(a + b*x + c*x**S(2) + d*x**S(3) + e*x**S(4))/(S(4)*e) - Int((-S(4)*A*e + D*b + x**S(2)*(-S(4)*C*e + S(3)*D*d) + S(2)*x*(-S(2)*B*e + D*c))/(a + b*x + c*x**S(2) + d*x**S(3) + e*x**S(4)), x)/(S(4)*e)) rubi.add(rule338) pattern339 = Pattern(Integral((x_**S(3)*WC('D', S(1)) + x_*WC('B', S(1)) + WC('A', S(0)))/(a_ + x_**S(4)*WC('e', S(1)) + x_**S(3)*WC('d', S(1)) + x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda D, x: FreeQ(D, x)), CustomConstraint(lambda e, A, D, d, b, c: ZeroQ(D**S(2)*c**S(2)*d - D*c*(-S(8)*A*e**S(2) - S(4)*C*c*e + S(2)*D*b*e + S(3)*D*c*d) + S(2)*(-S(4)*C*e + S(3)*D*d)*(-A*d*e - C*b*e + D*b*d))), CustomConstraint(lambda e, b, a, A, B, D, d, c: ZeroQ(S(54)*D**S(3)*a*d**S(3) - S(6)*D*c*d*(-S(2)*B*e + D*c)**S(2) + S(6)*D*d**S(2)*(-S(4)*A*e + D*b)*(-S(2)*B*e + D*c) + S(2)*d*(-S(2)*B*e + D*c)**S(3) - e*(-S(4)*A*e + D*b)*(S(6)*D*d*(-S(4)*A*e + D*b) + S(4)*(-S(2)*B*e + D*c)**S(2))))) rule339 = ReplacementRule(pattern339, lambda e, a, x, A, B, D, d, b, c : D*log(a + b*x + c*x**S(2) + d*x**S(3) + e*x**S(4))/(S(4)*e) - Int((-S(4)*A*e + D*b + S(3)*D*d*x**S(2) + S(2)*x*(-S(2)*B*e + D*c))/(a + b*x + c*x**S(2) + d*x**S(3) + e*x**S(4)), x)/(S(4)*e)) rubi.add(rule339) pattern340 = Pattern(Integral(u_/(sqrt(x_*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1)) + sqrt(x_*WC('d', S(1)) + WC('c', S(0)))*WC('f', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda f, a, e, c: ZeroQ(a*e**S(2) - c*f**S(2)))) rule340 = ReplacementRule(pattern340, lambda a, f, x, u, b, d, e, c : -a*Int(u*sqrt(c + d*x)/x, x)/(f*(-a*d + b*c)) + c*Int(u*sqrt(a + b*x)/x, x)/(e*(-a*d + b*c))) rubi.add(rule340) pattern341 = Pattern(Integral(u_/(sqrt(x_*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1)) + sqrt(x_*WC('d', S(1)) + WC('c', S(0)))*WC('f', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda b, a, d, c: NonzeroQ(-a*d + b*c)), CustomConstraint(lambda b, d, f, e: ZeroQ(b*e**S(2) - d*f**S(2)))) rule341 = ReplacementRule(pattern341, lambda a, f, x, u, b, d, e, c : b*Int(u*sqrt(c + d*x), x)/(f*(-a*d + b*c)) - d*Int(u*sqrt(a + b*x), x)/(e*(-a*d + b*c))) rubi.add(rule341) pattern342 = Pattern(Integral(u_/(sqrt(x_*WC('b', S(1)) + WC('a', S(0)))*WC('e', S(1)) + sqrt(x_*WC('d', S(1)) + WC('c', S(0)))*WC('f', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda f, a, e, c: NonzeroQ(a*e**S(2) - c*f**S(2))), CustomConstraint(lambda b, d, f, e: NonzeroQ(b*e**S(2) - d*f**S(2)))) rule342 = ReplacementRule(pattern342, lambda a, f, x, u, b, d, e, c : e*Int(u*sqrt(a + b*x)/(a*e**S(2) - c*f**S(2) + x*(b*e**S(2) - d*f**S(2))), x) - f*Int(u*sqrt(c + d*x)/(a*e**S(2) - c*f**S(2) + x*(b*e**S(2) - d*f**S(2))), x)) rubi.add(rule342) pattern343 = Pattern(Integral(WC('u', S(1))/(x_**WC('n', S(1))*WC('d', S(1)) + sqrt(x_**WC('p', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n, p: ZeroQ(-S(2)*n + p)), CustomConstraint(lambda b, d, c: ZeroQ(b*c**S(2) - d**S(2)))) rule343 = ReplacementRule(pattern343, lambda p, n, a, x, u, b, d, c : -b*Int(u*x**n, x)/(a*d) + Int(u*sqrt(a + b*x**(S(2)*n)), x)/(a*c)) rubi.add(rule343) pattern344 = Pattern(Integral(x_**WC('m', S(1))/(x_**WC('n', S(1))*WC('d', S(1)) + sqrt(x_**WC('p', S(1))*WC('b', S(1)) + WC('a', S(0)))*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n, p: ZeroQ(-S(2)*n + p)), CustomConstraint(lambda b, d, c: NonzeroQ(b*c**S(2) - d**S(2)))) rule344 = ReplacementRule(pattern344, lambda p, n, a, x, m, b, d, c : c*Int(x**m*sqrt(a + b*x**(S(2)*n))/(a*c**S(2) + x**(S(2)*n)*(b*c**S(2) - d**S(2))), x) - d*Int(x**(m + n)/(a*c**S(2) + x**(S(2)*n)*(b*c**S(2) - d**S(2))), x)) rubi.add(rule344) pattern345 = Pattern(Integral(S(1)/((a_ + x_**S(3)*WC('b', S(1)))*sqrt(x_**S(2)*WC('f', S(1)) + x_*WC('e', S(1)) + WC('d', S(0)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda b, a: PosQ(a/b)), ) def With345(a, f, x, b, d, e): r = Numerator(Rt(a/b, S(3))) s = Denominator(Rt(a/b, S(3))) return r*Int(S(1)/((r + s*x)*sqrt(d + e*x + f*x**S(2))), x)/(S(3)*a) + r*Int((S(2)*r - s*x)/(sqrt(d + e*x + f*x**S(2))*(r**S(2) - r*s*x + s**S(2)*x**S(2))), x)/(S(3)*a) rule345 = ReplacementRule(pattern345, lambda a, f, x, b, d, e : With345(a, f, x, b, d, e)) rubi.add(rule345) pattern346 = Pattern(Integral(S(1)/((a_ + x_**S(3)*WC('b', S(1)))*sqrt(x_**S(2)*WC('f', S(1)) + WC('d', S(0)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda b, a: PosQ(a/b)), ) def With346(a, f, x, b, d): r = Numerator(Rt(a/b, S(3))) s = Denominator(Rt(a/b, S(3))) return r*Int(S(1)/(sqrt(d + f*x**S(2))*(r + s*x)), x)/(S(3)*a) + r*Int((S(2)*r - s*x)/(sqrt(d + f*x**S(2))*(r**S(2) - r*s*x + s**S(2)*x**S(2))), x)/(S(3)*a) rule346 = ReplacementRule(pattern346, lambda a, f, x, b, d : With346(a, f, x, b, d)) rubi.add(rule346) pattern347 = Pattern(Integral(S(1)/((a_ + x_**S(3)*WC('b', S(1)))*sqrt(x_**S(2)*WC('f', S(1)) + x_*WC('e', S(1)) + WC('d', S(0)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda b, a: NegQ(a/b)), ) def With347(a, f, x, b, d, e): r = Numerator(Rt(-a/b, S(3))) s = Denominator(Rt(-a/b, S(3))) return r*Int(S(1)/((r - s*x)*sqrt(d + e*x + f*x**S(2))), x)/(S(3)*a) + r*Int((S(2)*r + s*x)/(sqrt(d + e*x + f*x**S(2))*(r**S(2) + r*s*x + s**S(2)*x**S(2))), x)/(S(3)*a) rule347 = ReplacementRule(pattern347, lambda a, f, x, b, d, e : With347(a, f, x, b, d, e)) rubi.add(rule347) pattern348 = Pattern(Integral(S(1)/((a_ + x_**S(3)*WC('b', S(1)))*sqrt(x_**S(2)*WC('f', S(1)) + WC('d', S(0)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda b, a: NegQ(a/b)), ) def With348(a, f, x, b, d): r = Numerator(Rt(-a/b, S(3))) s = Denominator(Rt(-a/b, S(3))) return r*Int(S(1)/(sqrt(d + f*x**S(2))*(r - s*x)), x)/(S(3)*a) + r*Int((S(2)*r + s*x)/(sqrt(d + f*x**S(2))*(r**S(2) + r*s*x + s**S(2)*x**S(2))), x)/(S(3)*a) rule348 = ReplacementRule(pattern348, lambda a, f, x, b, d : With348(a, f, x, b, d)) rubi.add(rule348) pattern349 = Pattern(Integral(S(1)/((d_ + x_*WC('e', S(1)))*sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x))) rule349 = ReplacementRule(pattern349, lambda e, a, x, b, d, c : d*Int(S(1)/((d**S(2) - e**S(2)*x**S(2))*sqrt(a + b*x**S(2) + c*x**S(4))), x) - e*Int(x/((d**S(2) - e**S(2)*x**S(2))*sqrt(a + b*x**S(2) + c*x**S(4))), x)) rubi.add(rule349) pattern350 = Pattern(Integral(S(1)/(sqrt(a_ + x_**S(4)*WC('c', S(1)))*(d_ + x_*WC('e', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x))) rule350 = ReplacementRule(pattern350, lambda e, a, x, d, c : d*Int(S(1)/(sqrt(a + c*x**S(4))*(d**S(2) - e**S(2)*x**S(2))), x) - e*Int(x/(sqrt(a + c*x**S(4))*(d**S(2) - e**S(2)*x**S(2))), x)) rubi.add(rule350) pattern351 = Pattern(Integral(S(1)/((d_ + x_*WC('e', S(1)))**S(2)*sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda a, b, d, e, c: NonzeroQ(a*e**S(4) + b*d**S(2)*e**S(2) + c*d**S(4))), CustomConstraint(lambda b, e, d, c: ZeroQ(b*d*e**S(2) + S(2)*c*d**S(3)))) rule351 = ReplacementRule(pattern351, lambda e, a, x, b, d, c : -c*Int((d**S(2) - e**S(2)*x**S(2))/sqrt(a + b*x**S(2) + c*x**S(4)), x)/(a*e**S(4) + b*d**S(2)*e**S(2) + c*d**S(4)) - e**S(3)*sqrt(a + b*x**S(2) + c*x**S(4))/((d + e*x)*(a*e**S(4) + b*d**S(2)*e**S(2) + c*d**S(4)))) rubi.add(rule351) pattern352 = Pattern(Integral(S(1)/((d_ + x_*WC('e', S(1)))**S(2)*sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda a, b, d, e, c: NonzeroQ(a*e**S(4) + b*d**S(2)*e**S(2) + c*d**S(4))), CustomConstraint(lambda b, e, d, c: NonzeroQ(b*d*e**S(2) + S(2)*c*d**S(3)))) rule352 = ReplacementRule(pattern352, lambda e, a, x, b, d, c : -c*Int((d**S(2) - e**S(2)*x**S(2))/sqrt(a + b*x**S(2) + c*x**S(4)), x)/(a*e**S(4) + b*d**S(2)*e**S(2) + c*d**S(4)) - e**S(3)*sqrt(a + b*x**S(2) + c*x**S(4))/((d + e*x)*(a*e**S(4) + b*d**S(2)*e**S(2) + c*d**S(4))) + (b*d*e**S(2) + S(2)*c*d**S(3))*Int(S(1)/((d + e*x)*sqrt(a + b*x**S(2) + c*x**S(4))), x)/(a*e**S(4) + b*d**S(2)*e**S(2) + c*d**S(4))) rubi.add(rule352) pattern353 = Pattern(Integral(S(1)/(sqrt(a_ + x_**S(4)*WC('c', S(1)))*(d_ + x_*WC('e', S(1)))**S(2)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda e, a, d, c: NonzeroQ(a*e**S(4) + c*d**S(4)))) rule353 = ReplacementRule(pattern353, lambda e, a, x, d, c : S(2)*c*d**S(3)*Int(S(1)/(sqrt(a + c*x**S(4))*(d + e*x)), x)/(a*e**S(4) + c*d**S(4)) - c*Int((d**S(2) - e**S(2)*x**S(2))/sqrt(a + c*x**S(4)), x)/(a*e**S(4) + c*d**S(4)) - e**S(3)*sqrt(a + c*x**S(4))/((d + e*x)*(a*e**S(4) + c*d**S(4)))) rubi.add(rule353) pattern354 = Pattern(Integral((A_ + x_**S(2)*WC('B', S(1)))/((d_ + x_**S(2)*WC('e', S(1)))*sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda B, e, d, A: ZeroQ(A*e + B*d)), CustomConstraint(lambda e, a, d, c: ZeroQ(-a*e**S(2) + c*d**S(2)))) rule354 = ReplacementRule(pattern354, lambda a, x, A, B, b, d, e, c : A*Subst(Int(1/(d - x**S(2)*(-S(2)*a*e + b*d)), x), x, x/sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule354) pattern355 = Pattern(Integral((A_ + x_**S(2)*WC('B', S(1)))/(sqrt(a_ + x_**S(4)*WC('c', S(1)))*(d_ + x_**S(2)*WC('e', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda B, e, d, A: ZeroQ(A*e + B*d)), CustomConstraint(lambda e, a, d, c: ZeroQ(-a*e**S(2) + c*d**S(2)))) rule355 = ReplacementRule(pattern355, lambda a, x, A, B, d, e, c : A*Subst(Int(1/(S(2)*a*e*x**S(2) + d), x), x, x/sqrt(a + c*x**S(4)))) rubi.add(rule355) pattern356 = Pattern(Integral((A_ + x_**S(4)*WC('B', S(1)))/(sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))*(d_ + x_**S(4)*WC('f', S(1)) + x_**S(2)*WC('e', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda f, a, d, c: ZeroQ(-a*f + c*d)), CustomConstraint(lambda B, a, c, A: ZeroQ(A*c + B*a))) rule356 = ReplacementRule(pattern356, lambda a, f, x, A, B, b, d, e, c : A*Subst(Int(1/(d - x**S(2)*(-a*e + b*d)), x), x, x/sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule356) pattern357 = Pattern(Integral((A_ + x_**S(4)*WC('B', S(1)))/(sqrt(a_ + x_**S(4)*WC('c', S(1)))*(d_ + x_**S(4)*WC('f', S(1)) + x_**S(2)*WC('e', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda f, a, d, c: ZeroQ(-a*f + c*d)), CustomConstraint(lambda B, a, c, A: ZeroQ(A*c + B*a))) rule357 = ReplacementRule(pattern357, lambda a, f, x, A, B, d, e, c : A*Subst(Int(1/(a*e*x**S(2) + d), x), x, x/sqrt(a + c*x**S(4)))) rubi.add(rule357) pattern358 = Pattern(Integral((A_ + x_**S(4)*WC('B', S(1)))/((d_ + x_**S(4)*WC('f', S(1)))*sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda f, a, d, c: ZeroQ(-a*f + c*d)), CustomConstraint(lambda B, a, c, A: ZeroQ(A*c + B*a))) rule358 = ReplacementRule(pattern358, lambda a, f, x, A, B, b, d, c : A*Subst(Int(1/(-b*d*x**S(2) + d), x), x, x/sqrt(a + b*x**S(2) + c*x**S(4)))) rubi.add(rule358) pattern359 = Pattern(Integral(sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))/(d_ + x_**S(4)*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda e, a, d, c: ZeroQ(a*e + c*d)), CustomConstraint(lambda a, c: PosQ(a*c))) rule359 = ReplacementRule(pattern359, lambda a, x, b, d, e, c : a*Subst(Int(1/(-S(2)*b*x**S(2) + x**S(4)*(-S(4)*a*c + b**S(2)) + S(1)), x), x, x/sqrt(a + b*x**S(2) + c*x**S(4)))/d) rubi.add(rule359) pattern360 = Pattern(Integral(sqrt(a_ + x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)))/(d_ + x_**S(4)*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda e, a, d, c: ZeroQ(a*e + c*d)), CustomConstraint(lambda a, c: NegQ(a*c)), ) def With360(a, x, b, d, e, c): q = sqrt(-S(4)*a*c + b**S(2)) return sqrt(S(2))*a*sqrt(-b + q)*atanh(sqrt(S(2))*x*sqrt(-b + q)*(b + S(2)*c*x**S(2) + q)/(S(4)*sqrt(a + b*x**S(2) + c*x**S(4))*Rt(-a*c, S(2))))/(S(4)*d*Rt(-a*c, S(2))) - sqrt(S(2))*a*sqrt(b + q)*atan(sqrt(S(2))*x*sqrt(b + q)*(b + S(2)*c*x**S(2) - q)/(S(4)*sqrt(a + b*x**S(2) + c*x**S(4))*Rt(-a*c, S(2))))/(S(4)*d*Rt(-a*c, S(2))) rule360 = ReplacementRule(pattern360, lambda a, x, b, d, e, c : With360(a, x, b, d, e, c)) rubi.add(rule360) pattern361 = Pattern(Integral(S(1)/((a_ + x_*WC('b', S(1)))*sqrt(c_ + x_**S(2)*WC('d', S(1)))*sqrt(e_ + x_**S(2)*WC('f', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x))) rule361 = ReplacementRule(pattern361, lambda e, a, f, x, b, d, c : a*Int(S(1)/((a**S(2) - b**S(2)*x**S(2))*sqrt(c + d*x**S(2))*sqrt(e + f*x**S(2))), x) - b*Int(x/((a**S(2) - b**S(2)*x**S(2))*sqrt(c + d*x**S(2))*sqrt(e + f*x**S(2))), x)) rubi.add(rule361) pattern362 = Pattern(Integral((x_*WC('h', S(1)) + WC('g', S(0)))*sqrt(x_*WC('e', S(1)) + sqrt(x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))*WC('f', S(1)) + WC('d', S(0))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda e, c, a, f, b, h, d, g: ZeroQ(-f**S(2)*(a*h**S(2) - b*g*h + c*g**S(2)) + (-d*h + e*g)**S(2))), CustomConstraint(lambda e, c, f, b, h, d, g: ZeroQ(-S(2)*d*e*h + S(2)*e**S(2)*g - f**S(2)*(-b*h + S(2)*c*g)))) rule362 = ReplacementRule(pattern362, lambda c, a, f, x, b, d, h, e, g : S(2)*sqrt(d + e*x + f*sqrt(a + b*x + c*x**S(2)))*(S(9)*c**S(2)*f*g*h*x**S(2) + S(3)*c**S(2)*f*h**S(2)*x**S(3) + c*f*x*(a*h**S(2) - b*g*h + S(10)*c*g**S(2)) + f*(S(2)*a*b*h**S(2) - S(3)*a*c*g*h - S(2)*b**S(2)*g*h + S(5)*b*c*g**S(2)) - (-d*h + e*g)*sqrt(a + b*x + c*x**S(2))*(-S(2)*b*h + S(5)*c*g + c*h*x))/(S(15)*c**S(2)*f*(g + h*x))) rubi.add(rule362) pattern363 = Pattern(Integral((u_ + (sqrt(v_)*WC('k', S(1)) + WC('j', S(0)))*WC('f', S(1)))**WC('n', S(1))*(x_*WC('h', S(1)) + WC('g', S(0)))**WC('m', S(1)), x_), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda k, x: FreeQ(k, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda x, u: LinearQ(u, x)), CustomConstraint(lambda v, x: QuadraticQ(v, x)), CustomConstraint(lambda f, v, x, u, j: Not(LinearMatchQ(u, x) & QuadraticMatchQ(v, x) & (ZeroQ(j) | ZeroQ(f + S(-1))))), CustomConstraint(lambda k, f, v, x, u, j, h, g: ZeroQ(-f**S(2)*k**S(2)*(g**S(2)*Coefficient(v, x, S(2)) - g*h*Coefficient(v, x, S(1)) + h**S(2)*Coefficient(v, x, S(0))) + (g*Coefficient(u, x, S(1)) - h*(f*j + Coefficient(u, x, S(0))))**S(2)))) rule363 = ReplacementRule(pattern363, lambda n, k, m, f, v, x, u, j, h, g : Int((g + h*x)**m*(f*k*sqrt(ExpandToSum(v, x)) + ExpandToSum(f*j + u, x))**n, x)) rubi.add(rule363) pattern364 = Pattern(Integral(((x_*WC('e', S(1)) + sqrt(x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))*WC('f', S(1)) + WC('d', S(0)))**n_*WC('h', S(1)) + WC('g', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda p: IntegerQ(p))) rule364 = ReplacementRule(pattern364, lambda p, c, n, a, f, x, b, d, h, e, g : S(2)*Subst(Int((g + h*x**n)**p*(d**S(2)*e + e*x**S(2) - f**S(2)*(-a*e + b*d) - x*(-b*f**S(2) + S(2)*d*e))/(b*f**S(2) - S(2)*d*e + S(2)*e*x)**S(2), x), x, d + e*x + f*sqrt(a + b*x + c*x**S(2)))) rubi.add(rule364) pattern365 = Pattern(Integral(((x_*WC('e', S(1)) + sqrt(a_ + x_**S(2)*WC('c', S(1)))*WC('f', S(1)) + WC('d', S(0)))**n_*WC('h', S(1)) + WC('g', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda p: IntegerQ(p))) rule365 = ReplacementRule(pattern365, lambda p, c, n, a, f, x, d, h, e, g : Subst(Int((g + h*x**n)**p*(a*f**S(2) + d**S(2) - S(2)*d*x + x**S(2))/(d - x)**S(2), x), x, d + e*x + f*sqrt(a + c*x**S(2)))/(S(2)*e)) rubi.add(rule365) pattern366 = Pattern(Integral(((u_ + sqrt(v_)*WC('f', S(1)))**n_*WC('h', S(1)) + WC('g', S(0)))**WC('p', S(1)), x_), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda x, u: LinearQ(u, x)), CustomConstraint(lambda v, x: QuadraticQ(v, x)), CustomConstraint(lambda v, x, u: Not(LinearMatchQ(u, x) & QuadraticMatchQ(v, x))), CustomConstraint(lambda f, v, x, u: ZeroQ(-f**S(2)*Coefficient(v, x, S(2)) + Coefficient(u, x, S(1))**S(2))), CustomConstraint(lambda p: IntegerQ(p))) rule366 = ReplacementRule(pattern366, lambda p, n, f, v, x, u, h, g : Int((g + h*(f*sqrt(ExpandToSum(v, x)) + ExpandToSum(u, x))**n)**p, x)) rubi.add(rule366) pattern367 = Pattern(Integral((x_*WC('e', S(1)) + sqrt(x_**S(2)*WC('c', S(1)) + WC('a', S(0)))*WC('f', S(1)))**WC('n', S(1))*(x_*WC('h', S(1)) + WC('g', S(0)))**WC('m', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda m: IntegerQ(m))) rule367 = ReplacementRule(pattern367, lambda c, n, a, f, x, m, h, e, g : S(2)**(-m + S(-1))*e**(-m + S(-1))*Subst(Int(x**(-m + n + S(-2))*(a*f**S(2) + x**S(2))*(-a*f**S(2)*h + S(2)*e*g*x + h*x**S(2))**m, x), x, e*x + f*sqrt(a + c*x**S(2)))) rubi.add(rule367) pattern368 = Pattern(Integral(x_**WC('p', S(1))*(g_ + x_**S(2)*WC('i', S(1)))**WC('m', S(1))*(x_*WC('e', S(1)) + sqrt(a_ + x_**S(2)*WC('c', S(1)))*WC('f', S(1)))**WC('n', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda i, x: FreeQ(i, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda g, i, a, c: ZeroQ(-a*i + c*g)), CustomConstraint(lambda p, m: IntegersQ(p, S(2)*m)), CustomConstraint(lambda i, c, m: IntegerQ(m) | PositiveQ(i/c))) rule368 = ReplacementRule(pattern368, lambda i, p, n, a, g, f, x, m, e, c : S(2)**(-S(2)*m - p + S(-1))*e**(-p + S(-1))*f**(-S(2)*m)*(i/c)**m*Subst(Int(x**(-S(2)*m + n - p + S(-2))*(-a*f**S(2) + x**S(2))**p*(a*f**S(2) + x**S(2))**(S(2)*m + S(1)), x), x, e*x + f*sqrt(a + c*x**S(2)))) rubi.add(rule368) pattern369 = Pattern(Integral((x_*WC('e', S(1)) + sqrt(x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))*WC('f', S(1)) + WC('d', S(0)))**WC('n', S(1))*(x_**S(2)*WC('i', S(1)) + x_*WC('h', S(1)) + WC('g', S(0)))**WC('m', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda i, x: FreeQ(i, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda g, i, a, c: ZeroQ(-a*i + c*g)), CustomConstraint(lambda b, i, h, c: ZeroQ(-b*i + c*h)), CustomConstraint(lambda m: IntegerQ(S(2)*m)), CustomConstraint(lambda i, c, m: IntegerQ(m) | PositiveQ(i/c))) rule369 = ReplacementRule(pattern369, lambda i, e, c, n, a, f, x, m, b, h, d, g : S(2)*f**(-S(2)*m)*(i/c)**m*Subst(Int(x**n*(b*f**S(2) - S(2)*d*e + S(2)*e*x)**(-S(2)*m + S(-2))*(d**S(2)*e + e*x**S(2) - f**S(2)*(-a*e + b*d) - x*(-b*f**S(2) + S(2)*d*e))**(S(2)*m + S(1)), x), x, d + e*x + f*sqrt(a + b*x + c*x**S(2)))) rubi.add(rule369) pattern370 = Pattern(Integral((g_ + x_**S(2)*WC('i', S(1)))**WC('m', S(1))*(x_*WC('e', S(1)) + sqrt(a_ + x_**S(2)*WC('c', S(1)))*WC('f', S(1)) + WC('d', S(0)))**WC('n', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda i, x: FreeQ(i, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda g, i, a, c: ZeroQ(-a*i + c*g)), CustomConstraint(lambda m: IntegerQ(S(2)*m)), CustomConstraint(lambda i, c, m: IntegerQ(m) | PositiveQ(i/c))) rule370 = ReplacementRule(pattern370, lambda i, n, a, g, f, x, m, d, e, c : S(2)**(-S(2)*m + S(-1))*f**(-S(2)*m)*(i/c)**m*Subst(Int(x**n*(-d + x)**(-S(2)*m + S(-2))*(a*f**S(2) + d**S(2) - S(2)*d*x + x**S(2))**(S(2)*m + S(1)), x), x, d + e*x + f*sqrt(a + c*x**S(2)))/e) rubi.add(rule370) pattern371 = Pattern(Integral((x_*WC('e', S(1)) + sqrt(x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))*WC('f', S(1)) + WC('d', S(0)))**WC('n', S(1))*(x_**S(2)*WC('i', S(1)) + x_*WC('h', S(1)) + WC('g', S(0)))**WC('m', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda i, x: FreeQ(i, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda g, i, a, c: ZeroQ(-a*i + c*g)), CustomConstraint(lambda b, i, h, c: ZeroQ(-b*i + c*h)), CustomConstraint(lambda m: PositiveIntegerQ(m + S(1)/2)), CustomConstraint(lambda i, c: Not(PositiveQ(i/c)))) rule371 = ReplacementRule(pattern371, lambda i, e, c, n, a, f, x, m, b, h, d, g : (i/c)**(m + S(-1)/2)*sqrt(g + h*x + i*x**S(2))*Int((a + b*x + c*x**S(2))**m*(d + e*x + f*sqrt(a + b*x + c*x**S(2)))**n, x)/sqrt(a + b*x + c*x**S(2))) rubi.add(rule371) pattern372 = Pattern(Integral((g_ + x_**S(2)*WC('i', S(1)))**WC('m', S(1))*(x_*WC('e', S(1)) + sqrt(a_ + x_**S(2)*WC('c', S(1)))*WC('f', S(1)) + WC('d', S(0)))**WC('n', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda i, x: FreeQ(i, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda g, i, a, c: ZeroQ(-a*i + c*g)), CustomConstraint(lambda m: PositiveIntegerQ(m + S(1)/2)), CustomConstraint(lambda i, c: Not(PositiveQ(i/c)))) rule372 = ReplacementRule(pattern372, lambda i, n, a, g, f, x, m, d, e, c : (i/c)**(m + S(-1)/2)*sqrt(g + i*x**S(2))*Int((a + c*x**S(2))**m*(d + e*x + f*sqrt(a + c*x**S(2)))**n, x)/sqrt(a + c*x**S(2))) rubi.add(rule372) pattern373 = Pattern(Integral((x_*WC('e', S(1)) + sqrt(x_**S(2)*WC('c', S(1)) + x_*WC('b', S(1)) + WC('a', S(0)))*WC('f', S(1)) + WC('d', S(0)))**WC('n', S(1))*(x_**S(2)*WC('i', S(1)) + x_*WC('h', S(1)) + WC('g', S(0)))**WC('m', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda h, x: FreeQ(h, x)), CustomConstraint(lambda i, x: FreeQ(i, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda g, i, a, c: ZeroQ(-a*i + c*g)), CustomConstraint(lambda b, i, h, c: ZeroQ(-b*i + c*h)), CustomConstraint(lambda m: NegativeIntegerQ(m + S(-1)/2)), CustomConstraint(lambda i, c: Not(PositiveQ(i/c)))) rule373 = ReplacementRule(pattern373, lambda i, e, c, n, a, f, x, m, b, h, d, g : (i/c)**(m + S(1)/2)*sqrt(a + b*x + c*x**S(2))*Int((a + b*x + c*x**S(2))**m*(d + e*x + f*sqrt(a + b*x + c*x**S(2)))**n, x)/sqrt(g + h*x + i*x**S(2))) rubi.add(rule373) pattern374 = Pattern(Integral((g_ + x_**S(2)*WC('i', S(1)))**WC('m', S(1))*(x_*WC('e', S(1)) + sqrt(a_ + x_**S(2)*WC('c', S(1)))*WC('f', S(1)) + WC('d', S(0)))**WC('n', S(1)), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda i, x: FreeQ(i, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda f, e, c: ZeroQ(-c*f**S(2) + e**S(2))), CustomConstraint(lambda g, i, a, c: ZeroQ(-a*i + c*g)), CustomConstraint(lambda m: NegativeIntegerQ(m + S(-1)/2)), CustomConstraint(lambda i, c: Not(PositiveQ(i/c)))) rule374 = ReplacementRule(pattern374, lambda i, n, a, g, f, x, m, d, e, c : (i/c)**(m + S(1)/2)*sqrt(a + c*x**S(2))*Int((a + c*x**S(2))**m*(d + e*x + f*sqrt(a + c*x**S(2)))**n, x)/sqrt(g + i*x**S(2))) rubi.add(rule374) pattern375 = Pattern(Integral(w_**WC('m', S(1))*(u_ + (sqrt(v_)*WC('k', S(1)) + WC('j', S(0)))*WC('f', S(1)))**WC('n', S(1)), x_), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda j, x: FreeQ(j, x)), CustomConstraint(lambda k, x: FreeQ(k, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda x, u: LinearQ(u, x)), CustomConstraint(lambda w, v, x: QuadraticQ(List(v, w), x)), CustomConstraint(lambda w, v, f, x, u, j: Not(LinearMatchQ(u, x) & QuadraticMatchQ(List(v, w), x) & (ZeroQ(j) | ZeroQ(f + S(-1))))), CustomConstraint(lambda k, f, v, x, u: ZeroQ(-f**S(2)*k**S(2)*Coefficient(v, x, S(2)) + Coefficient(u, x, S(1))**S(2)))) rule375 = ReplacementRule(pattern375, lambda j, n, k, w, f, v, x, u, m : Int((f*k*sqrt(ExpandToSum(v, x)) + ExpandToSum(f*j + u, x))**n*ExpandToSum(w, x)**m, x)) rubi.add(rule375) pattern376 = Pattern(Integral(S(1)/((a_ + x_**WC('n', S(1))*WC('b', S(1)))*sqrt(x_**S(2)*WC('c', S(1)) + (a_ + x_**WC('n', S(1))*WC('b', S(1)))**WC('p', S(1))*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n, p: ZeroQ(p - S(2)/n))) rule376 = ReplacementRule(pattern376, lambda p, n, a, x, b, d, c : Subst(Int(1/(-c*x**S(2) + S(1)), x), x, x/sqrt(c*x**S(2) + d*(a + b*x**n)**(S(2)/n)))/a) rubi.add(rule376) pattern377 = Pattern(Integral(sqrt(a_ + sqrt(c_ + x_**S(2)*WC('d', S(1)))*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda b, a, c: ZeroQ(a**S(2) - b**S(2)*c))) rule377 = ReplacementRule(pattern377, lambda a, x, b, d, c : S(2)*a*x/sqrt(a + b*sqrt(c + d*x**S(2))) + S(2)*b**S(2)*d*x**S(3)/(S(3)*(a + b*sqrt(c + d*x**S(2)))**(S(3)/2))) rubi.add(rule377) pattern378 = Pattern(Integral(sqrt(x_**S(2)*WC('a', S(1)) + x_*sqrt(c_ + x_**S(2)*WC('d', S(1)))*WC('b', S(1)))/(x_*sqrt(c_ + x_**S(2)*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda b, a, d: ZeroQ(a**S(2) - b**S(2)*d)), CustomConstraint(lambda b, a, c: ZeroQ(a + b**S(2)*c))) rule378 = ReplacementRule(pattern378, lambda a, x, b, d, c : sqrt(S(2))*b*Subst(Int(1/sqrt(S(1) + x**S(2)/a), x), x, a*x + b*sqrt(c + d*x**S(2)))/a) rubi.add(rule378) pattern379 = Pattern(Integral(sqrt(x_*(x_*WC('a', S(1)) + sqrt(c_ + x_**S(2)*WC('d', S(1)))*WC('b', S(1)))*WC('e', S(1)))/(x_*sqrt(c_ + x_**S(2)*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda b, a, d: ZeroQ(a**S(2) - b**S(2)*d)), CustomConstraint(lambda b, a, e, c: ZeroQ(a + b**S(2)*c*e))) rule379 = ReplacementRule(pattern379, lambda a, x, b, d, e, c : Int(sqrt(a*e*x**S(2) + b*e*x*sqrt(c + d*x**S(2)))/(x*sqrt(c + d*x**S(2))), x)) rubi.add(rule379) pattern380 = Pattern(Integral(sqrt(x_**S(2)*WC('c', S(1)) + sqrt(a_ + x_**S(4)*WC('b', S(1)))*WC('d', S(1)))/sqrt(a_ + x_**S(4)*WC('b', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda b, d, c: ZeroQ(-b*d**S(2) + c**S(2)))) rule380 = ReplacementRule(pattern380, lambda a, x, b, d, c : d*Subst(Int(1/(-S(2)*c*x**S(2) + S(1)), x), x, x/sqrt(c*x**S(2) + d*sqrt(a + b*x**S(4))))) rubi.add(rule380) pattern381 = Pattern(Integral((x_*WC('d', S(1)) + WC('c', S(0)))**WC('m', S(1))*sqrt(x_**S(2)*WC('b', S(1)) + sqrt(a_ + x_**S(4)*WC('e', S(1))))/sqrt(a_ + x_**S(4)*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda b, e: ZeroQ(-b**S(2) + e)), CustomConstraint(lambda a: PositiveQ(a))) rule381 = ReplacementRule(pattern381, lambda a, x, m, b, d, e, c : (-ImaginaryI/S(2) + S(1)/2)*Int((c + d*x)**m/sqrt(-ImaginaryI*b*x**S(2) + sqrt(a)), x) + (ImaginaryI/S(2) + S(1)/2)*Int((c + d*x)**m/sqrt(ImaginaryI*b*x**S(2) + sqrt(a)), x)) rubi.add(rule381) pattern382 = Pattern(Integral(S(1)/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b: PosQ(b)), ) def With382(a, x, b, d, c): q = Rt(b/a, S(3)) return d*Int((q*x + S(1) + sqrt(S(3)))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(-c*q + d*(S(1) + sqrt(S(3)))) - q*Int(1/sqrt(a + b*x**S(3)), x)/(-c*q + d*(S(1) + sqrt(S(3)))) rule382 = ReplacementRule(pattern382, lambda a, x, b, d, c : With382(a, x, b, d, c)) rubi.add(rule382) pattern383 = Pattern(Integral(S(1)/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b: NegQ(b)), ) def With383(a, x, b, d, c): q = Rt(-b/a, S(3)) return d*Int((-q*x + S(1) + sqrt(S(3)))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(c*q + d*(S(1) + sqrt(S(3)))) + q*Int(1/sqrt(a + b*x**S(3)), x)/(c*q + d*(S(1) + sqrt(S(3)))) rule383 = ReplacementRule(pattern383, lambda a, x, b, d, c : With383(a, x, b, d, c)) rubi.add(rule383) pattern384 = Pattern(Integral(S(1)/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b: PosQ(b)), ) def With384(a, x, b, d, c): q = Rt(-b/a, S(3)) return d*Int((-q*x - sqrt(S(3)) + S(1))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(c*q + d*(-sqrt(S(3)) + S(1))) + q*Int(1/sqrt(a + b*x**S(3)), x)/(c*q + d*(-sqrt(S(3)) + S(1))) rule384 = ReplacementRule(pattern384, lambda a, x, b, d, c : With384(a, x, b, d, c)) rubi.add(rule384) pattern385 = Pattern(Integral(S(1)/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b: NegQ(b)), ) def With385(a, x, b, d, c): q = Rt(b/a, S(3)) return d*Int((q*x - sqrt(S(3)) + S(1))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(-c*q + d*(-sqrt(S(3)) + S(1))) - q*Int(1/sqrt(a + b*x**S(3)), x)/(-c*q + d*(-sqrt(S(3)) + S(1))) rule385 = ReplacementRule(pattern385, lambda a, x, b, d, c : With385(a, x, b, d, c)) rubi.add(rule385) pattern386 = Pattern(Integral((e_ + x_*WC('f', S(1)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b: PosQ(b)), CustomConstraint(lambda f, d, a, e, b, x, q, c: ZeroQ(-e*q + f*(S(1) + sqrt(S(3)))))) def With386(e, a, f, x, b, d, c): q = Rt(b/a, S(3)) return S(4)*S(3)**(S(1)/4)*f*sqrt((q**S(2)*x**S(2) - q*x + S(1))/(q*x + S(1) + sqrt(S(3)))**S(2))*sqrt(-sqrt(S(3)) + S(2))*(q*x + S(1))*Subst(Int(S(1)/(sqrt(-x**S(2) + S(1))*sqrt(x**S(2) - S(4)*sqrt(S(3)) + S(7))*(-c*q + d*(-sqrt(S(3)) + S(1)) + x*(-c*q + d*(S(1) + sqrt(S(3)))))), x), x, (-q*x + S(-1) + sqrt(S(3)))/(q*x + S(1) + sqrt(S(3))))/(q*sqrt((q*x + S(1))/(q*x + S(1) + sqrt(S(3)))**S(2))*sqrt(a + b*x**S(3))) rule386 = ReplacementRule(pattern386, lambda e, a, f, x, b, d, c : With386(e, a, f, x, b, d, c)) rubi.add(rule386) pattern387 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b: PosQ(b)), CustomConstraint(lambda f, d, b, e, a, x, q, c: NonzeroQ(-e*q + f*(S(1) + sqrt(S(3)))))) def With387(a, f, x, b, d, e, c): q = Rt(b/a, S(3)) return (-c*f + d*e)*Int((q*x + S(1) + sqrt(S(3)))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(-c*q + d*(S(1) + sqrt(S(3)))) + (-e*q + f*(S(1) + sqrt(S(3))))*Int(1/sqrt(a + b*x**S(3)), x)/(-c*q + d*(S(1) + sqrt(S(3)))) rule387 = ReplacementRule(pattern387, lambda a, f, x, b, d, e, c : With387(a, f, x, b, d, e, c)) rubi.add(rule387) pattern388 = Pattern(Integral((e_ + x_*WC('f', S(1)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b: NegQ(b)), CustomConstraint(lambda f, d, a, e, b, x, q, c: ZeroQ(e*q + f*(S(1) + sqrt(S(3)))))) def With388(e, a, f, x, b, d, c): q = Rt(-b/a, S(3)) return -S(4)*S(3)**(S(1)/4)*f*sqrt((q**S(2)*x**S(2) + q*x + S(1))/(-q*x + S(1) + sqrt(S(3)))**S(2))*sqrt(-sqrt(S(3)) + S(2))*(-q*x + S(1))*Subst(Int(S(1)/(sqrt(-x**S(2) + S(1))*sqrt(x**S(2) - S(4)*sqrt(S(3)) + S(7))*(c*q + d*(-sqrt(S(3)) + S(1)) + x*(c*q + d*(S(1) + sqrt(S(3)))))), x), x, (q*x + S(-1) + sqrt(S(3)))/(-q*x + S(1) + sqrt(S(3))))/(q*sqrt((-q*x + S(1))/(-q*x + S(1) + sqrt(S(3)))**S(2))*sqrt(a + b*x**S(3))) rule388 = ReplacementRule(pattern388, lambda e, a, f, x, b, d, c : With388(e, a, f, x, b, d, c)) rubi.add(rule388) pattern389 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: PosQ(a)), CustomConstraint(lambda b: NegQ(b)), CustomConstraint(lambda f, d, b, e, a, x, q, c: NonzeroQ(e*q + f*(S(1) + sqrt(S(3)))))) def With389(a, f, x, b, d, e, c): q = Rt(-b/a, S(3)) return (-c*f + d*e)*Int((-q*x + S(1) + sqrt(S(3)))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(c*q + d*(S(1) + sqrt(S(3)))) + (e*q + f*(S(1) + sqrt(S(3))))*Int(1/sqrt(a + b*x**S(3)), x)/(c*q + d*(S(1) + sqrt(S(3)))) rule389 = ReplacementRule(pattern389, lambda a, f, x, b, d, e, c : With389(a, f, x, b, d, e, c)) rubi.add(rule389) pattern390 = Pattern(Integral((e_ + x_*WC('f', S(1)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b: PosQ(b)), CustomConstraint(lambda f, d, a, e, b, x, q, c: ZeroQ(e*q + f*(-sqrt(S(3)) + S(1))))) def With390(e, a, f, x, b, d, c): q = Rt(-b/a, S(3)) return S(4)*S(3)**(S(1)/4)*f*sqrt((q**S(2)*x**S(2) + q*x + S(1))/(-q*x - sqrt(S(3)) + S(1))**S(2))*sqrt(sqrt(S(3)) + S(2))*(-q*x + S(1))*Subst(Int(S(1)/(sqrt(-x**S(2) + S(1))*sqrt(x**S(2) + S(4)*sqrt(S(3)) + S(7))*(c*q + d*(S(1) + sqrt(S(3))) + x*(c*q + d*(-sqrt(S(3)) + S(1))))), x), x, (-q*x + S(1) + sqrt(S(3)))/(q*x + S(-1) + sqrt(S(3))))/(q*sqrt((q*x + S(-1))/(-q*x - sqrt(S(3)) + S(1))**S(2))*sqrt(a + b*x**S(3))) rule390 = ReplacementRule(pattern390, lambda e, a, f, x, b, d, c : With390(e, a, f, x, b, d, c)) rubi.add(rule390) pattern391 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b: PosQ(b)), CustomConstraint(lambda f, d, b, e, a, x, q, c: NonzeroQ(e*q + f*(-sqrt(S(3)) + S(1))))) def With391(a, f, x, b, d, e, c): q = Rt(-b/a, S(3)) return (-c*f + d*e)*Int((-q*x - sqrt(S(3)) + S(1))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(c*q + d*(-sqrt(S(3)) + S(1))) + (e*q + f*(-sqrt(S(3)) + S(1)))*Int(1/sqrt(a + b*x**S(3)), x)/(c*q + d*(-sqrt(S(3)) + S(1))) rule391 = ReplacementRule(pattern391, lambda a, f, x, b, d, e, c : With391(a, f, x, b, d, e, c)) rubi.add(rule391) pattern392 = Pattern(Integral((e_ + x_*WC('f', S(1)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b: NegQ(b)), CustomConstraint(lambda f, d, a, e, b, x, q, c: ZeroQ(-e*q + f*(-sqrt(S(3)) + S(1))))) def With392(e, a, f, x, b, d, c): q = Rt(b/a, S(3)) return -S(4)*S(3)**(S(1)/4)*f*sqrt((q**S(2)*x**S(2) - q*x + S(1))/(q*x - sqrt(S(3)) + S(1))**S(2))*sqrt(sqrt(S(3)) + S(2))*(q*x + S(1))*Subst(Int(S(1)/(sqrt(-x**S(2) + S(1))*sqrt(x**S(2) + S(4)*sqrt(S(3)) + S(7))*(-c*q + d*(S(1) + sqrt(S(3))) + x*(-c*q + d*(-sqrt(S(3)) + S(1))))), x), x, (q*x + S(1) + sqrt(S(3)))/(-q*x + S(-1) + sqrt(S(3))))/(q*sqrt((-q*x + S(-1))/(q*x - sqrt(S(3)) + S(1))**S(2))*sqrt(a + b*x**S(3))) rule392 = ReplacementRule(pattern392, lambda e, a, f, x, b, d, c : With392(e, a, f, x, b, d, c)) rubi.add(rule392) pattern393 = Pattern(Integral((x_*WC('f', S(1)) + WC('e', S(0)))/(sqrt(a_ + x_**S(3)*WC('b', S(1)))*(c_ + x_*WC('d', S(1)))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda a: NegQ(a)), CustomConstraint(lambda b: NegQ(b)), CustomConstraint(lambda f, d, b, e, a, x, q, c: NonzeroQ(-e*q + f*(-sqrt(S(3)) + S(1))))) def With393(a, f, x, b, d, e, c): q = Rt(b/a, S(3)) return (-c*f + d*e)*Int((q*x - sqrt(S(3)) + S(1))/(sqrt(a + b*x**S(3))*(c + d*x)), x)/(-c*q + d*(-sqrt(S(3)) + S(1))) + (-e*q + f*(-sqrt(S(3)) + S(1)))*Int(1/sqrt(a + b*x**S(3)), x)/(-c*q + d*(-sqrt(S(3)) + S(1))) rule393 = ReplacementRule(pattern393, lambda a, f, x, b, d, e, c : With393(a, f, x, b, d, e, c)) rubi.add(rule393) pattern394 = Pattern(Integral(x_**WC('m', S(1))/(c_ + x_**n_*WC('d', S(1)) + sqrt(a_ + x_**n_*WC('b', S(1)))*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda b, a, d, c: ZeroQ(-a*d + b*c, S(0))), CustomConstraint(lambda n, m: IntegerQ((m + S(1))/n))) rule394 = ReplacementRule(pattern394, lambda n, a, x, m, b, d, e, c : Subst(Int(x**(S(-1) + (m + S(1))/n)/(c + d*x + e*sqrt(a + b*x)), x), x, x**n)/n) rubi.add(rule394) pattern395 = Pattern(Integral(WC('u', S(1))/(c_ + x_**n_*WC('d', S(1)) + sqrt(a_ + x_**n_*WC('b', S(1)))*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda b, a, d, c: ZeroQ(-a*d + b*c, S(0)))) rule395 = ReplacementRule(pattern395, lambda n, a, x, u, b, d, e, c : -a*e*Int(u/(sqrt(a + b*x**n)*(-a*e**S(2) + c**S(2) + c*d*x**n)), x) + c*Int(u/(-a*e**S(2) + c**S(2) + c*d*x**n), x)) rubi.add(rule395) pattern396 = Pattern(Integral((A_ + x_**n_*WC('B', S(1)))/(a_ + x_**S(2)*WC('b', S(1)) + x_**n2_*WC('d', S(1)) + x_**n_*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n: NonzeroQ(n + S(-2))), CustomConstraint(lambda n, a, A, B, d: ZeroQ(-A**S(2)*d*(n + S(-1))**S(2) + B**S(2)*a)), CustomConstraint(lambda n, A, B, d, c: ZeroQ(S(2)*A*d*(n + S(-1)) + B*c))) rule396 = ReplacementRule(pattern396, lambda n2, n, a, x, A, B, b, d, c : A**S(2)*(n + S(-1))*Subst(Int(1/(A**S(2)*b*x**S(2)*(n + S(-1))**S(2) + a), x), x, x/(A*(n + S(-1)) - B*x**n))) rubi.add(rule396) pattern397 = Pattern(Integral(x_**WC('m', S(1))*(A_ + x_**WC('n', S(1))*WC('B', S(1)))/(a_ + x_**n2_*WC('d', S(1)) + x_**WC('k', S(1))*WC('b', S(1)) + x_**WC('n', S(1))*WC('c', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda A, x: FreeQ(A, x)), CustomConstraint(lambda B, x: FreeQ(B, x)), CustomConstraint(lambda m, x: FreeQ(m, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda k, m: ZeroQ(k - S(2)*m + S(-2))), CustomConstraint(lambda n, a, m, A, B, d: ZeroQ(-A**S(2)*d*(m - n + S(1))**S(2) + B**S(2)*a*(m + S(1))**S(2))), CustomConstraint(lambda n, A, m, B, d, c: ZeroQ(-S(2)*A*d*(m - n + S(1)) + B*c*(m + S(1))))) rule397 = ReplacementRule(pattern397, lambda n2, n, k, a, x, A, m, B, b, d, c : A**S(2)*(m - n + S(1))*Subst(Int(1/(A**S(2)*b*x**S(2)*(m - n + S(1))**S(2) + a), x), x, x**(m + S(1))/(A*(m - n + S(1)) + B*x**n*(m + S(1))))/(m + S(1))) rubi.add(rule397) pattern398 = Pattern(Integral((a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_*(d_ + g_*x_**n3_ + x_**n2_*WC('f', S(1)) + x_**n_*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule398 = ReplacementRule(pattern398, lambda n2, n3, p, n, a, g, f, x, b, d, e, c : -x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*(-a*b*(a*g + c*e) - S(2)*a*c*(-a*f + c*d) + b**S(2)*c*d + x**n*(-a*b**S(2)*g - S(2)*a*c*(-a*g + c*e) + b*c*(a*f + c*d)))/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2))) - Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Simp(a*b*(a*g + c*e) - S(2)*a*c*(a*f - c*d*(S(2)*n*(p + S(1)) + S(1))) - b**S(2)*c*d*(n*p + n + S(1)) + x**n*(a*b**S(2)*g*(n*(p + S(2)) + S(1)) - S(2)*a*c*(a*g*(n + S(1)) - c*e*(n*(S(2)*p + S(3)) + S(1))) - b*c*(a*f + c*d)*(n*(S(2)*p + S(3)) + S(1))), x), x)/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rubi.add(rule398) pattern399 = Pattern(Integral((a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_*(d_ + x_**n2_*WC('f', S(1)) + x_**n_*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule399 = ReplacementRule(pattern399, lambda n2, p, n, a, f, x, b, d, e, c : -x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*(-a*b*e - S(2)*a*(-a*f + c*d) + b**S(2)*d + x**n*(-S(2)*a*c*e + b*(a*f + c*d)))/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2))) - Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Simp(a*b*e - S(2)*a*(a*f - c*d*(S(2)*n*(p + S(1)) + S(1))) - b**S(2)*d*(n*p + n + S(1)) - x**n*(-S(2)*a*c*e*(n*(S(2)*p + S(3)) + S(1)) + b*(a*f + c*d)*(n*(S(2)*p + S(3)) + S(1))), x), x)/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rubi.add(rule399) pattern400 = Pattern(Integral((a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_*(d_ + g_*x_**n3_ + x_**n_*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule400 = ReplacementRule(pattern400, lambda n2, n3, p, n, a, g, x, b, d, e, c : -x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*(-a*b*(a*g + c*e) - S(2)*a*c**S(2)*d + b**S(2)*c*d + x**n*(-a*b**S(2)*g - S(2)*a*c*(-a*g + c*e) + b*c**S(2)*d))/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2))) - Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Simp(a*b*(a*g + c*e) + S(2)*a*c**S(2)*d*(S(2)*n*(p + S(1)) + S(1)) - b**S(2)*c*d*(n*p + n + S(1)) + x**n*(a*b**S(2)*g*(n*(p + S(2)) + S(1)) - S(2)*a*c*(a*g*(n + S(1)) - c*e*(n*(S(2)*p + S(3)) + S(1))) - b*c**S(2)*d*(n*(S(2)*p + S(3)) + S(1))), x), x)/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rubi.add(rule400) pattern401 = Pattern(Integral((a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_*(d_ + g_*x_**n3_ + x_**n2_*WC('f', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule401 = ReplacementRule(pattern401, lambda n2, n3, p, n, a, g, f, x, b, d, c : -x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*(-a**S(2)*b*g - S(2)*a*c*(-a*f + c*d) + b**S(2)*c*d + x**n*(S(2)*a**S(2)*c*g - a*b**S(2)*g + b*c*(a*f + c*d)))/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2))) - Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Simp(a**S(2)*b*g - S(2)*a*c*(a*f - c*d*(S(2)*n*(p + S(1)) + S(1))) - b**S(2)*c*d*(n*p + n + S(1)) + x**n*(-S(2)*a**S(2)*c*g*(n + S(1)) + a*b**S(2)*g*(n*(p + S(2)) + S(1)) - b*c*(a*f + c*d)*(n*(S(2)*p + S(3)) + S(1))), x), x)/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rubi.add(rule401) pattern402 = Pattern(Integral((d_ + x_**n2_*WC('f', S(1)))*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule402 = ReplacementRule(pattern402, lambda n2, p, n, a, f, x, b, d, c : -x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*(-S(2)*a*(-a*f + c*d) + b**S(2)*d + b*x**n*(a*f + c*d))/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2))) + Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Simp(S(2)*a*(a*f - c*d*(S(2)*n*(p + S(1)) + S(1))) + b**S(2)*d*(n*p + n + S(1)) + b*x**n*(a*f + c*d)*(n*(S(2)*p + S(3)) + S(1)), x), x)/(a*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rubi.add(rule402) pattern403 = Pattern(Integral((d_ + g_*x_**n3_)*(a_ + x_**n2_*WC('c', S(1)) + x_**n_*WC('b', S(1)))**p_, x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda b, a, c: NonzeroQ(-S(4)*a*c + b**S(2))), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule403 = ReplacementRule(pattern403, lambda n2, n3, p, n, a, g, x, b, d, c : -x*(a + b*x**n + c*x**(S(2)*n))**(p + S(1))*(-a**S(2)*b*g - S(2)*a*c**S(2)*d + b**S(2)*c*d + x**n*(S(2)*a**S(2)*c*g - a*b**S(2)*g + b*c**S(2)*d))/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2))) - Int((a + b*x**n + c*x**(S(2)*n))**(p + S(1))*Simp(a**S(2)*b*g + S(2)*a*c**S(2)*d*(S(2)*n*(p + S(1)) + S(1)) - b**S(2)*c*d*(n*p + n + S(1)) + x**n*(-S(2)*a**S(2)*c*g*(n + S(1)) + a*b**S(2)*g*(n*(p + S(2)) + S(1)) - b*c**S(2)*d*(n*(S(2)*p + S(3)) + S(1))), x), x)/(a*c*n*(p + S(1))*(-S(4)*a*c + b**S(2)))) rubi.add(rule403) pattern404 = Pattern(Integral((a_ + x_**n2_*WC('c', S(1)))**p_*(d_ + g_*x_**n3_ + x_**n2_*WC('f', S(1)) + x_**n_*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule404 = ReplacementRule(pattern404, lambda n2, n3, p, n, a, g, f, x, d, e, c : x*(a + c*x**(S(2)*n))**(p + S(1))*(-S(2)*a*c*x**n*(-a*g + c*e) - S(2)*a*c*(-a*f + c*d))/(S(4)*a**S(2)*c**S(2)*n*(p + S(1))) + Int((a + c*x**(S(2)*n))**(p + S(1))*Simp(-S(2)*a*c*x**n*(a*g*(n + S(1)) - c*e*(n*(S(2)*p + S(3)) + S(1))) - S(2)*a*c*(a*f - c*d*(S(2)*n*(p + S(1)) + S(1))), x), x)/(S(4)*a**S(2)*c**S(2)*n*(p + S(1)))) rubi.add(rule404) pattern405 = Pattern(Integral((a_ + x_**n2_*WC('c', S(1)))**p_*(d_ + x_**n2_*WC('f', S(1)) + x_**n_*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule405 = ReplacementRule(pattern405, lambda n2, p, n, a, f, x, d, e, c : x*(a + c*x**(S(2)*n))**(p + S(1))*(-S(2)*a*c*e*x**n - S(2)*a*(-a*f + c*d))/(S(4)*a**S(2)*c*n*(p + S(1))) + Int((a + c*x**(S(2)*n))**(p + S(1))*Simp(S(2)*a*c*e*x**n*(n*(S(2)*p + S(3)) + S(1)) - S(2)*a*(a*f - c*d*(S(2)*n*(p + S(1)) + S(1))), x), x)/(S(4)*a**S(2)*c*n*(p + S(1)))) rubi.add(rule405) pattern406 = Pattern(Integral((a_ + x_**n2_*WC('c', S(1)))**p_*(d_ + g_*x_**n3_ + x_**n_*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda n, x: FreeQ(n, x)), CustomConstraint(lambda n2, n: ZeroQ(-S(2)*n + n2)), CustomConstraint(lambda n, n3: ZeroQ(-S(3)*n + n3)), CustomConstraint(lambda p: NegativeIntegerQ(p + S(1)))) rule406 = ReplacementRule(pattern406, lambda n2, n3, p, n, a, g, x, d, e, c : x*(a + c*x**(S(2)*n))**(p + S(1))*(-S(2)*a*c**S(2)*d - S(2)*a*c*x**n*(-a*g + c*e))/(S(4)*a**S(2)*c**S(2)*n*(p + S(1))) + Int((a + c*x**(S(2)*n))**(p + S(1))*Simp(S(2)*a*c**S(2)*d*(S(2)*n*(p + S(1)) + S(1)) - S(2)*a*c*x**n*(a*g*(n + S(1)) - c*e*(n*(S(2)*p + S(3)) + S(1))), x), x)/(S(4)*a**S(2)*c**S(2)*n*(p + S(1)))) rubi.add(rule406) pattern407 = Pattern(Integral((x_**S(4)*WC('c', S(1)) + x_**S(2)*WC('b', S(1)) + WC('a', S(0)))/(d_ + x_**S(6)*WC('g', S(1)) + x_**S(4)*WC('f', S(1)) + x_**S(2)*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda b, x: FreeQ(b, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda a, g, f, b, d, c: ZeroQ(-S(12)*a**S(3)*g**S(2) + a**S(2)*c*f**S(2) + S(2)*a*b*g*(a*f + S(3)*c*d) + S(9)*c**S(3)*d**S(2) - c*d*f*(S(6)*a*c + b**S(2)))), CustomConstraint(lambda a, g, f, b, d, e, c: ZeroQ(a**S(3)*c*f**S(2)*g + S(2)*a**S(3)*g**S(2)*(-S(6)*a*g + b*f) - S(3)*a**S(2)*c**S(2)*d*f*g + S(3)*c**S(4)*d**S(2)*e - c**S(3)*d*(-S(12)*a*d*g + a*e*f + S(2)*b*d*f))), CustomConstraint(lambda f, a, d, c: NonzeroQ(-a*f + S(3)*c*d)), CustomConstraint(lambda c, a, b, d, g: NonzeroQ(-S(2)*a**S(2)*g + b*c*d)), CustomConstraint(lambda a, g, f, b, d, c: NonzeroQ(S(4)*a**S(2)*g - a*b*f + b*c*d)), CustomConstraint(lambda c, a, f, b, d, g: PosQ((S(12)*a**S(2)*g**S(2) - a*c*f**S(2) + f*(-S(2)*a*b*g + S(3)*c**S(2)*d))/(c*g*(-a*f + S(3)*c*d)))), ) def With407(a, g, f, x, b, d, e, c): q = Rt((S(12)*a**S(2)*g**S(2) - a*c*f**S(2) + f*(-S(2)*a*b*g + S(3)*c**S(2)*d))/(c*g*(-a*f + S(3)*c*d)), S(2)) r = Rt((a*c*f**S(2) - f*(S(2)*a*b*g + S(3)*c**S(2)*d) + S(4)*g*(a**S(2)*g + b*c*d))/(c*g*(-a*f + S(3)*c*d)), S(2)) return -c*atan((r - S(2)*x)/q)/(g*q) + c*atan((r + S(2)*x)/q)/(g*q) - c*atan(x*(-a*f + S(3)*c*d)*(S(6)*a**S(2)*b*g**S(2) - S(2)*a**S(2)*c*f*g - a*b**S(2)*f*g + b*c**S(2)*d*f + c**S(2)*g*x**S(4)*(-a*f + S(3)*c*d) + c*x**S(2)*(S(2)*a**S(2)*g**S(2) - a*c*f**S(2) - b*c*d*g + S(3)*c**S(2)*d*f))/(g*q*(-S(2)*a**S(2)*g + b*c*d)*(S(4)*a**S(2)*g - a*b*f + b*c*d)))/(g*q) rule407 = ReplacementRule(pattern407, lambda a, g, f, x, b, d, e, c : With407(a, g, f, x, b, d, e, c)) rubi.add(rule407) pattern408 = Pattern(Integral((x_**S(4)*WC('c', S(1)) + WC('a', S(0)))/(d_ + x_**S(6)*WC('g', S(1)) + x_**S(4)*WC('f', S(1)) + x_**S(2)*WC('e', S(1))), x_), CustomConstraint(lambda a, x: FreeQ(a, x)), CustomConstraint(lambda c, x: FreeQ(c, x)), CustomConstraint(lambda d, x: FreeQ(d, x)), CustomConstraint(lambda e, x: FreeQ(e, x)), CustomConstraint(lambda f, x: FreeQ(f, x)), CustomConstraint(lambda g, x: FreeQ(g, x)), CustomConstraint(lambda c, a, f, d, g: ZeroQ(-S(12)*a**S(3)*g**S(2) + a**S(2)*c*f**S(2) - S(6)*a*c**S(2)*d*f + S(9)*c**S(3)*d**S(2))), CustomConstraint(lambda a, g, f, d, e, c: ZeroQ(-S(12)*a**S(4)*g**S(3) + a**S(3)*c*f**S(2)*g - S(3)*a**S(2)*c**S(2)*d*f*g - a*c**S(3)*d*(-S(12)*d*g + e*f) + S(3)*c**S(4)*d**S(2)*e)), CustomConstraint(lambda f, a, d, c: NonzeroQ(-a*f + S(3)*c*d)), CustomConstraint(lambda c, a, f, d, g: PosQ((S(12)*a**S(2)*g**S(2) - a*c*f**S(2) + S(3)*c**S(2)*d*f)/(c*g*(-a*f + S(3)*c*d)))), ) def With408(c, a, f, x, d, e, g): q = Rt((S(12)*a**S(2)*g**S(2) - a*c*f**S(2) + S(3)*c**S(2)*d*f)/(c*g*(-a*f + S(3)*c*d)), S(2)) r = Rt((S(4)*a**S(2)*g**S(2) + a*c*f**S(2) - S(3)*c**S(2)*d*f)/(c*g*(-a*f + S(3)*c*d)), S(2)) return -c*atan((r - S(2)*x)/q)/(g*q) + c*atan((r + S(2)*x)/q)/(g*q) - c*atan(c*x*(-a*f + S(3)*c*d)*(S(2)*a**S(2)*f*g - c*g*x**S(4)*(-a*f + S(3)*c*d) - x**S(2)*(S(2)*a**S(2)*g**S(2) - a*c*f**S(2) + S(3)*c**S(2)*d*f))/(S(8)*a**S(4)*g**S(3)*q))/(g*q) rule408 = ReplacementRule(pattern408, lambda c, a, f, x, d, e, g : With408(c, a, f, x, d, e, g)) rubi.add(rule408) pattern409 = Pattern(Integral(u_*v_**p_, x_), CustomConstraint(lambda p: RationalQ(p)), CustomConstraint(lambda p: Less(p, S(-1))), CustomConstraint(lambda x, u: PolynomialQ(u, x)), CustomConstraint(lambda v, x: PolynomialQ(v, x)), CustomConstraint(lambda v: SumQ(v)), CustomConstraint(lambda v, x, u: Not(BinomialQ(v, x) & MonomialQ(u, x))), CustomConstraint(lambda v, x, u: Not(ZeroQ(Coefficient(u, x, S(0))) & ZeroQ(Coefficient(v, x, S(0))))), CustomConstraint(lambda v, n, w, LessEqual, Less, m, x, p, c, u: FalseQ(DerivativeDivides(v, u, x)) & Less(m + n*p, S(-1)) & Inequality(S(1), Less, n, LessEqual, m + S(1)))) def With409(v, p, x, u): m = Exponent(u, x) n = Exponent(v, x) return Module(List(Set(c, Coefficient(u, x, m)/((m + n*p + S(1))*Coefficient(v, x, n))), w), CompoundExpression(Set(c, Coefficient(u, x, m)/((m + n*p + S(1))*Coefficient(v, x, n))), Set(w, Apart(-c*x**(m - n)*(v*(m - n + S(1)) + x*(p + S(1))*D(v, x)) + u, x)), If(ZeroQ(w), c*v**(p + S(1))*x**(m - n + S(1)), c*v**(p + S(1))*x**(m - n + S(1)) + Int(v**p*w, x)))) rule409 = ReplacementRule(pattern409, lambda v, p, x, u : With409(v, p, x, u)) rubi.add(rule409) return rubi

163.76966

6,553

0.576858

68,397

351,941

2.931196

0.022545

0.369913

0.30711

0.058777

0.856807

0.848398

0.834282

0.817318

0.803152

0.789456

0

0.043399

0.141674

351,941

2,148

6,554

163.845903

0.620283

0

0.1188

0

0.00549

0.000088

0

1

0.087082

false

0

0.006344

0

0.180508

0

null

1

0

1

0

1

0

null

0

10

e99cc11fc06ef511c97815b69e90b4ccecdcd2b8

13,099

py

Python

idea_6_analysis.py

sherlock1987/ConvLab-2

9547cb09bfd7e297e2c609637c9e38f6c94fdbfb

[ "Apache-2.0" ]

1

2020-06-05T08:42:51.000Z

idea_6_analysis.py

sherlock1987/ConvLab-2

9547cb09bfd7e297e2c609637c9e38f6c94fdbfb

[ "Apache-2.0" ]

null

idea_6_analysis.py

sherlock1987/ConvLab-2

9547cb09bfd7e297e2c609637c9e38f6c94fdbfb

[ "Apache-2.0" ]

1

2020-06-05T09:15:51.000Z

import os import torch import logging import torch.nn as nn import numpy as np from convlab2.util.train_util import to_device import torch.nn as nn from torch import optim import zipfile import sys import matplotlib.pyplot as plt import pickle DEVICE = torch.device("cuda" if torch.cuda.is_available() else "cpu") import torch.tensor as tensor import copy # result for the descriminator encoder = {} decoder = {} collections = {'[1, 0, 1, 0, 0, 0, 0, 0, 0]', '[1, 0, 0, 0, 0, 0, 1, 0, 1]', '[0, 0, 1, 1, 0, 0, 0, 0, 0]', '[0, 0, 1, 0, 0, 0, 1, 0, 0]', '[1, 0, 0, 0, 0, 1, 0, 0, 0]', '[0, 1, 1, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 1, 0, 1]', '[0, 0, 1, 0, 0, 1, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0]', '[0, 0, 1, 0, 0, 0, 0, 1, 0]', '[1, 0, 0, 0, 0, 0, 0, 0, 1]', '[0, 1, 0, 1, 0, 0, 0, 0, 0]', '[0, 0, 0, 1, 0, 0, 0, 0, 0]', '[1, 0, 0, 0, 0, 0, 1, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 1]', '[1, 1, 0, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 1, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 1, 1, 1, 0]', '[0, 0, 0, 0, 0, 0, 1, 1, 1]', '[1, 0, 1, 0, 0, 0, 0, 1, 1]', '[0, 0, 0, 0, 0, 1, 1, 0, 0]', '[1, 0, 0, 0, 0, 0, 0, 1, 1]', '[1, 0, 0, 0, 0, 1, 0, 1, 0]', '[0, 1, 0, 0, 0, 1, 0, 1, 0]', '[0, 0, 0, 0, 0, 1, 0, 0, 0]', '[0, 0, 1, 0, 0, 0, 0, 0, 1]', '[0, 0, 1, 0, 0, 1, 0, 1, 0]', '[0, 1, 0, 0, 0, 0, 0, 0, 0]', '[0, 0, 1, 0, 0, 1, 0, 0, 1]', '[0, 0, 1, 0, 0, 0, 0, 1, 1]', '[0, 0, 0, 0, 0, 1, 1, 0, 1]', '[1, 0, 0, 0, 0, 1, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 1, 1, 0]', '[0, 0, 1, 0, 0, 0, 1, 0, 1]', '[1, 0, 1, 0, 0, 0, 0, 0, 1]', '[0, 1, 0, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 1, 0, 1, 0, 0, 0]', '[0, 0, 0, 0, 0, 1, 0, 0, 1]', '[1, 0, 0, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 1, 0, 1, 1]', '[0, 0, 1, 0, 0, 0, 1, 1, 0]', '[1, 0, 0, 0, 0, 0, 1, 1, 0]', '[0, 0, 1, 0, 0, 0, 0, 0, 0]', '[1, 0, 0, 0, 0, 0, 0, 0, 0]', '[1, 0, 1, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 1, 1]', '[0, 0, 0, 0, 0, 0, 1, 0, 0]', '[0, 0, 0, 0, 0, 1, 0, 1, 0]'} # len_comb = len(collections) # print(len(collections)) # zeros = [0] * len_comb # for i, ele in enumerate(collections): # one_hot = copy.deepcopy(zeros) # one_hot[i] = 1 # encoder[ele] = i # decoder[str(one_hot)] = ele # print(collections) # print(encoder) # print(decoder) a = torch.rand((2, 3)) one = torch.ones_like(a) zero = torch.zeros_like(a) a = torch.where(a > 0.5, one, a) print(a) print(torch.where(a <0.5, zero, a)) # from domain list to one hot encoder = {'[1, 0, 0, 0, 0, 1, 0, 0, 0]': 0, '[0, 0, 0, 0, 0, 0, 1, 1, 1]': 1, '[1, 0, 1, 0, 0, 0, 0, 1, 0]': 2, '[0, 0, 0, 0, 0, 0, 0, 0, 0]': 3, '[0, 0, 0, 0, 0, 1, 0, 1, 0]': 4, '[1, 0, 0, 0, 0, 0, 1, 0, 1]': 5, '[1, 0, 1, 0, 0, 0, 0, 0, 1]': 6, '[1, 0, 0, 0, 0, 0, 0, 0, 1]': 7, '[0, 0, 1, 0, 0, 1, 0, 0, 1]': 8, '[0, 0, 0, 1, 0, 0, 0, 0, 0]': 9, '[1, 0, 1, 0, 0, 0, 0, 1, 1]': 10, '[1, 0, 0, 0, 0, 1, 0, 1, 0]': 11, '[0, 0, 0, 0, 0, 1, 1, 0, 0]': 12, '[1, 0, 1, 0, 0, 0, 0, 0, 0]': 13, '[0, 0, 0, 0, 0, 0, 1, 0, 0]': 14, '[0, 0, 1, 0, 0, 1, 0, 1, 0]': 15, '[1, 0, 0, 0, 0, 1, 0, 0, 1]': 16, '[0, 0, 0, 0, 0, 1, 0, 0, 0]': 17, '[0, 0, 0, 0, 0, 1, 0, 1, 1]': 18, '[1, 0, 0, 0, 0, 0, 0, 1, 1]': 19, '[0, 0, 1, 0, 0, 0, 0, 1, 1]': 20, '[0, 0, 0, 0, 0, 0, 1, 0, 1]': 21, '[0, 0, 0, 0, 0, 0, 0, 0, 1]': 22, '[0, 1, 0, 0, 0, 1, 0, 1, 0]': 23, '[0, 0, 0, 1, 0, 0, 0, 1, 0]': 24, '[0, 0, 0, 0, 0, 0, 0, 1, 0]': 25, '[0, 1, 0, 0, 0, 0, 0, 0, 0]': 26, '[0, 0, 1, 1, 0, 0, 0, 0, 0]': 27, '[1, 0, 0, 0, 0, 0, 0, 0, 0]': 28, '[0, 0, 0, 0, 0, 0, 0, 1, 1]': 29, '[0, 0, 0, 0, 0, 0, 1, 1, 0]': 30, '[0, 0, 1, 0, 0, 0, 0, 0, 0]': 31, '[0, 1, 0, 0, 0, 0, 0, 1, 0]': 32, '[0, 0, 0, 0, 0, 1, 0, 0, 1]': 33, '[0, 0, 0, 0, 0, 1, 1, 0, 1]': 34, '[0, 0, 1, 0, 0, 0, 0, 1, 0]': 35, '[0, 0, 1, 0, 0, 0, 1, 0, 0]': 36, '[0, 0, 1, 0, 0, 0, 1, 1, 0]': 37, '[0, 0, 0, 1, 0, 1, 0, 0, 0]': 38, '[1, 0, 0, 0, 0, 0, 1, 1, 0]': 39, '[1, 0, 0, 0, 0, 0, 1, 0, 0]': 40, '[0, 1, 0, 1, 0, 0, 0, 0, 0]': 41, '[0, 0, 1, 0, 0, 0, 0, 0, 1]': 42, '[1, 0, 0, 0, 0, 0, 0, 1, 0]': 43, '[0, 0, 1, 0, 0, 0, 1, 0, 1]': 44, '[1, 1, 0, 0, 0, 0, 0, 0, 0]': 45, '[0, 0, 1, 0, 0, 1, 0, 0, 0]': 46, '[0, 0, 0, 0, 0, 1, 1, 1, 0]': 47, '[0, 1, 1, 0, 0, 0, 0, 0, 0]': 48} # from one hot to domain list decoder = {'[1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 1, 0, 0, 0]', '[0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 1, 1, 1]', '[0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 1, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 1, 0, 1, 0]', '[0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 0, 1, 0, 1]', '[0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 1, 0, 0, 0, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 0, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 1, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 1, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 1, 0, 0, 0, 0, 1, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 1, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 1, 1, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 1, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 1, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 1, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 1, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 1, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 1, 0, 1, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 0, 0, 1, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 0, 0, 1, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 1, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 1, 0, 0, 0, 1, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 1, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 1, 0, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 1, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 0, 1, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 0, 1, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 1, 0, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 1, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 0, 0, 1, 1, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 0, 1, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 0, 1, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[0, 0, 0, 1, 0, 1, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 0, 1, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 0, 1, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 0]': '[0, 1, 0, 1, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 0, 0, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0, 0]': '[1, 0, 0, 0, 0, 0, 0, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0, 0]': '[0, 0, 1, 0, 0, 0, 1, 0, 1]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 0]': '[1, 1, 0, 0, 0, 0, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0]': '[0, 0, 1, 0, 0, 1, 0, 0, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1, 0]': '[0, 0, 0, 0, 0, 1, 1, 1, 0]', '[0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 1]': '[0, 1, 1, 0, 0, 0, 0, 0, 0]'}

304.627907

8,928

0.34308

3,928

13,099

1.141548

0.026731

1.349688

1.851249

2.275647

0.844335

0.830955

0.737957

0

0.416912

0.300328

13,099

42

8,929

311.880952

0.07234

0.026949

0

0.076923

0

1.884615

0.878093

0

1

0

false

0

0.538462

0

0.538462

0.076923

0

1

null

1

0

1

0

1

0

1

0

null

0

1

0

1

0

18

e9b393ba7f8b4b260d3f0e50e9838089159cd2f1

34,894

py

Python

src/frr/tests/topotests/bgp_conditional_advertisement/test_bgp_conditional_advertisement.py

zhouhaifeng/vpe

9c644ffd561988e5740021ed26e0f7739844353d

[ "Apache-2.0" ]

null

src/frr/tests/topotests/bgp_conditional_advertisement/test_bgp_conditional_advertisement.py

zhouhaifeng/vpe

9c644ffd561988e5740021ed26e0f7739844353d

[ "Apache-2.0" ]

null

src/frr/tests/topotests/bgp_conditional_advertisement/test_bgp_conditional_advertisement.py

zhouhaifeng/vpe

9c644ffd561988e5740021ed26e0f7739844353d

[ "Apache-2.0" ]

null

#!/usr/bin/env python # # test_bgp_conditional_advertisement.py # # Copyright (c) 2020 by # Samsung R&D Institute India - Bangalore. # Madhurilatha Kuruganti # # Permission to use, copy, modify, and/or distribute this software # for any purpose with or without fee is hereby granted, provided # that the above copyright notice and this permission notice appear # in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NETDEF DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NETDEF BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY # DAMAGES WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, # WHETHER IN AN ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS # ACTION, ARISING OUT OF OR IN CONNECTION WITH THE USE OR PERFORMANCE # OF THIS SOFTWARE. # """ Test BGP conditional advertisement functionality. +--------+ +--------+ +--------+ | | | | | | | R1 |------------| R2 |------------| R3 | | | | | | | +--------+ +--------+ +--------+ R2 is DUT and peers with R1 and R3 in default bgp instance. Following tests are covered under BGP conditional advertisement functionality. Conditional advertisement ------------------------- TC11: R3 BGP convergence, without advertise-map configuration. All routes are advertised to R3. TC21: exist-map routes present in R2's BGP table. advertise-map routes present in R2's BGP table are advertised to R3. TC22: exist-map routes not present in R2's BGP table advertise-map routes present in R2's BGP table are withdrawn from R3. TC31: non-exist-map routes not present in R2's BGP table advertise-map routes present in R2's BGP table are advertised to R3. TC32: non-exist-map routes present in R2's BGP table advertise-map routes present in R2's BGP table are withdrawn from R3. TC41: non-exist-map route-map configuration removed in R2. advertise-map routes present in R2's BGP table are advertised to R3. TC42: exist-map route-map configuration removed in R2 advertise-map routes present in R2's BGP table are withdrawn from R3. Conditional advertisement(received routes) along with Route-map Filter ---------------------------------------------------------------------- TC51: exist-map routes present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 except advertise-map routes. TC52: exist-map routes present in R2's BGP table, without route-map filter. All routes are advertised to R3 including advertise-map routes. TC53: non-exist-map routes present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 including advertise-map routes. TC54: non-exist-map routes present in R2's BGP table, without route-map filter. All routes are advertised to R3 except advertise-map routes. TC61: exist-map routes not present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 including advertise-map routes. TC62: exist-map routes not present in R2's BGP table, without route-map filter. All routes are advertised to R3 except advertise-map routes. TC63: non-exist-map routes not present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 except advertise-map routes. TC64: non-exist-map routes not present in R2's BGP table, without route-map filter. All routes are advertised to R3 including advertise-map routes. Conditional advertisement(attached routes) along with Route-map Filter ----------------------------------------------------------------- TC71: exist-map routes present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 except advertise-map routes. TC72: exist-map routes present in R2's BGP table, without route-map filter. All routes are advertised to R3 including advertise-map routes. TC73: non-exist-map routes present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 including advertise-map routes. TC74: non-exist-map routes present in R2's BGP table, without route-map filter. All routes are advertised to R3 except advertise-map routes. TC81: exist-map routes not present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 including advertise-map routes. TC82: exist-map routes not present in R2's BGP table, without route-map filter. All routes are advertised to R3 except advertise-map routes. TC83: non-exist-map routes not present in R2's BGP table, with route-map filter. All routes are withdrawn from R3 except advertise-map routes. TC84: non-exist-map routes not present in R2's BGP table, without route-map filter. All routes are advertised to R3 including advertise-map routes. TC91: exist-map routes present in R2's BGP table, with route-map filter and network. All routes are advertised to R3 including advertise-map routes. TC92: exist-map routes present in R2's BGP table, with route-map filter and no network. All routes are advertised to R3 except advertise-map routes. TC93: non-exist-map routes not present in R2's BGP table, with route-map filter and network. All routes are advertised to R3 including advertise-map routes. TC94: non-exist-map routes not present in R2's BGP table, with route-map filter and no network. All routes are advertised to R3 except advertise-map routes. i.e. +----------------+-------------------------+------------------------+ | Routes in | exist-map status | advertise-map status | | BGP table | | | +----------------+-------------------------+------------------------+ | Present | Condition matched | Advertise | +----------------+-------------------------+------------------------+ | Not Present | Condition not matched | Withdrawn | +----------------+-------------------------+------------------------+ | | non-exist-map status | advertise-map status | | | | | +----------------+-------------------------+------------------------+ | Present | Condition matched | Withdrawn | +----------------+-------------------------+------------------------+ | Not Present | Condition not matched | Advertise | +----------------+-------------------------+------------------------+ Here in this topology, based on the default route presence in R2 and the configured condition-map (exist-map/non-exist-map) 10.139.224.0/20 will be either advertised/withdrawn to/from R3. """ import os import sys import json import time import pytest import functools CWD = os.path.dirname(os.path.realpath(__file__)) sys.path.append(os.path.join(CWD, "../")) # pylint: disable=C0413 from lib import topotest from lib.topogen import Topogen, TopoRouter, get_topogen from lib.topolog import logger pytestmark = [pytest.mark.bgpd] def build_topo(tgen): r1 = tgen.add_router("r1") r2 = tgen.add_router("r2") r3 = tgen.add_router("r3") switch = tgen.add_switch("s1") switch.add_link(r1) switch.add_link(r2) switch = tgen.add_switch("s2") switch.add_link(r2) switch.add_link(r3) def setup_module(mod): testsuite_run_time = time.asctime(time.localtime(time.time())) logger.info("Testsuite start time: {}".format(testsuite_run_time)) logger.info("=" * 40) logger.info("Running setup_module to create topology") tgen = Topogen(build_topo, mod.__name__) tgen.start_topology() router_list = tgen.routers() for i, (rname, router) in enumerate(router_list.items(), 1): router.load_config( TopoRouter.RD_ZEBRA, os.path.join(CWD, "{}/zebra.conf".format(rname)) ) router.load_config( TopoRouter.RD_BGP, os.path.join(CWD, "{}/bgpd.conf".format(rname)) ) tgen.start_router() logger.info("Running setup_module() done") def teardown_module(mod): """ Teardown the pytest environment * `mod`: module name """ logger.info("Running teardown_module to delete topology") tgen = get_topogen() tgen.stop_topology() logger.info( "Testsuite end time: {}".format(time.asctime(time.localtime(time.time()))) ) logger.info("=" * 40) def test_bgp_conditional_advertisement(): """ Test BGP conditional advertisement functionality. """ tgen = get_topogen() if tgen.routers_have_failure(): pytest.skip(tgen.errors) router1 = tgen.gears["r1"] router2 = tgen.gears["r2"] router3 = tgen.gears["r3"] passed = "PASSED!!!" failed = "FAILED!!!" def _all_routes_advertised(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": [{"protocol": "bgp"}], "192.0.2.1/32": [{"protocol": "bgp"}], "192.0.2.5/32": [{"protocol": "bgp"}], "10.139.224.0/20": [{"protocol": "bgp"}], "203.0.113.1/32": [{"protocol": "bgp"}], } return topotest.json_cmp(output, expected) def _all_routes_withdrawn(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": None, "192.0.2.1/32": None, "192.0.2.5/32": None, "10.139.224.0/20": None, "203.0.113.1/32": None, } return topotest.json_cmp(output, expected) # BGP conditional advertisement with route-maps # EXIST-MAP, ADV-MAP-1 and RMAP-1 def _exist_map_routes_present(router): return _all_routes_advertised(router) def _exist_map_routes_not_present(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": None, "192.0.2.1/32": None, "192.0.2.5/32": [{"protocol": "bgp"}], "10.139.224.0/20": None, "203.0.113.1/32": [{"protocol": "bgp"}], } return topotest.json_cmp(output, expected) def _non_exist_map_routes_present(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": [{"protocol": "bgp"}], "192.0.2.1/32": None, "192.0.2.5/32": [{"protocol": "bgp"}], "10.139.224.0/20": None, "203.0.113.1/32": [{"protocol": "bgp"}], } return topotest.json_cmp(output, expected) def _non_exist_map_routes_not_present(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": None, "192.0.2.1/32": [{"protocol": "bgp"}], "192.0.2.5/32": [{"protocol": "bgp"}], "10.139.224.0/20": [{"protocol": "bgp"}], "203.0.113.1/32": [{"protocol": "bgp"}], } return topotest.json_cmp(output, expected) def _exist_map_no_condition_route_map(router): return _non_exist_map_routes_present(router) def _non_exist_map_no_condition_route_map(router): return _all_routes_advertised(router) def _exist_map_routes_present_rmap_filter(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": None, "192.0.2.1/32": [{"protocol": "bgp"}], "192.0.2.5/32": None, "10.139.224.0/20": [{"protocol": "bgp"}], "203.0.113.1/32": None, } return topotest.json_cmp(output, expected) def _exist_map_routes_present_no_rmap_filter(router): return _all_routes_advertised(router) def _non_exist_map_routes_present_rmap_filter(router): return _all_routes_withdrawn(router) def _non_exist_map_routes_present_no_rmap_filter(router): return _non_exist_map_routes_present(router) def _exist_map_routes_not_present_rmap_filter(router): return _all_routes_withdrawn(router) def _exist_map_routes_not_present_no_rmap_filter(router): return _exist_map_routes_not_present(router) def _non_exist_map_routes_not_present_rmap_filter(router): return _exist_map_routes_present_rmap_filter(router) def _non_exist_map_routes_not_present_no_rmap_filter(router): return _non_exist_map_routes_not_present(router) # BGP conditional advertisement with route-maps # EXIST-MAP, ADV-MAP-2 and RMAP-2 def _exist_map_routes_not_present_rmap2_filter(router): return _all_routes_withdrawn(router) def _exist_map_routes_not_present_no_rmap2_filter(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": None, "192.0.2.1/32": [{"protocol": "bgp"}], "192.0.2.5/32": [{"protocol": "bgp"}], "10.139.224.0/20": [{"protocol": "bgp"}], "203.0.113.1/32": None, } return topotest.json_cmp(output, expected) def _non_exist_map_routes_not_present_rmap2_filter(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": None, "192.0.2.1/32": None, "192.0.2.5/32": None, "10.139.224.0/20": None, "203.0.113.1/32": [{"protocol": "bgp"}], } return topotest.json_cmp(output, expected) def _non_exist_map_routes_not_present_no_rmap2_filter(router): return _non_exist_map_routes_not_present(router) def _exist_map_routes_present_rmap2_filter(router): return _non_exist_map_routes_not_present_rmap2_filter(router) def _exist_map_routes_present_no_rmap2_filter(router): return _all_routes_advertised(router) def _non_exist_map_routes_present_rmap2_filter(router): return _all_routes_withdrawn(router) def _non_exist_map_routes_present_no_rmap2_filter(router): output = json.loads(router.vtysh_cmd("show ip route json")) expected = { "0.0.0.0/0": [{"protocol": "bgp"}], "192.0.2.1/32": [{"protocol": "bgp"}], "192.0.2.5/32": [{"protocol": "bgp"}], "10.139.224.0/20": [{"protocol": "bgp"}], "203.0.113.1/32": None, } return topotest.json_cmp(output, expected) def _exist_map_routes_present_rmap2_network(router): return _non_exist_map_routes_not_present_rmap2_filter(router) def _exist_map_routes_present_rmap2_no_network(router): return _all_routes_withdrawn(router) def _non_exist_map_routes_not_present_rmap2_network(router): return _non_exist_map_routes_not_present_rmap2_filter(router) def _non_exist_map_routes_not_present_rmap2_no_network(router): return _all_routes_withdrawn(router) # TC11: R3 BGP convergence, without advertise-map configuration. # All routes are advertised to R3. test_func = functools.partial(_all_routes_advertised, router3) success, result = topotest.run_and_expect(test_func, None, count=130, wait=1) msg = 'TC11: "router3" BGP convergence - ' assert result is None, msg + failed logger.info(msg + passed) # TC21: exist-map routes present in R2's BGP table. # advertise-map routes present in R2's BGP table are advertised to R3. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 advertise-map ADV-MAP-1 exist-map EXIST-MAP """ ) test_func = functools.partial(_exist_map_routes_present, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = 'TC21: exist-map routes present in "router2" BGP table - ' assert result is None, msg + failed logger.info(msg + passed) # TC22: exist-map routes not present in R2's BGP table # advertise-map routes present in R2's BGP table are withdrawn from R3. router1.vtysh_cmd( """ configure terminal router bgp 1 address-family ipv4 unicast no network 0.0.0.0/0 route-map DEF """ ) test_func = functools.partial(_exist_map_routes_not_present, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = 'TC22: exist-map routes not present in "router2" BGP table - ' assert result is None, msg + failed logger.info(msg + passed) # TC31: non-exist-map routes not present in R2's BGP table # advertise-map routes present in R2's BGP table are advertised to R3. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 advertise-map ADV-MAP-1 non-exist-map EXIST-MAP """ ) test_func = functools.partial(_non_exist_map_routes_not_present, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = 'TC31: non-exist-map routes not present in "router2" BGP table - ' assert result is None, msg + failed logger.info(msg + passed) # TC32: non-exist-map routes present in R2's BGP table # advertise-map routes present in R2's BGP table are withdrawn from R3. router1.vtysh_cmd( """ configure terminal router bgp 1 address-family ipv4 unicast network 0.0.0.0/0 route-map DEF """ ) test_func = functools.partial(_non_exist_map_routes_present, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = 'TC32: non-exist-map routes present in "router2" BGP table - ' assert result is None, msg + failed logger.info(msg + passed) # TC41: non-exist-map route-map configuration removed in R2. # advertise-map routes present in R2's BGP table are advertised to R3. router2.vtysh_cmd( """ configure terminal no route-map EXIST-MAP permit 10 """ ) test_func = functools.partial(_non_exist_map_no_condition_route_map, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = 'TC41: non-exist-map route-map removed in "router2" - ' assert result is None, msg + failed logger.info(msg + passed) # TC42: exist-map route-map configuration removed in R2 # advertise-map routes present in R2's BGP table are withdrawn from R3. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 advertise-map ADV-MAP-1 exist-map EXIST-MAP """ ) test_func = functools.partial(_exist_map_no_condition_route_map, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = 'TC42: exist-map route-map removed in "router2" - ' assert result is None, msg + failed logger.info(msg + passed) # TC51: exist-map routes present in R2's BGP table, with route-map filter. # All routes are withdrawn from R3 except advertise-map routes. router2.vtysh_cmd( """ configure terminal route-map EXIST-MAP permit 10 match community DEFAULT-ROUTE match ip address prefix-list DEFAULT-ROUTE ! router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-1 out """ ) test_func = functools.partial(_exist_map_routes_present_rmap_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC51: exist-map routes present with route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC52: exist-map routes present in R2's BGP table, no route-map filter. # All routes are advertised to R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-1 out """ ) test_func = functools.partial(_exist_map_routes_present_no_rmap_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC52: exist-map routes present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC53: non-exist-map routes present in R2's BGP table, with route-map filter. # All routes are withdrawn from R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-1 out neighbor 10.10.20.3 advertise-map ADV-MAP-1 non-exist-map EXIST-MAP """ ) test_func = functools.partial(_non_exist_map_routes_present_rmap_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC53: non-exist-map routes present, with route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC54: non-exist-map routes present in R2's BGP table, no route-map filter. # All routes are advertised to R3 except advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-1 out """ ) test_func = functools.partial(_non_exist_map_routes_present_no_rmap_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC54: non-exist-map routes present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC61: exist-map routes not present in R2's BGP table, with route-map filter. # All routes are withdrawn from R3 including advertise-map routes. router1.vtysh_cmd( """ configure terminal router bgp 1 address-family ipv4 unicast no network 0.0.0.0/0 route-map DEF """ ) router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-1 out neighbor 10.10.20.3 advertise-map ADV-MAP-1 exist-map EXIST-MAP """ ) test_func = functools.partial(_exist_map_routes_not_present_rmap_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC61: exist-map routes not present, route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC62: exist-map routes not present in R2's BGP table, without route-map filter. # All routes are advertised to R3 except advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-1 out """ ) test_func = functools.partial(_exist_map_routes_not_present_no_rmap_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC62: exist-map routes not present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC63: non-exist-map routes not present in R2's BGP table, with route-map filter. # All routes are withdrawn from R3 except advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-1 out neighbor 10.10.20.3 advertise-map ADV-MAP-1 non-exist-map EXIST-MAP """ ) test_func = functools.partial( _non_exist_map_routes_not_present_rmap_filter, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC63: non-exist-map routes not present, route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC64: non-exist-map routes not present in R2's BGP table, without route-map filter. # All routes are advertised to R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-1 out """ ) test_func = functools.partial( _non_exist_map_routes_not_present_no_rmap_filter, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC64: non-exist-map routes not present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC71: exist-map routes present in R2's BGP table, with route-map filter. # All routes are withdrawn from R3 except advertise-map routes. router1.vtysh_cmd( """ configure terminal router bgp 1 address-family ipv4 unicast network 0.0.0.0/0 route-map DEF """ ) router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-2 out neighbor 10.10.20.3 advertise-map ADV-MAP-2 exist-map EXIST-MAP """ ) test_func = functools.partial(_exist_map_routes_present_rmap2_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC71: exist-map routes present, route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC72: exist-map routes present in R2's BGP table, without route-map filter. # All routes are advertised to R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-2 out """ ) test_func = functools.partial(_exist_map_routes_present_no_rmap2_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC72: exist-map routes present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC73: non-exist-map routes present in R2's BGP table, with route-map filter. # All routes are advertised to R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-2 out neighbor 10.10.20.3 advertise-map ADV-MAP-2 non-exist-map EXIST-MAP """ ) test_func = functools.partial(_non_exist_map_routes_present_rmap2_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC73: non-exist-map routes present, route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC74: non-exist-map routes present in R2's BGP table, without route-map filter. # All routes are advertised to R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-2 out """ ) test_func = functools.partial( _non_exist_map_routes_present_no_rmap2_filter, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC74: non-exist-map routes present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC81: exist-map routes not present in R2's BGP table, with route-map filter. # All routes are withdrawn from R3 including advertise-map routes. router1.vtysh_cmd( """ configure terminal router bgp 1 address-family ipv4 unicast no network 0.0.0.0/0 route-map DEF """ ) router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-2 out neighbor 10.10.20.3 advertise-map ADV-MAP-2 exist-map EXIST-MAP """ ) test_func = functools.partial(_exist_map_routes_not_present_rmap2_filter, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC81: exist-map routes not present, route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC82: exist-map routes not present in R2's BGP table, without route-map filter. # All routes are advertised to R3 except advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-2 out """ ) test_func = functools.partial( _exist_map_routes_not_present_no_rmap2_filter, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC82: exist-map routes not present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC83: non-exist-map routes not present in R2's BGP table, with route-map filter. # All routes are advertised to R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-2 out neighbor 10.10.20.3 advertise-map ADV-MAP-2 non-exist-map EXIST-MAP """ ) test_func = functools.partial( _non_exist_map_routes_not_present_rmap2_filter, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC83: non-exist-map routes not present, route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC84: non-exist-map routes not present in R2's BGP table, without route-map filter. # All routes are advertised to R3 including advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no neighbor 10.10.20.3 route-map RMAP-2 out """ ) test_func = functools.partial( _non_exist_map_routes_not_present_no_rmap2_filter, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC84: non-exist-map routes not present, no route-map filter - " assert result is None, msg + failed logger.info(msg + passed) # TC91: exist-map routes present in R2's BGP table, with route-map filter and network. # All routes are advertised to R3 including advertise-map routes. router1.vtysh_cmd( """ configure terminal router bgp 1 address-family ipv4 unicast network 0.0.0.0/0 route-map DEF """ ) router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast neighbor 10.10.20.3 route-map RMAP-2 out neighbor 10.10.20.3 advertise-map ADV-MAP-2 exist-map EXIST-MAP """ ) test_func = functools.partial(_exist_map_routes_present_rmap2_network, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC91: exist-map routes present, route-map filter and network - " assert result is None, msg + failed logger.info(msg + passed) # TC92: exist-map routes present in R2's BGP table, with route-map filter and no network. # All routes are advertised to R3 except advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no network 203.0.113.1/32 """ ) test_func = functools.partial(_exist_map_routes_present_rmap2_no_network, router3) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC92: exist-map routes present, route-map filter and no network - " assert result is None, msg + failed logger.info(msg + passed) # TC93: non-exist-map routes not present in R2's BGP table, with route-map filter and network. # All routes are advertised to R3 including advertise-map routes. router1.vtysh_cmd( """ configure terminal router bgp 1 address-family ipv4 unicast no network 0.0.0.0/0 route-map DEF """ ) router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast network 203.0.113.1/32 neighbor 10.10.20.3 advertise-map ADV-MAP-2 non-exist-map EXIST-MAP """ ) test_func = functools.partial( _non_exist_map_routes_not_present_rmap2_network, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC93: non-exist-map routes not present, route-map filter and network - " assert result is None, msg + failed logger.info(msg + passed) # TC94: non-exist-map routes not present in R2's BGP table, with route-map filter and no network. # All routes are advertised to R3 except advertise-map routes. router2.vtysh_cmd( """ configure terminal router bgp 2 address-family ipv4 unicast no network 203.0.113.1/32 """ ) test_func = functools.partial( _non_exist_map_routes_not_present_rmap2_no_network, router3 ) success, result = topotest.run_and_expect(test_func, None, count=90, wait=1) msg = "TC94: non-exist-map routes not present, route-map filter and no network - " assert result is None, msg + failed logger.info(msg + passed) def test_memory_leak(): "Run the memory leak test and report results." tgen = get_topogen() if not tgen.is_memleak_enabled(): pytest.skip("Memory leak test/report is disabled") tgen.report_memory_leaks() if __name__ == "__main__": args = ["-s"] + sys.argv[1:] sys.exit(pytest.main(args))

36.347917

101

0.636585

4,801

34,894

4.484691

0.062487

0.075658

0.083879

0.0529

0.881287

0.864428

0.853328

0.847383

0.837072

0.827876

0

0.047893

0.25202

34,894

959

102

36.385819

0.77705

0.309881

0

0.534483

0

0.157228

0

0.066502

1

0.081281

false

0.068966

0.022167

0.046798

0.172414

0

null

0

1

0

null

0

1

0

7

e9c236bac4581f2fc6513b618ef715f2d352c951

275

py

Python

tests/test_version.py

simonsobs/productdb

60daf768ee8f30169e9947dda1a6dc4ffcf89e11

[ "MIT" ]

null

tests/test_version.py

simonsobs/productdb

60daf768ee8f30169e9947dda1a6dc4ffcf89e11

[ "MIT" ]

4

2022-02-07T15:12:14.000Z

2022-03-18T14:00:49.000Z

tests/test_version.py

simonsobs/productdb

60daf768ee8f30169e9947dda1a6dc4ffcf89e11

[ "MIT" ]

null

import productdb ##__________________________________________________________________|| def test_version(): """test if the version string is attached to the module """ productdb.__version__ ##__________________________________________________________________||

27.5

70

0.818182

17

275

5.176471

0.705882

0

0.116364

275

9

71

30.555556

0.36214

0.705455

0

1

0.333333

true

0

0.333333

0

0.666667

0

1

0

null

0

1

0

1

0

null

0

1

0

1

0

1

0

7

e9d0eaca046ba2b0d678f1ccf5bb92bfbdabfb40

360

py

Python

bradfield/test_x5_06_islands.py

savarin/algorithms

4d1f8f2361de12a02f376883f648697562d177ae

[ "MIT" ]

1

2020-06-16T23:22:54.000Z

bradfield/test_x5_06_islands.py

savarin/algorithms

4d1f8f2361de12a02f376883f648697562d177ae

[ "MIT" ]

null

bradfield/test_x5_06_islands.py

savarin/algorithms

4d1f8f2361de12a02f376883f648697562d177ae

[ "MIT" ]

null

from x5_06_islands import count_islands def test_count_islands(): assert count_islands(["11110", "11010", "11000", "00000"]) == 1 assert count_islands(["11000", "11000", "00100", "00011"]) == 3

27.692308

40

0.380556

27

360

4.814815

0.62963

0.369231

0.276923

0

0.258621

0.516667

360

12

41

30

0.488506

0

0.2

0

0.111111

0

0.2

1

0.1

true

0

0.1

0

0.2

0

1

0

null

1

0

1

0

1

0

null

0

1

0

7

759060a1999016f32923d065f83a7b0e2712e755

3,484

py

Python

www/courses/cs1120/spring2017/code/day22.py

ic4f/sergey.cs.uni.edu

52bbf121f73603fdb465dae36dbe691fe39e6e47

[ "Unlicense" ]

null

www/courses/cs1120/spring2017/code/day22.py

ic4f/sergey.cs.uni.edu

52bbf121f73603fdb465dae36dbe691fe39e6e47

[ "Unlicense" ]

null

www/courses/cs1120/spring2017/code/day22.py

ic4f/sergey.cs.uni.edu

52bbf121f73603fdb465dae36dbe691fe39e6e47

[ "Unlicense" ]

null

#simple flip def flip(source): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) for x in range(width): for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getPixel(target, y, x) setColor(targetPixel, getColor(sourcePixel)) return target #version 1 def rotate90(source): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) y1 = 0 for x in range(width): x1 = width - 1 for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getPixel(target, x1, y1) setColor( targetPixel, getColor(sourcePixel)) x1 -= 1 y1 += 1 return target def rotate270(source): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) x1 = width - 1 for x in range(width): y1 = 0 for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getPixel(target, y1, x1) setColor(targetPixel, getColor(sourcePixel)) y1 += 1 x1 -= 1 return target def rotate180(source): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) x1 = width - 1 for x in range(width): y1 = width - 1 for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getPixel(target, x1, y1) setColor(targetPixel, getColor(sourcePixel)) y1 -= 1 x1 -= 1 return target #version 2 def simpleRotate90(source): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) for x in range(width): for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getPixel(target, width-1-x, y) setColor(targetPixel, getColor(sourcePixel)) return target def simpleRotate180(source): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) for x in range(width): for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getPixel(target, width-1-x, width-1-y) setColor(targetPixel, getColor(sourcePixel)) return target def simpleRotate270(source): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) for x in range(width): for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getPixel(target, x, width-1-y) setColor(targetPixel, getColor(sourcePixel)) return target #version 3 def rotate(source, angle): width = getWidth(source) height = getHeight(source) target = makeEmptyPicture(width, height) for x in range(width): for y in range(height): sourcePixel = getPixel(source, x, y) targetPixel = getRotatedPixel(target, x, y, width, angle) setColor(targetPixel, getColor(sourcePixel)) return target #helper fucntion def getRotatedPixel(picture, x, y, width, angle): if angle == 90: return getPixel(picture, width-1-x, y) elif angle == 180: return getPixel(picture, width-1-x, width-1-y) elif angle == 270: return getPixel(picture, x, width-1-y) else: return getPixel(picture, x, y)

29.033333

64

0.625144

406

3,484

5.364532

0.1133

0.051423

0.069789

0.091827

0.847107

0.839761

0.787879

0.758494

0.732323

0

0.025702

0.27411

3,484

119

65

29.277311

0.835508

0.016361

0

0.752475

0

1

0.089109

false

0

0.207921

0

null

0

1

0

1

0

null

0

7

75af6de348f0dd59512a30c770859dd1c7ae40fa

14,597

py

Python

pyreach/impl/snapshot_impl_test.py

google-research/pyreach

f91753ce7a26e77e122eb02a9fdd5a1ce3ce0159

[ "Apache-2.0" ]

13

2021-09-01T01:10:22.000Z

2022-03-05T10:01:52.000Z

pyreach/impl/snapshot_impl_test.py

google-research/pyreach

f91753ce7a26e77e122eb02a9fdd5a1ce3ce0159

[ "Apache-2.0" ]

null

pyreach/impl/snapshot_impl_test.py

google-research/pyreach

f91753ce7a26e77e122eb02a9fdd5a1ce3ce0159

[ "Apache-2.0" ]

6

2021-09-20T21:17:53.000Z

2022-03-14T18:42:48.000Z

# Copyright 2021 Google LLC # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. """Tests for snapshot_impl.""" import json import unittest from pyreach.common.proto_gen import logs_pb2 from pyreach import snapshot from pyreach.common.python import types_gen from pyreach.core import PyReachStatus from pyreach.impl import snapshot_impl class SnapshotImpl(unittest.TestCase): def test_reverse_snapshot(self) -> None: self.assertIsNone(snapshot_impl.reverse_snapshot(None)) snapshot_cmd = snapshot_impl.reverse_snapshot( types_gen.Snapshot( source="pyreach-test", device_data_refs=[types_gen.DeviceDataRef(ts=2000, seq=1)], responses=[ types_gen.SnapshotResponse( cid=5, gym_element_type="vacuum", gym_config_name="test-vacuum", device_data_ref=types_gen.DeviceDataRef(ts=3000, seq=4)), types_gen.SnapshotResponse( cid=6, gym_element_type="arm", gym_config_name="test-arm", device_data_ref=types_gen.DeviceDataRef(ts=7000, seq=0), status=types_gen.Status( status="test-status", script="test-script", error="test-error", progress=8.0, message="test-message", code=9)), types_gen.SnapshotResponse( cid=10, gym_element_type="oracle", gym_config_name="test-oracle", device_data_ref=types_gen.DeviceDataRef(ts=11000, seq=12), status=types_gen.Status( status="test-status", script="test-script", error="test-error", progress=13.0, message="test-message", code=14)), ], gym_server_ts=1, gym_actions=[ types_gen.GymAction( device_type="test-type", device_name="test-name", synchronous=True), types_gen.GymAction( device_type="test-vacuum", device_name="vacuum", synchronous=True, vacuum_action_params=types_gen.VacuumActionParams(1)), types_gen.GymAction( device_type="test-logger", device_name="logger", synchronous=False, logger_action_params=types_gen.LoggerActionParams([ types_gen.KeyValue(key="1", value="2"), types_gen.KeyValue(key="3", value="4") ], True)), types_gen.GymAction( device_type="test-arm", device_name="arm", synchronous=True, arm_action_params=types_gen.ArmActionParams( command=1, cid=2, joint_angles=[1.1, 2.2, 3.3, 4.4, 5.5, 6.6], pose=[1.0, 2.0, 3.0, 4.0, 5.0, 6.0], reach_action=3, timeout_sec=6.0, use_linear=True, velocity=4.0, acceleration=5.0, action_name="test-action", use_unity_ik=True, intent="test-intent", success_type="success", pick_id="test-id", apply_tip_adjust_transform=True, servo=True, servo_t_secs=7.0, servo_lookahead_time_secs=8.0, servo_gain=9.0, allow_uncalibrated=True, controller_name="test-controller")), types_gen.GymAction( device_type="test-client", device_name="client", synchronous=True, client_annotation_action_params=types_gen .ClientAnnotationActionParams( annotation=types_gen.ClientAnnotation( text_annotation=types_gen.TextAnnotation( category="test-category", text="test-text")))), ], gym_env_id="test-env-id", gym_run_id="test-run-id", gym_episode=1, gym_step=2, gym_reward=3.0, gym_done=True)) assert snapshot_cmd is not None expect_snapshot = snapshot.Snapshot( source="pyreach-test", device_data_refs=(snapshot.SnapshotReference(2.0, 1),), responses=(snapshot.SnapshotResponse(5, "vacuum", "test-vacuum", snapshot.SnapshotReference(3.0, 4)), snapshot.SnapshotResponse( 6, "arm", "test-arm", PyReachStatus( time=7.0, status="test-status", script="test-script", error="test-error", progress=8.0, message="test-message", code=9)), snapshot.SnapshotResponse( 10, "oracle", "test-oracle", snapshot.SnapshotReference(11.0, 12))), gym_server_time=0.001, gym_env_id="test-env-id", gym_run_id="test-run-id", gym_episode=1, gym_step=2, gym_reward=3.0, gym_done=True, gym_actions=(snapshot.SnapshotGymAction("test-type", "test-name", True), snapshot.SnapshotGymVacuumAction("test-vacuum", "vacuum", True, 1), snapshot.SnapshotGymLoggerAction("test-logger", "logger", False, True, { "1": "2", "3": "4" }), snapshot.SnapshotGymArmAction( "test-arm", "arm", True, 1, 2, (1.1, 2.2, 3.3, 4.4, 5.5, 6.6), (1.0, 2.0, 3.0, 4.0, 5.0, 6.0), True, 4.0, 5.0, 6.0, "test-action", True, "test-intent", "success", "test-id", True, True, 7.0, 8.0, 9.0, True, "test-controller"), snapshot.SnapshotGymClientAnnotationAction( "test-client", "client", True, logs_pb2.ClientAnnotation( text_annotation=logs_pb2.TextAnnotation( category="test-category", text="test-text"))))) self.assertEqual(expect_snapshot, snapshot_cmd) def test_convert_snapshot(self) -> None: self.assertIsNone(snapshot_impl.convert_snapshot(None)) snapshot_cmd = snapshot_impl.convert_snapshot( snapshot.Snapshot( source="pyreach-test", device_data_refs=(snapshot.SnapshotReference(2.0, 1),), responses=(snapshot.SnapshotResponse( 5, "vacuum", "test-vacuum", snapshot.SnapshotReference(3.0, 4)), snapshot.SnapshotResponse( 6, "arm", "test-arm", PyReachStatus( time=7.0, status="test-status", script="test-script", error="test-error", progress=8.0, message="test-message", code=9)), snapshot.SnapshotResponse( 10, "oracle", "test-oracle", PyReachStatus( time=11.0, sequence=12, status="test-status", script="test-script", error="test-error", progress=13.0, message="test-message", code=14))), gym_server_time=0.001, gym_env_id="test-env-id", gym_run_id="test-run-id", gym_episode=1, gym_step=2, gym_reward=3.0, gym_done=True, gym_actions=( snapshot.SnapshotGymAction("test-type", "test-name", True), snapshot.SnapshotGymVacuumAction("test-vacuum", "vacuum", True, 1), snapshot.SnapshotGymLoggerAction("test-logger", "logger", False, True, { "1": "2", "3": "4" }), snapshot.SnapshotGymArmAction( "test-arm", "arm", True, 1, 2, (1.1, 2.2, 3.3, 4.4, 5.5, 6.6), (1.0, 2.0, 3.0, 4.0, 5.0, 6.0), True, 4.0, 5.0, 6.0, "test-action", True, "test-intent", "success", "test-id", True, True, 7.0, 8.0, 9.0, True, "test-controller"), snapshot.SnapshotGymClientAnnotationAction( "test-client", "client", True, logs_pb2.ClientAnnotation( text_annotation=logs_pb2.TextAnnotation( category="test-category", text="test-text")), )))) self.assertIsNotNone(snapshot_cmd) expect_snapshot = types_gen.Snapshot( source="pyreach-test", device_data_refs=[types_gen.DeviceDataRef(ts=2000, seq=1)], responses=[ types_gen.SnapshotResponse( cid=5, gym_element_type="vacuum", gym_config_name="test-vacuum", device_data_ref=types_gen.DeviceDataRef(ts=3000, seq=4)), types_gen.SnapshotResponse( cid=6, gym_element_type="arm", gym_config_name="test-arm", device_data_ref=types_gen.DeviceDataRef(ts=7000), status=types_gen.Status( status="test-status", script="test-script", error="test-error", progress=8.0, message="test-message", code=9)), types_gen.SnapshotResponse( cid=10, gym_element_type="oracle", gym_config_name="test-oracle", device_data_ref=types_gen.DeviceDataRef(ts=11000, seq=12)) ], gym_server_ts=1, gym_actions=[ types_gen.GymAction( device_type="test-type", device_name="test-name", synchronous=True), types_gen.GymAction( device_type="test-vacuum", device_name="vacuum", synchronous=True, vacuum_action_params=types_gen.VacuumActionParams(1)), types_gen.GymAction( device_type="test-logger", device_name="logger", synchronous=False, logger_action_params=types_gen.LoggerActionParams([ types_gen.KeyValue(key="1", value="2"), types_gen.KeyValue(key="3", value="4") ], True)), types_gen.GymAction( device_type="test-arm", device_name="arm", synchronous=True, arm_action_params=types_gen.ArmActionParams( command=1, cid=2, joint_angles=[1.1, 2.2, 3.3, 4.4, 5.5, 6.6], pose=[1.0, 2.0, 3.0, 4.0, 5.0, 6.0], timeout_sec=6.0, use_linear=True, velocity=4.0, acceleration=5.0, action_name="test-action", use_unity_ik=True, intent="test-intent", success_type="success", pick_id="test-id", apply_tip_adjust_transform=True, servo=True, servo_t_secs=7.0, servo_lookahead_time_secs=8.0, servo_gain=9.0, allow_uncalibrated=True, controller_name="test-controller")), types_gen.GymAction( device_type="test-client", device_name="client", synchronous=True, client_annotation_action_params=types_gen .ClientAnnotationActionParams( annotation=types_gen.ClientAnnotation( text_annotation=types_gen.TextAnnotation( category="test-category", text="test-text")))), ], gym_env_id="test-env-id", gym_run_id="test-run-id", gym_episode=1, gym_step=2, gym_reward=3.0, gym_done=True) assert snapshot_cmd is not None self.assertEqual( json.dumps(snapshot_cmd.to_json(), indent=" "), json.dumps(expect_snapshot.to_json(), indent=" ")) if __name__ == "__main__": unittest.main()

44.233333

80

0.457902

1,351

14,597

4.757957

0.15248

0.05725

0.026447

0.035781

0.845675

0.834785

0.821095

0

0.039199

0.442488

14,597

329

81

44.367781

0.750676

0.039323

0

0.788274

0

0.087112

0

0.022801

1

0.006515

false

0

0.022801

0

0.032573

0

null

0

1

0

1

0

null

0

7

75edff7319a280ed53c002e562449bd0a8f3e32d

7,200

py

Python

agent.py

brunobelluomini/flappy_bird_with_TD_learning

d8d9b8d30c8826b344efa875b7d02f2163a189f1

[ "MIT" ]

null

agent.py

brunobelluomini/flappy_bird_with_TD_learning

d8d9b8d30c8826b344efa875b7d02f2163a189f1

[ "MIT" ]

16

2020-01-28T22:54:11.000Z

2022-03-11T23:56:22.000Z

agent.py

brunobelluomini/flappy_bird_with_TD_learning

d8d9b8d30c8826b344efa875b7d02f2163a189f1

[ "MIT" ]

1

2019-09-26T11:46:20.000Z

import numpy as np from collections import defaultdict import json import os def make_epsilon_greedy_policy(action_space_size, Q_state, epsilon): epsilon = max(epsilon, 0.10) policy_state = np.ones(action_space_size) * epsilon / action_space_size policy_state[np.argmax(Q_state)] = 1 - epsilon + (epsilon / action_space_size) return policy_state def choose_action_from_policy(action_space, policy): available_actions = np.arange(action_space) return np.random.choice(available_actions, p=policy) def update_Q_values(alpha, reward, gamma, Q_current_action, Q_next_action): return Q_current_action + alpha * (reward + gamma * Q_next_action - Q_current_action) class Sarsa: def __init__(self, action_space, alpha=0.15, gamma=1.0, epsilon=1.0, force_training=False): self.action_space = action_space self.Q = self.load_q_values(force_training) self.alpha = alpha self.gamma = gamma self.epsilon = epsilon def learn(self, env): state = env.get_state() epsilon_greedy_policy = make_epsilon_greedy_policy( self.action_space, self.Q[state], self.epsilon ) action = choose_action_from_policy(self.action_space, epsilon_greedy_policy) while True: next_state, reward, done = env.step(action) epsilon_greedy_policy = make_epsilon_greedy_policy( self.action_space, self.Q[next_state], self.epsilon ) next_action = choose_action_from_policy(self.action_space, epsilon_greedy_policy) Q_current_action = self.Q[state][action] Q_next_action = self.Q[next_state][next_action] self.Q[next_state][next_action] = update_Q_values( self.alpha, reward, self.gamma, Q_current_action, Q_next_action ) state = next_state action = next_action if done: break def act(self, state): epsilon_greedy_policy = make_epsilon_greedy_policy( self.action_space, self.Q[state], self.epsilon ) action = choose_action_from_policy(self.action_space, epsilon_greedy_policy) return action def load_q_values(self, force_training): if force_training or not os.path.exists('sarsa_q_values.json'): return defaultdict(lambda: [0 for action in range(self.action_space)]) else: q_values_file = open('sarsa_q_values.json', 'r') q_values = json.load(q_values_file) q_values_file.close() return defaultdict(lambda: [0 for action in range(self.action_space)], q_values) def save_q_values(self): q_values_file = open('sarsa_q_values.json', 'w') json.dump(dict(self.Q), q_values_file) q_values_file.close() class QLearning: def __init__(self, action_space, alpha=0.15, gamma=1.0, epsilon=1.0, force_training=False): self.action_space = action_space self.Q = self.load_q_values(force_training) self.alpha = alpha self.gamma = gamma self.epsilon = epsilon def learn(self, env): state = env.get_state() while True: epsilon_greedy_policy = make_epsilon_greedy_policy( self.action_space, self.Q[state], self.epsilon ) action = choose_action_from_policy(self.action_space, epsilon_greedy_policy) next_state, reward, done = env.step(action) max_Q_a = np.max( [self.Q[next_state][next_action] for next_action in np.arange(self.action_space)] ) self.Q[state][action] = update_Q_values( self.alpha, reward, self.gamma, self.Q[state][action], max_Q_a ) state = next_state if done: break def act(self, state): epsilon_greedy_policy = make_epsilon_greedy_policy( self.action_space, self.Q[state], self.epsilon ) action = choose_action_from_policy(self.action_space, epsilon_greedy_policy) return action def load_q_values(self, force_training): if force_training or not os.path.exists('q_learning_q_values.json'): return defaultdict(lambda: [0 for action in range(self.action_space)]) else: q_values_file = open('q_learning_q_values.json', 'r') q_values = json.load(q_values_file) q_values_file.close() return defaultdict(lambda: [0 for action in range(self.action_space)], q_values) def save_q_values(self): q_values_file = open('q_learning_q_values.json', 'w') json.dump(dict(self.Q), q_values_file) q_values_file.close() class ExpectedSarsa: def __init__(self, action_space, alpha=0.15, gamma=1.0, epsilon=1.0, force_training=False): self.action_space = action_space self.Q = self.load_q_values(force_training) self.alpha = alpha self.gamma = gamma self.epsilon = epsilon def learn(self, env): state = env.get_state() while True: epsilon_greedy_policy = make_epsilon_greedy_policy( self.action_space, self.Q[state], self.epsilon ) action = choose_action_from_policy(self.action_space, epsilon_greedy_policy) next_state, reward, done = env.step(action) next_policy = make_epsilon_greedy_policy( self.action_space, self.Q[next_state], self.epsilon ) expected_Q = np.dot(self.Q[next_state], next_policy) self.Q[state][action] = update_Q_values( self.alpha, reward, self.gamma, self.Q[state][action], expected_Q ) state = next_state if done: break def act(self, state): epsilon_greedy_policy = make_epsilon_greedy_policy( self.action_space, self.Q[state], self.epsilon ) action = choose_action_from_policy(self.action_space, epsilon_greedy_policy) return action def load_q_values(self, force_training): if force_training or not os.path.exists('expected_sarsa_q_values.json'): return defaultdict(lambda: [0 for action in range(self.action_space)]) else: q_values_file = open('expected_sarsa_q_values.json', 'r') q_values = json.load(q_values_file) q_values_file.close() return defaultdict(lambda: [0 for action in range(self.action_space)], q_values) def save_q_values(self): q_values_file = open('expected_sarsa_q_values.json', 'w') json.dump(dict(self.Q), q_values_file) q_values_file.close()

31.441048

97

0.603333

893

7,200

4.539754

0.091825

0.079428

0.103601

0.077701

0.839665

0.831031

0.821411

0.799951

0.787124

0.76813

0

0.006255

0.311667

7,200

229

98

31.441048

0.811743

0

0.705202

0

0.030412

0.021664

0

1

0.104046

false

0

0.023121

0.00578

0.213873

0

null

0

1

0

1

0

null

0

7

75f333d35175c349af522154baffc1dbb13420f6

27

py

Python

zhongwen/121212.py

zhangbo2008/transformer

bd627f121478a0467b18766d1e275f4ac7120f9a

[ "Apache-2.0" ]

null

zhongwen/121212.py

zhangbo2008/transformer

bd627f121478a0467b18766d1e275f4ac7120f9a

[ "Apache-2.0" ]

null

zhongwen/121212.py

zhangbo2008/transformer

bd627f121478a0467b18766d1e275f4ac7120f9a

[ "Apache-2.0" ]

null

print((148**2+166**2)**0.5)

27

0.555556

7

27

2.142857

0.857143

0

0.37037

0

27

1

27

0.185185

0

1

0

true

0

1

0

null

0

1

0

1

0

1

0

null

0

1

0

1

0

7

f93289bcdaba7697408aa6879dbe7db913d552f6

148

py

Python

pcap3103/using_modules/main.py

owaishanif786/python

212d626e10bebf161ee123459dc5f0384d9540ac

[ "MIT" ]

null

pcap3103/using_modules/main.py

owaishanif786/python

212d626e10bebf161ee123459dc5f0384d9540ac

[ "MIT" ]

null

pcap3103/using_modules/main.py

owaishanif786/python

212d626e10bebf161ee123459dc5f0384d9540ac

[ "MIT" ]

null

import helpers print(f"Uppercase Letters: {helpers.extract_upper(helpers.NAME)}") print(f"Lowercase letter: {helpers.extract_lower(helpers.NAME)}")

37

66

0.797297

20

148

5.8

0.6

0.103448

0

0.054054

148

4

67

37

0.828571

0

0.744966

0.496644

0

1

0

true

0

0.333333

0

0.333333

0.666667

1

0

null

0

1

0

1

null

0

1

0

1

0

1

0

7

f9ae395bee09b1daebade5ce15e737f2fb397aef

4,985

py

Python

tests/test_multivariate_def.py

altosaar/deep-exponential-families-gluon

80d69b54081f622c0012bb181aa6d8ab9a740f15

[ "MIT" ]

19

2017-10-17T01:04:23.000Z

2021-11-14T20:50:56.000Z

tests/test_multivariate_def.py

afcarl/deep-exponential-families-gluon

80d69b54081f622c0012bb181aa6d8ab9a740f15

[ "MIT" ]

null

tests/test_multivariate_def.py

afcarl/deep-exponential-families-gluon

80d69b54081f622c0012bb181aa6d8ab9a740f15

[ "MIT" ]

1

2018-07-05T21:17:34.000Z

import numpy as np import tester def test_one_layer_gaussian(): """Test variational EM with pathwise gradients.""" config = """ learning_rate: 0.1 n_iterations: 100 gradient: estimator: pathwise n_samples: 7 batch_size: 1 layer_1: latent_distribution: gaussian p_z_variance: 1. size: 3 layer_0: weight_distribution: point_mass p_w_variance: 1. data_size: 1 """ data = np.array([[3.3]]) def test_posterior_predictive(sample: np.array) -> None: print('data:', data) print('posterior predictive sample:', sample) np.testing.assert_allclose(sample, data, rtol=1e-1) tester.test( config, data=data, test_fn=test_posterior_predictive) def test_one_layer_gaussian_score(): """Test variational EM with score function gradients.""" config = """ learning_rate: 0.1 n_iterations: 100 print_every: 100 gradient: estimator: score_function n_samples: 32 batch_size: 1 layer_1: latent_distribution: gaussian size: 7 layer_0: weight_distribution: point_mass data_size: 1 """ data = np.array([[30.3]]) def test_posterior_predictive(sample: np.array) -> None: print('data:', data) print('posterior predictive sample:', sample) np.testing.assert_allclose(sample, data, rtol=1e-1) tester.test( config, data=data, test_fn=test_posterior_predictive) def test_multivariate_data(): """Test variational EM with score function gradients.""" config = """ learning_rate: 0.1 n_iterations: 100 print_every: 100 gradient: estimator: score_function n_samples: 16 batch_size: 1 layer_1: latent_distribution: gaussian size: 1 layer_0: weight_distribution: point_mass data_size: 3 """ # shape [n_data, data_size] data = np.array([[30.3, -10., 5.]]) def test_posterior_predictive(sample: np.array) -> None: print('data:', data) print('posterior predictive sample:', sample) np.testing.assert_allclose(sample, data, rtol=1e-1) tester.test( config, data=data, test_fn=test_posterior_predictive) def test_latent_poisson_layer(): """Test matching q(z) to p(z) where p is Poisson.""" mean = 5. config = """ n_iterations: 100 learning_rate: 0.1 gradient: estimator: score_function n_samples: 16 batch_size: 1 layer_1: latent_distribution: poisson size: 3 p_z_mean: {} """.format(mean) def test_posterior_predictive(sample: np.array) -> None: print('posterior predictive sample:', sample) print('prior mean:', mean) np.testing.assert_allclose(sample, mean, rtol=1e-1) tester.test(config, data=np.array([np.nan]), test_fn=test_posterior_predictive) def test_one_layer_poisson(): """Test variational EM with score function gradients and poisson latents.""" config = """ learning_rate: 0.1 n_iterations: 100 print_every: 100 gradient: estimator: score_function n_samples: 32 batch_size: 1 layer_1: latent_distribution: poisson size: 3 layer_0: weight_distribution: point_mass data_size: 1 """ data = np.array([[30.3]]) def test_posterior_predictive(sample: np.array) -> None: print('data:', data) print('posterior predictive sample:', sample) np.testing.assert_allclose(sample, data, rtol=0.3) tester.test( config, data=data, test_fn=test_posterior_predictive) def test_two_layer_gaussian_score(): """Test variational EM with score function gradients and gaussian latents.""" config = """ learning_rate: 0.1 n_iterations: 100 gradient: estimator: score_function n_samples: 32 batch_size: 1 layer_2: latent_distribution: gaussian size: 2 layer_1: latent_distribution: gaussian weight_distribution: point_mass size: 3 layer_0: weight_distribution: point_mass data_size: 1 """ data = np.array([[8.5]]) def test_posterior_predictive(sample: np.array) -> None: print('data:', data) print('posterior predictive sample:', sample) np.testing.assert_allclose(sample, data, rtol=1e-1) tester.test( config, data=data, test_fn=test_posterior_predictive) def test_two_layer_poisson_score(): """Test variational EM with score function gradients and gaussian latents.""" config = """ learning_rate: 0.1 n_iterations: 100 gradient: estimator: score_function n_samples: 32 batch_size: 1 layer_2: latent_distribution: poisson size: 2 layer_1: latent_distribution: poisson weight_distribution: point_mass size: 3 layer_0: weight_distribution: point_mass data_size: 1 """ data = np.array([[-3.2]]) def test_posterior_predictive(sample: np.array) -> None: print('data:', data) print('posterior predictive sample:', sample) np.testing.assert_allclose(sample, data, rtol=0.3) tester.test( config, data=data, test_fn=test_posterior_predictive) if __name__ == '__main__': test_latent_poisson_layer()

23.851675

79

0.691675

671

4,985

4.889717

0.119225

0.121609

0.098141

0.065834

0.895154

0.861018

0.84334

0.828406

0.777507

0.736361

0

0.032274

0.198195

4,985

208

80

23.966346

0.788591

0.087262

0

0.828402

0

0.481391

0

0.04142

1

0.08284

false

0

0.011834

0

0.094675

0.100592

0

null

0

1

0

1

0

null

0

7

ddb42ad55b5f7d355dba44eace7a19ce4612e7d4

27,234

py

Python

sysvet/apps/reserva/views.py

joseiba/SysVetSoft

d1ed13799a5086c880bc45dd153d78bb3a629c7d

[ "Apache-2.0" ]

null

sysvet/apps/reserva/views.py

joseiba/SysVetSoft

d1ed13799a5086c880bc45dd153d78bb3a629c7d

[ "Apache-2.0" ]

null

sysvet/apps/reserva/views.py

joseiba/SysVetSoft

d1ed13799a5086c880bc45dd153d78bb3a629c7d

[ "Apache-2.0" ]

null

from django.shortcuts import render, redirect, HttpResponse from django.contrib.auth.decorators import login_required, permission_required from django.contrib import messages from django.db.models import Q from django.core.paginator import Paginator from django.http import JsonResponse from datetime import time, datetime, date import json from apps.reserva.models import Reserva from apps.reserva.forms import ReservaForm from apps.configuracion.models import Servicio, Empleado from apps.configuracion.forms import ServicioForm from apps.ventas.mascota.models import Mascota hora_entrada = "08:00" hora_salida_lun_vie = "18:00" hora_salida_sab = "15:00" today = date.today() #Reservas @login_required() @permission_required('reserva.add_reserva') def add_reserva(request): form = ReservaForm servicios = Servicio.objects.exclude(is_active="N").order_by('-last_modified') if request.method == 'POST': form = ReservaForm(request.POST) if form.is_valid(): form.save() messages.success(request, 'Se ha agregado correctamente!') try: emp = Empleado.objects.get(id=request.POST.get('id_empleado')) emp.emp_disponible_reserva = 'N' emp.save() masc = Mascota.objects.get(id=request.POST.get('id_mascota')) masc.masc_reservado = 'N' masc.fecha_reservada = request.POST.get('fecha_reserva') masc.hora_reserva = request.POST.get('hora_reserva') masc.save() except Exception as e: pass return redirect('/reserva/listReserva/') context = {'form' : form} return render(request, 'reserva/add_reserva_modal.html', context) @login_required() @permission_required('reserva.change_reserva') def edit_reserva(request, id): reserva = Reserva.objects.get(id=id) form = ReservaForm(instance=reserva) if request.method == 'POST': form = ReservaForm(request.POST, instance=reserva) if not form.has_changed(): messages.info(request, "No has hecho ningun cambio!") return redirect('/reserva/listReserva/') if form.is_valid(): reserva = form.save(commit=False) emp = Empleado.objects.get(id=request.POST.get('id_empleado')) masc = Mascota.objects.get(id=request.POST.get('id_mascota')) estado = request.POST.get('estado_re') if estado == 'FIN' or estado == 'CAN': reserva.disponible_emp = "S" emp.emp_disponible_reserva = 'S' masc.masc_reservado = 'S' masc.fecha_reservada = "" masc.hora_reserva = "" reserva.save() emp.save() masc.save() messages.success(request, 'Se ha editado correctamente!') return redirect('/reserva/listReserva/') context = {'form' : form, 'reserva': reserva} return render(request, 'reserva/edit_reserva_modal.html', context) @login_required() @permission_required('reserva.view_reserva') def list_reserva(request): data = [] reserva = Reserva.objects.all() fechaDate = date(today.year, today.month, today.day) for r in reserva: if r.fecha_reserva is not None: if fechaDate > r.fecha_reserva: if r.estado_re == 'PEN': r.estado_re = 'FIN' r.disponible_emp = "S" r.color_estado = "green" try: masc = Mascota.objects.get(id=r.id_mascota.id) masc.masc_reservado = "S" masc.fecha_reservada = "" masc.hora_reserva = "" masc.save() except: pass r.save() paginator = Paginator(reserva, 10) page_number = request.GET.get('page') page_obj = paginator.get_page(page_number) context = {'page_obj' : page_obj} return render(request, "reserva/list_reserva.html", context) #Metodo para eliminar servicio @login_required() @permission_required('reserva.delete_reserva') def delete_reserva(request, id): reserva = Reserva.objects.get(id=id) reserva.delete() messages.success(request, 'La reserva se ha eliminado!') return redirect('/reserva/listReserva/') @login_required() def search_reserva(request): query = request.GET.get('q') if query: reserva = Reserva.objects.exclude(is_active="N").filter(Q(fecha_reserva__icontains=query)) else: reserva = Reserva.objects.exclude(is_active="N").order_by('-last_modified') paginator = Paginator(reserva, 10) page_number = request.GET.get('page') page_obj = paginator.get_page(page_number) context = { 'page_obj': page_obj} return render(request, "reserva/list_reserva.html", context) def validar_fecha_hora(request): fecha = request.GET.get('fecha') hora = request.GET.get('hora') horaSelected = hora.split(':') servicio = request.GET.get('servicio') cliente = request.GET.get('id_cliente') mascota = request.GET.get('id_mascota') emp = request.GET.get('empleado') action = request.GET.get('action') id_reserva_r = request.GET.get('id_reserva') diaActual = datetime.now() mesActual = str(diaActual.month) if diaActual.month > 9 else '0' + str(diaActual.month) dayActual = str(diaActual.day) if diaActual.day > 9 else '0' + str(diaActual.day) diaCompare = str(diaActual.year) + "-" + mesActual + "-" + dayActual messageReponse = "" isFalse = True isFalseOtherDay = True isFalseMascota = True isFalseEmpleado = True splitHoraActual = diaActual.hour empe_dispo = Empleado.objects.get(id=emp) serviEmpleado = Empleado.objects.filter(id_servicio=servicio).exclude(disponible=False) countEmpleadoServi = Empleado.objects.filter(id_servicio=servicio).exclude(disponible=False).count() countEmpleadoDiaServi = Reserva.objects.filter(id_servicio=servicio, fecha_reserva=fecha, hora_reserva=hora).exclude(disponible_emp='S').count() mas_disponible = Mascota.objects.get(id=mascota) try: reserva_compare = Reserva.objects.get(id=id_reserva_r) except: pass if diaCompare == fecha: if splitHoraActual <= int(horaSelected[0]): if action == 'A': if countEmpleadoServi <= countEmpleadoDiaServi: messageReponse = "Ya no hay disponibilidad del servicio para esa hora" response = { 'mensaje': messageReponse} return JsonResponse(response) else: try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False except Exception as e: if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False else: isFalseEmpleado = True reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseEmpleado = True else: isFalseEmpleado = False if isFalseEmpleado: messageReponse = "El empleado ya esta asignado a un trabajo para esa hora y dia" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if mas_disponible.masc_reservado == 'S': isFalseMascota = False except: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: isFalseMascota = True reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseMascota = True else: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: isFalseMascota = True if isFalseMascota: messageReponse = "Esta mascota ya tiene una reserva para este dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, id_servicio=servicio, id_cliente=cliente, hora_reserva=hora, id_mascota=mascota, id_empleado=emp) except: isFalse = False if isFalse: messageReponse = "Este cliente ya tiene una reserva para ese dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) else: if (int(reserva_compare.id_empleado.id) != int(emp) or int(reserva_compare.id_servicio.id) != int(servicio) and reserva_compare.hora_reserva != hora): try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False except Exception as e: if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False else: isFalseEmpleado = True reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseEmpleado = True else: isFalseEmpleado = False if isFalseEmpleado: messageReponse = "El empleado ya esta asignado a un trabajo para esa hora y dia" response = { 'mensaje': messageReponse} return JsonResponse(response) if (int(reserva_compare.id_servicio.id) != int(servicio)): if(int(reserva_compare.id_cliente.id) != int(cliente) or int(reserva_compare.id_mascota.id != int(mascota))): try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente, id_servicio=servicio) if mas_disponible.masc_reservado == 'S': isFalseMascota = False except: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: isFalseMascota = True reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente, id_servicio=servicio) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseMascota = True else: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: isFalseMascota = True if isFalseMascota: messageReponse = "Esta mascota ya tiene una reserva para este dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, id_cliente=cliente, hora_reserva=hora, id_mascota=mascota) except: isFalse = False if isFalse: messageReponse = "Este cliente ya tiene una reserva para ese dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) if(int(reserva_compare.id_cliente.id) != int(cliente) and int(reserva_compare.id_mascota.id != int(mascota))): try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if mas_disponible.masc_reservado == 'S': isFalseMascota = False except: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: isFalseMascota = True reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseMascota = True else: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: isFalseMascota = True if isFalseMascota: messageReponse = "Esta mascota ya tiene una reserva para este dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, id_cliente=cliente, hora_reserva=hora, id_mascota=mascota, id_servicio=servicio) except: isFalse = False if isFalse: messageReponse = "Este cliente ya tiene una reserva para ese dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) else: messageReponse = "Has seleccionado un horario que ya a ha pasado" response = { 'mensaje': messageReponse} return JsonResponse(response) else: if action == 'A': if countEmpleadoServi <= countEmpleadoDiaServi: messageReponse = "Ya no hay disponibilidad del servicio para esa hora y dia" response = { 'mensaje': messageReponse} return JsonResponse(response) else: try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False except Exception as e: if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False else: isFalseEmpleado = True reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseEmpleado = True else: isFalseEmpleado = False if isFalseEmpleado: messageReponse = "El empleado ya esta asignado a un trabajo para esa hora y dia" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if mas_disponible.masc_reservado == 'S': isFalseMascota = False except Exception as e: reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseMascota = True else: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: if mas_disponible.fecha_reservada == fecha and mas_disponible.hora_reserva == hora: isFalseMascota = True else: isFalseMascota = False if isFalseMascota: messageReponse = "Esta mascota ya tiene una reserva para este dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, id_servicio=servicio, id_cliente=cliente, hora_reserva=hora, id_mascota=mascota, id_empleado=emp) except: isFalse = False if isFalse: messageReponse = "Este cliente ya tiene una reserva para ese dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) else: if (int(reserva_compare.id_empleado.id) != int(emp) or int(reserva_compare.id_servicio.id) != int(servicio) and reserva_compare.hora_reserva != hora): try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False except Exception as e: if empe_dispo.emp_disponible_reserva == 'S': isFalseEmpleado = False else: isFalseEmpleado = True reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_empleado=emp, id_servicio=servicio) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseEmpleado = True else: isFalseEmpleado = False if isFalseEmpleado: messageReponse = "El empleado ya esta asignado a un trabajo para esa hora y dia" response = { 'mensaje': messageReponse} return JsonResponse(response) if (int(reserva_compare.id_servicio.id) != int(servicio)): if(int(reserva_compare.id_cliente.id) != int(cliente) or int(reserva_compare.id_mascota.id != int(mascota))): try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente, id_servicio=servicio) if mas_disponible.masc_reservado == 'S': isFalseMascota = False except: reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseMascota = True else: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: if mas_disponible.fecha_reservada == fecha and mas_disponible.hora_reserva == hora: isFalseMascota = True else: isFalseMascota = False if isFalseMascota: messageReponse = "Esta mascota ya tiene una reserva para este dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, id_cliente=cliente, hora_reserva=hora, id_mascota=mascota) except: isFalse = False if isFalse: messageReponse = "Este cliente ya tiene una reserva para ese dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) if(int(reserva_compare.id_cliente.id) != int(cliente) and int(reserva_compare.id_mascota.id != int(mascota))): try: reserva = Reserva.objects.get(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if mas_disponible.masc_reservado == 'S': isFalseMascota = False except: reserva = Reserva.objects.filter(fecha_reserva=fecha, hora_reserva=hora, id_mascota=mascota, id_cliente=cliente) if reserva.count() > 0: for r in reserva: if r.estado_re == 'PEN': isFalseMascota = True else: if mas_disponible.masc_reservado == 'S': isFalseMascota = False else: if mas_disponible.fecha_reservada == fecha and mas_disponible.hora_reserva == hora: isFalseMascota = True else: isFalseMascota = False if isFalseMascota: messageReponse = "Esta mascota ya tiene una reserva para este dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) try: reserva = Reserva.objects.get(fecha_reserva=fecha, id_cliente=cliente, hora_reserva=hora, id_mascota=mascota, id_servicio=servicio) except: isFalse = False if isFalse: messageReponse = "Este cliente ya tiene una reserva para ese dia y hora" response = { 'mensaje': messageReponse} return JsonResponse(response) response = { 'mensaje': messageReponse} return JsonResponse(response) def get_mascota_cliente(request): cliente = request.GET.get('id_cliente') mascotas = Mascota.objects.filter(id_cliente=cliente) listMascota = [{'id': mascota.id, 'nombre': mascota.nombre_mascota} for mascota in mascotas] listJsonMascotas = json.dumps(listMascota) if listJsonMascotas != '[]': response = { 'mascota': listJsonMascotas, 'mensaje': "Ok"} return JsonResponse(response) response = { 'mascota': listJsonMascotas, 'mensaje': ""} return JsonResponse(response) def get_min_service(request): servicio = request.GET.get('servicio') emp = Empleado.objects.filter(id_servicio=servicio) listEmpleado = [{'id': empleado.id, 'nombre': empleado.nombre_emp + " " + empleado.apellido_emp} for empleado in emp] listJsonEmpleado= json.dumps(listEmpleado) isFalse = True try: minService = Servicio.objects.get(id=servicio) except: isFalse = False if isFalse: response = { 'tiempo': minService.min_serv, 'mensaje': "Ok", 'empleado': listJsonEmpleado} return JsonResponse(response) response = { 'tiempo': minService.min_serv, 'mensaje': "", 'empleado': listJsonEmpleado} return JsonResponse(response) def get_mascota_selected(request): id_reserva = request.GET.get('id_reserva') cliente = request.GET.get('id_cliente') hora_reserva = request.GET.get('hora_reserva') fecha_reserva = request.GET.get('fecha_reserva') servicio = request.GET.get('servicio') emp = Empleado.objects.filter(id_servicio=servicio) mascotas = Mascota.objects.filter(id_cliente=cliente) listMascota = [{'id': mascota.id, 'nombre': mascota.nombre_mascota} for mascota in mascotas] listEmpleado = [{'id': empleado.id, 'nombre': empleado.nombre_emp + " " + empleado.apellido_emp} for empleado in emp] listJsonEmpleado= json.dumps(listEmpleado) listJsonMascotas = json.dumps(listMascota) reserva = Reserva.objects.get(id=id_reserva, fecha_reserva=fecha_reserva, id_servicio=servicio, id_cliente=cliente, hora_reserva=hora_reserva) if listJsonMascotas != '[]': response = { 'mascota': listJsonMascotas, 'mensaje': "Ok", 'mascota_selected': reserva.id_mascota.id, 'empleado': reserva.id_empleado.id, 'empleados':listJsonEmpleado} return JsonResponse(response) response = { 'mascota': listJsonMascotas, 'mensaje': ""} return JsonResponse(response)

53.295499

176

0.528384

2,491

27,234

5.632276

0.084303

0.031361

0.035282

0.031504

0.805773

0.778261

0.745331

0.723735

0.713115

0.679971

0

0.001871

0.391643

27,234

510

177

53.4

0.844942

0.001359

0

0.778468

0

0.078366

0.008789

0

0.001961

0

1

0.018634

false

0.006211

0.026915

0

0.115942

0

null

0

1

0

1

0

null

0

7

ddcd592527ae1c2c35b3808f1ba592810226cc4b

7,966

py

Python

ATM shell.py

K-P1/kp-learning-python

67e63a53b93f269ba25d45f6811727382edf3fff

[ "bzip2-1.0.6" ]

null

ATM shell.py

K-P1/kp-learning-python

67e63a53b93f269ba25d45f6811727382edf3fff

[ "bzip2-1.0.6" ]

null

ATM shell.py

K-P1/kp-learning-python

67e63a53b93f269ba25d45f6811727382edf3fff

[ "bzip2-1.0.6" ]

null

Python 3.7.2 (tags/v3.7.2:9a3ffc0492, Dec 23 2018, 23:09:28) [MSC v.1916 64 bit (AMD64)] on win32 Type "help", "copyright", "credits" or "license()" for more information. >>> === RESTART: C:/Users/HP/Desktop/python genesis bootcamp/ATM assignment.py === ************************* WELCOME TO KP BANK ************************* Please insert your card and enter your pin Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 1 1 for slip, 2 for no slip Do you want a slip for this inquiry? 1 your balance as at "2019-11-23" is $2500 Here is your slip! Thanks for using KP bank Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 2 Select your account type 1. Savings 2. Current 3. Credit Enter your account type 2 Enter amount: 200 Collect your cash! Thanks for using KP bank Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 3 Select your account type 1. Savings 2. Current 3. Credit Enter your account type 2 Here your bank statement Thanks for using KP bank Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 4 Select your account type 1. Savings 2. Current 3. Credit Enter your account type 2 Enter destination account number: 39873874 Enter amount you want to send: 700 Transfer SUCCESFUL!!! Thanks for using KP bank Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 5 Only 3 international currencies are supported 1. Euro 2. Pounds Sterling 3. Australian Dollars Select a currency 1-3: 1 Enter destination account number: 9587432094 Enter amount you want to send in Euro: 600 thats $660.0 in USD Transfer SUCCESFUL!!! Thanks for using KP bank Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 6 enter price of flight: 900 Your flight has been booked successfully Vist your airways website for more info Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 7 WELCOME TO BVN REG PAGE Do you want to generate your BVN now 1. yes 2. no pick an option 1-2: 1 This is your new BVN number: 60920736968 Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 8 SELECT YOUR NETWORK 1. GLO 2. MTN 3. AIRTEL 4. 9MOBILE select an option 1-4: 4 Enter amount of airtime you want to buy: 600 Insufecient funds Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 9 SELECT YOUR NETWORK 1. NTEL 2. SPECTRANET 3. SMILE 4. SWIFT select an option 1-4: 4 1. 30mb -->$0.28 2. 100mb -->$0.55 3. 750mb -->$1.38 4. 1.5gb -->$2.76 5. 3.5gb -->$5.52 6. 10gb -->$13.81 7. 22gb -->$27.61 select a data plan 6 Insufecient funds Enter Your Pin: 2222 incorrect pin, try again Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 1 1 for slip, 2 for no slip Do you want a slip for this inquiry? 2 your balance as at "2019-11-23" is $-23.0 Enter Your Pin: 0000 Correct pin Choose your transaction S/N OPTIONS FEES 1. Check balance -> $2 2. Withdrawal -> $10 3. Bank statement -> $4 4. Local transfers -> $4 5. International transfers -> $8 6. Book flight:less than $100 -> $20 above $100 -> $35 7. Register for BVN -> $0 8. Buy airtime -> $0 9. Buy data -> $0 10. Quit Select an option 1-10: 10 >>>

27.756098

98

0.516445

1,076

7,966

3.82342

0.173792

0.035002

0.030627

0.047399

0.779047

0.768352

0.74842

0.736266

0

0.128073

0.392292

7,966

287

99

27.756098

0.721752

0

0.788

0

0.006379

0

null

0

null

0

null

0

1

0

1

0

null

0

1

0

7

fb2e9091690cd2086a5bfae79876547126a5a9fe

133

py

Python

example_applications/SAR_ML_wetlands/10_Scripts/test_wetlands_insight.py

fangfy/radar

6bb8a10396513711a507f8298c22df0e0565d4a7

[ "Apache-2.0" ]

15

2018-08-14T01:46:09.000Z

2022-03-23T18:41:20.000Z

example_applications/SAR_ML_wetlands/10_Scripts/test_wetlands_insight.py

fangfy/radar

6bb8a10396513711a507f8298c22df0e0565d4a7

[ "Apache-2.0" ]

1

2018-09-17T13:14:45.000Z

2021-05-05T01:43:34.000Z

example_applications/SAR_ML_wetlands/10_Scripts/test_wetlands_insight.py

fangfy/radar

6bb8a10396513711a507f8298c22df0e0565d4a7

[ "Apache-2.0" ]

5

2018-11-08T23:17:02.000Z

2021-03-05T07:29:39.000Z

import pytest import wetlands_insight #TODO actually write these tests def test_WIT_array(): pass def test_WIT_da(): pass

12.090909

32

0.75188

20

133

4.75

0.75

0.147368

0.210526

0

0.195489

133

11

33

12.090909

0.88785

0.233083

0

0.333333

0

0.090909

0

1

0.333333

true

0.333333

0

0.666667

0

1

0

null

0

1

0

null

0

1

0

1

0

1

0

8

349b01baa31d0086506407c47964ad0efa1e4c9e

28,887

py

Python

azure-graphrbac/azure/graphrbac/operations/group_operations_operations.py

HydAu/AzureSDKForPython

5cbe34e9e0b8ea1faacc9f205633ccc0b885c0f3

[ "Apache-2.0" ]

null

azure-graphrbac/azure/graphrbac/operations/group_operations_operations.py

HydAu/AzureSDKForPython

5cbe34e9e0b8ea1faacc9f205633ccc0b885c0f3

[ "Apache-2.0" ]

null

azure-graphrbac/azure/graphrbac/operations/group_operations_operations.py

HydAu/AzureSDKForPython

5cbe34e9e0b8ea1faacc9f205633ccc0b885c0f3

[ "Apache-2.0" ]

null

# coding=utf-8 # -------------------------------------------------------------------------- # Copyright (c) Microsoft and contributors. All rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # # See the License for the specific language governing permissions and # limitations under the License. # # Code generated by Microsoft (R) AutoRest Code Generator. # Changes may cause incorrect behavior and will be lost if the code is # regenerated. # -------------------------------------------------------------------------- from msrest.pipeline import ClientRawResponse from msrestazure.azure_exceptions import CloudError import uuid from .. import models class GroupOperationsOperations(object): """GroupOperationsOperations operations. :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An objec model deserializer. """ def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self.config = config def remove_member( self, group_object_id, member_object_id, custom_headers=None, raw=False, **operation_config): """ Remove a memeber from a group. Reference: http://msdn.microsoft.com/en-us/library/azure/dn151607.aspx :param group_object_id: Group object id :type group_object_id: str :param member_object_id: Member Object id :type member_object_id: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: None :rtype: :class:`ClientRawResponse<msrest.pipeline.ClientRawResponse>` if raw=true """ # Construct URL url = '/{tenantID}/groups/{groupObjectId}/$links/members/{memberObjectId}' path_format_arguments = { 'groupObjectId': self._serialize.url("group_object_id", group_object_id, 'str', skip_quote=True), 'memberObjectId': self._serialize.url("member_object_id", member_object_id, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct and send request request = self._client.delete(url, query_parameters) response = self._client.send(request, header_parameters, **operation_config) if response.status_code not in [204]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp if raw: client_raw_response = ClientRawResponse(None, response) return client_raw_response def add_member( self, group_object_id, url, custom_headers=None, raw=False, **operation_config): """ Add a memeber to a group. Reference: http://msdn.microsoft.com/en-us/library/azure/dn151676.aspx :param group_object_id: Group object id :type group_object_id: str :param url: Group display name :type url: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: None :rtype: :class:`ClientRawResponse<msrest.pipeline.ClientRawResponse>` if raw=true """ parameters = models.GroupAddMemberParameters(url=url) # Construct URL url = '/{tenantID}/groups/{groupObjectId}/$links/members' path_format_arguments = { 'groupObjectId': self._serialize.url("group_object_id", group_object_id, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct body body_content = self._serialize.body(parameters, 'GroupAddMemberParameters') # Construct and send request request = self._client.post(url, query_parameters) response = self._client.send( request, header_parameters, body_content, **operation_config) if response.status_code not in [204]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp if raw: client_raw_response = ClientRawResponse(None, response) return client_raw_response def delete( self, group_object_id, custom_headers=None, raw=False, **operation_config): """ Delete a group in the directory. Reference: http://msdn.microsoft.com/en-us/library/azure/dn151676.aspx :param group_object_id: Object id :type group_object_id: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: None :rtype: :class:`ClientRawResponse<msrest.pipeline.ClientRawResponse>` if raw=true """ # Construct URL url = '/{tenantID}/groups/{groupObjectId}' path_format_arguments = { 'groupObjectId': self._serialize.url("group_object_id", group_object_id, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct and send request request = self._client.delete(url, query_parameters) response = self._client.send(request, header_parameters, **operation_config) if response.status_code not in [204]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp if raw: client_raw_response = ClientRawResponse(None, response) return client_raw_response def create( self, parameters, custom_headers=None, raw=False, **operation_config): """ Create a group in the directory. Reference: http://msdn.microsoft.com/en-us/library/azure/dn151676.aspx :param parameters: Parameters to create a group :type parameters: :class:`GroupCreateParameters <azure.graphrbac.models.GroupCreateParameters>` :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: :class:`ADGroup <azure.graphrbac.models.ADGroup>` :rtype: :class:`ClientRawResponse<msrest.pipeline.ClientRawResponse>` if raw=true """ # Construct URL url = '/{tenantID}/groups' path_format_arguments = { 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct body body_content = self._serialize.body(parameters, 'GroupCreateParameters') # Construct and send request request = self._client.post(url, query_parameters) response = self._client.send( request, header_parameters, body_content, **operation_config) if response.status_code not in [201]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp deserialized = None if response.status_code == 201: deserialized = self._deserialize('ADGroup', response) if raw: client_raw_response = ClientRawResponse(deserialized, response) return client_raw_response return deserialized def list( self, filter=None, custom_headers=None, raw=False, **operation_config): """ Gets list of groups for the current tenant. :param filter: The filter to apply on the operation. :type filter: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: :class:`ADGroupPaged <azure.graphrbac.models.ADGroupPaged>` """ def internal_paging(next_link=None, raw=False): if not next_link: # Construct URL url = '/{tenantID}/groups' path_format_arguments = { 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} if filter is not None: query_parameters['$filter'] = self._serialize.query("filter", filter, 'str') query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') else: url = next_link query_parameters = {} # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct and send request request = self._client.get(url, query_parameters) response = self._client.send( request, header_parameters, **operation_config) if response.status_code not in [200]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp return response # Deserialize response deserialized = models.ADGroupPaged(internal_paging, self._deserialize.dependencies) if raw: header_dict = {} client_raw_response = models.ADGroupPaged(internal_paging, self._deserialize.dependencies, header_dict) return client_raw_response return deserialized def get_group_members( self, object_id, custom_headers=None, raw=False, **operation_config): """ Gets the members of a group. :param object_id: Group object Id who's members should be retrieved. :type object_id: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: :class:`AADObjectPaged <azure.graphrbac.models.AADObjectPaged>` """ def internal_paging(next_link=None, raw=False): if not next_link: # Construct URL url = '/{tenantID}/groups/{objectId}/members' path_format_arguments = { 'objectId': self._serialize.url("object_id", object_id, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') else: url = next_link query_parameters = {} # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct and send request request = self._client.get(url, query_parameters) response = self._client.send( request, header_parameters, **operation_config) if response.status_code not in [200]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp return response # Deserialize response deserialized = models.AADObjectPaged(internal_paging, self._deserialize.dependencies) if raw: header_dict = {} client_raw_response = models.AADObjectPaged(internal_paging, self._deserialize.dependencies, header_dict) return client_raw_response return deserialized def get( self, object_id, custom_headers=None, raw=False, **operation_config): """ Gets group information from the directory. :param object_id: User objectId to get group information. :type object_id: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: :class:`ADGroup <azure.graphrbac.models.ADGroup>` :rtype: :class:`ClientRawResponse<msrest.pipeline.ClientRawResponse>` if raw=true """ # Construct URL url = '/{tenantID}/groups/{objectId}' path_format_arguments = { 'objectId': self._serialize.url("object_id", object_id, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct and send request request = self._client.get(url, query_parameters) response = self._client.send(request, header_parameters, **operation_config) if response.status_code not in [200]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp deserialized = None if response.status_code == 200: deserialized = self._deserialize('ADGroup', response) if raw: client_raw_response = ClientRawResponse(deserialized, response) return client_raw_response return deserialized def get_member_groups( self, object_id, security_enabled_only, custom_headers=None, raw=False, **operation_config): """ Gets a collection that contains the Object IDs of the groups of which the group is a member. :param object_id: Group filtering parameters. :type object_id: str :param security_enabled_only: If true only membership in security enabled groups should be checked. Otherwise membership in all groups should be checked :type security_enabled_only: bool :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: :class:`strPaged <azure.graphrbac.models.strPaged>` """ parameters = models.GroupGetMemberGroupsParameters(security_enabled_only=security_enabled_only) def internal_paging(next_link=None, raw=False): if not next_link: # Construct URL url = '/{tenantID}/groups/{objectId}/getMemberGroups' path_format_arguments = { 'objectId': self._serialize.url("object_id", object_id, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') else: url = next_link query_parameters = {} # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct body body_content = self._serialize.body(parameters, 'GroupGetMemberGroupsParameters') # Construct and send request request = self._client.post(url, query_parameters) response = self._client.send( request, header_parameters, body_content, **operation_config) if response.status_code not in [200]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp return response # Deserialize response deserialized = models.strPaged(internal_paging, self._deserialize.dependencies) if raw: header_dict = {} client_raw_response = models.strPaged(internal_paging, self._deserialize.dependencies, header_dict) return client_raw_response return deserialized def list_next( self, next_link, custom_headers=None, raw=False, **operation_config): """ Gets list of groups for the current tenant. :param next_link: Next link for list operation. :type next_link: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: :class:`ADGroupPaged <azure.graphrbac.models.ADGroupPaged>` """ def internal_paging(next_link=None, raw=False): if not next_link: # Construct URL url = '/{tenantID}/{nextLink}' path_format_arguments = { 'nextLink': self._serialize.url("next_link", next_link, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') else: url = next_link query_parameters = {} # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct and send request request = self._client.get(url, query_parameters) response = self._client.send( request, header_parameters, **operation_config) if response.status_code not in [200]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp return response # Deserialize response deserialized = models.ADGroupPaged(internal_paging, self._deserialize.dependencies) if raw: header_dict = {} client_raw_response = models.ADGroupPaged(internal_paging, self._deserialize.dependencies, header_dict) return client_raw_response return deserialized def get_group_members_next( self, next_link, custom_headers=None, raw=False, **operation_config): """ Gets the members of a group. :param next_link: Next link for list operation. :type next_link: str :param dict custom_headers: headers that will be added to the request :param bool raw: returns the direct response alongside the deserialized response :param operation_config: :ref:`Operation configuration overrides<msrest:optionsforoperations>`. :rtype: :class:`AADObjectPaged <azure.graphrbac.models.AADObjectPaged>` """ def internal_paging(next_link=None, raw=False): if not next_link: # Construct URL url = '/{tenantID}/{nextLink}' path_format_arguments = { 'nextLink': self._serialize.url("next_link", next_link, 'str', skip_quote=True), 'tenantID': self._serialize.url("self.config.tenant_id", self.config.tenant_id, 'str') } url = self._client.format_url(url, **path_format_arguments) # Construct parameters query_parameters = {} query_parameters['api-version'] = self._serialize.query("self.config.api_version", self.config.api_version, 'str') else: url = next_link query_parameters = {} # Construct headers header_parameters = {} header_parameters['Content-Type'] = 'application/json; charset=utf-8' if self.config.generate_client_request_id: header_parameters['x-ms-client-request-id'] = str(uuid.uuid1()) if custom_headers: header_parameters.update(custom_headers) if self.config.accept_language is not None: header_parameters['accept-language'] = self._serialize.header("self.config.accept_language", self.config.accept_language, 'str') # Construct and send request request = self._client.get(url, query_parameters) response = self._client.send( request, header_parameters, **operation_config) if response.status_code not in [200]: exp = CloudError(response) exp.request_id = response.headers.get('x-ms-request-id') raise exp return response # Deserialize response deserialized = models.AADObjectPaged(internal_paging, self._deserialize.dependencies) if raw: header_dict = {} client_raw_response = models.AADObjectPaged(internal_paging, self._deserialize.dependencies, header_dict) return client_raw_response return deserialized

43.050671

144

0.635684

3,113

28,887

5.702538

0.075169

0.045629

0.027039

0.040559

0.878436

0.873197

0.870043

0.864635

0.856861

0.851453

0

0.004016

0.267214

28,887

670

145

43.114925

0.834609

0.251082

0

0.84104

0

0.127602

0.063972

0

1

0.046243

false

0

0.011561

0

0.124277

0

null

0

1

0

1

0

null

0

7

34a82b14cdc15ede9606015473ec51004f00f114

329

py

Python

lib/config/__init__.py

hplin6/oral_disease_diagnosis

ef0994c3b066a5c5fa61957bdc8460a8a7dbeb45

[ "MIT" ]

null

lib/config/__init__.py

hplin6/oral_disease_diagnosis

ef0994c3b066a5c5fa61957bdc8460a8a7dbeb45

[ "MIT" ]

1

2021-10-15T12:20:01.000Z

lib/config/__init__.py

hplin6/oral_disease_diagnosis

ef0994c3b066a5c5fa61957bdc8460a8a7dbeb45

[ "MIT" ]

1

2021-10-02T07:04:51.000Z

# ------------------------------------------------------------------------------ # Copy from https://github.com/HRNet/HRNet-Image-Classification # ------------------------------------------------------------------------------ from .default import _C as config from .default import update_config from .models import MODEL_EXTRAS

41.125

80

0.413374

25

329

5.32

0.68

0.165414

0.255639

0

0.069909

329

7

81

47

0.434641

0.665654

0

1

0

true

0

1

0

1

0

1

0

null

0

1

0

1

0

1

0

null

0

1

0

1

0

1

0

7

34abe4fdf93eeef13ac83cf9812137296e856881

17,335

py

Python

pyqt数据库系统/仓库管理/source/apprcc_rc.py

yxg995995/yxg-code

7dd23f3dfb13d68ebc44bf7d5a344fb661c33136

[ "MIT" ]

1

2021-03-15T02:07:50.000Z

pyqt数据库系统/仓库管理/source/apprcc_rc.py

yxg995995/yxg-code

7dd23f3dfb13d68ebc44bf7d5a344fb661c33136

[ "MIT" ]

null

pyqt数据库系统/仓库管理/source/apprcc_rc.py

yxg995995/yxg-code

7dd23f3dfb13d68ebc44bf7d5a344fb661c33136

[ "MIT" ]

1

2021-03-15T02:07:55.000Z

# -*- coding: utf-8 -*- # Resource object code # # Created by: The Resource Compiler for PyQt5 (Qt v5.12.1) # # WARNING! All changes made in this file will be lost! from PyQt5 import QtCore qt_resource_data = b"\ \x00\x00\x02\x22\ \x00\ \x00\x23\x38\x78\x9c\xed\xd1\x39\x4c\x14\x51\x18\xc0\xf1\xef\xcd\ \x7b\x73\x3d\x01\x77\xd8\x61\x76\x19\x35\xbb\xb0\x2c\xcc\x12\x37\ \xe1\xf2\x6c\x14\xd4\x55\xb6\x12\xbc\xed\xc0\xdb\x0e\x3c\x50\x13\ \x13\x40\x3c\x3b\xbc\xb5\x92\xf5\x40\xed\x50\x3c\x2b\x51\x3c\x3b\ \x3c\x01\x1b\xf0\xd6\x0a\x14\x2f\x9a\x71\x76\xa3\x34\x36\x4a\xb2\ \x26\x26\xdf\x37\xc5\xef\x4b\x5e\xf1\xde\x3f\x63\x77\xdb\x7d\xe0\ \x8a\x46\xca\x23\x40\x08\x00\x71\x3e\xb0\x9f\x43\x13\x48\x4c\x94\ \x44\x26\x49\xa2\x24\xcb\x92\xc2\x5d\x9c\xab\x2a\xd7\xd3\xc6\xa6\ \xb8\x3c\xba\xd7\xeb\xd1\x0d\xc3\x9c\x10\xf4\x99\xe3\x02\xe3\x0d\ \xc3\x3f\xd1\x1f\xc8\xcd\x0b\xe5\x87\x32\x7d\xe1\x82\xb0\x55\x10\ \xb4\x42\x16\x91\x65\x99\x2b\xdc\xcd\xb9\xdb\x32\x0d\xd3\xfa\xeb\ \xb1\x6f\x80\xa6\x08\xf5\xa4\x8f\x12\x0d\x04\x8d\x50\x8d\xd8\x9d\ \x24\xe6\xbc\x51\x24\x89\x81\x9f\x43\x04\xea\xbc\x55\x56\x54\x3e\ \xc6\x05\x02\xa1\x54\x60\x54\x14\x19\x73\x4e\xb6\x3b\x67\xc0\x34\ \x31\x3d\xab\xb0\x54\x72\x57\x54\xc9\xd9\x35\x7a\x51\x43\x73\x8b\ \x12\x28\x6b\xeb\xc8\xa8\xec\x1a\xc8\x29\xae\xae\x6d\x54\xb9\xe1\ \xf1\x66\x9a\xc1\xdc\x3c\x2b\x94\x5f\x32\x69\xf2\x94\xa9\xd3\xa6\ \xcf\x9a\x3d\x27\x32\x77\x5e\x79\x74\xc1\xc2\x45\x8b\x97\x2c\x5d\ \xb6\x7c\xc5\xca\x55\xab\xd7\xac\x5d\xb7\x7e\xc3\xc6\x4d\x9b\xeb\ \xb6\x6c\xdd\xb6\xa3\x69\xe7\xae\xdd\x7b\xf6\xee\xdb\x7f\xe0\xe0\ \xa1\xc3\x47\x8e\x1e\x3b\x1e\x3b\x79\xea\xf4\x99\xd6\xb3\xe7\xce\ \x5f\xb8\xd8\x7e\xe9\xf2\x95\xab\xd7\xae\xdf\xbc\xd5\x79\xfb\xce\ \xdd\x7b\xf7\x1f\x3c\x7c\xf4\xf8\xc9\xd3\x67\xdd\x3d\xbd\xfd\x2f\ \x5e\xbe\x7a\xfd\xe6\xed\xbb\xf7\x1f\x06\x3f\x7e\x1a\xfa\xfc\xe5\ \xeb\xb7\xef\xc3\x04\x28\xf9\x35\xbf\xf5\x38\xe1\x44\x60\x8c\x32\ \x39\xde\x43\x84\xba\xf8\xa1\xc6\xc4\xac\x42\x29\xbd\xb4\x42\xae\ \xaa\x71\x67\x17\x35\x28\x7a\x59\x73\x4b\x5b\x87\x1a\x28\xae\x1c\ \xc8\xa8\xae\xed\xe2\x46\x4e\x49\x7f\x70\x30\x9e\x94\x28\xfa\xb3\ \xa0\xc6\x51\x15\x8d\x04\x8d\xf4\xd8\xbd\x90\x42\x89\xf3\xc3\xa8\ \x06\x33\x60\x38\x56\xcf\xc1\x82\x13\x02\x82\x20\x08\x82\x20\x08\ \x82\x8c\x1e\xe6\x2c\xc6\x3f\xb9\x2c\x1a\x5f\x44\x67\x4d\x1b\x82\ \xf9\x64\xa6\x08\x7a\x72\x10\x4c\x48\x85\x30\xf8\x13\x77\x25\x37\ \x8c\xa4\x3a\x17\xb6\x27\xb5\x06\x41\x10\x04\x41\x10\x04\x41\x10\ \x04\x41\x10\x04\x41\x10\xe4\x3f\xc5\x67\xf7\xfc\x00\xd6\x77\xf1\ \x75\ \x00\x00\x01\x78\ \x89\ \x50\x4e\x47\x0d\x0a\x1a\x0a\x00\x00\x00\x0d\x49\x48\x44\x52\x00\ \x00\x00\x10\x00\x00\x00\x10\x08\x06\x00\x00\x00\x1f\xf3\xff\x61\ \x00\x00\x00\x04\x73\x42\x49\x54\x08\x08\x08\x08\x7c\x08\x64\x88\ \x00\x00\x00\x09\x70\x48\x59\x73\x00\x00\x00\x59\x00\x00\x00\x59\ \x01\xaa\x9d\xa9\x86\x00\x00\x00\x19\x74\x45\x58\x74\x53\x6f\x66\ \x74\x77\x61\x72\x65\x00\x77\x77\x77\x2e\x69\x6e\x6b\x73\x63\x61\ \x70\x65\x2e\x6f\x72\x67\x9b\xee\x3c\x1a\x00\x00\x00\xf5\x49\x44\ \x41\x54\x38\x8d\xad\xd1\x3d\x4a\x43\x41\x14\x05\xe0\xef\x3d\x03\ \x51\x41\xb1\x8a\x24\x68\x23\x08\x46\x4b\x6d\xec\x74\x07\x96\x76\ \x62\xe7\x02\xa2\xab\x10\x2b\x45\x77\xa0\x9d\x6b\xb0\xd0\xd2\x15\ \xf8\x1a\x45\x0b\x21\xa5\x9d\x26\x16\x33\xc2\x90\xbc\x24\x2f\xe0\ \x81\x0b\x97\x33\xf7\xe7\xdc\x33\xfc\x33\x16\x71\x85\x8f\x18\x97\ \x58\x18\xd7\x90\x27\x79\x86\x3b\xcc\x61\x1b\x3b\x98\xc7\x6d\xd5\ \xed\x5b\x78\xc1\x4c\xc2\xd5\x50\xa0\x5d\x45\xc1\x4a\x1c\xf0\x93\ \x70\xdf\x91\x5b\x4d\xb8\x0e\x8e\xca\x86\x2d\xe3\x13\xcd\x84\x6b\ \x45\xae\x91\x70\xeb\x78\xc3\x89\x01\xb9\x5f\xe8\xe1\x5a\xf0\x63\ \x17\x37\xb8\xc0\x73\x3c\xb1\x85\x3a\x9e\x70\x8e\xd9\xac\x44\xc9\ \x1e\x0e\x62\x7e\x8f\x87\x28\xfb\x70\xa0\xae\x89\xa5\xb2\x53\xaa\ \xe0\x18\xef\xa2\xb9\x39\x4e\x05\xb7\xfb\x23\xa2\x88\x2a\xf2\xa8\ \xe4\x55\xf0\x02\x9c\xe1\x11\x1b\x63\x36\xb6\x85\xbb\x3b\xd8\xc7\ \x5a\xfa\x58\x4c\x68\xfe\xc3\xa6\xf0\xa5\x43\xe8\x09\xae\x4f\x42\ \x16\x6b\x87\xd0\xaf\xd0\x3c\xb2\xb6\x86\xee\x14\x43\xba\x53\x2c\ \xab\x86\x5f\xe3\xfa\x30\x27\x61\x0f\x66\x93\x00\x00\x00\x00\x49\ \x45\x4e\x44\xae\x42\x60\x82\ \x00\x00\x02\x79\ \x89\ \x50\x4e\x47\x0d\x0a\x1a\x0a\x00\x00\x00\x0d\x49\x48\x44\x52\x00\ \x00\x00\x20\x00\x00\x00\x20\x08\x06\x00\x00\x00\x73\x7a\x7a\xf4\ \x00\x00\x00\x04\x73\x42\x49\x54\x08\x08\x08\x08\x7c\x08\x64\x88\ \x00\x00\x00\x09\x70\x48\x59\x73\x00\x00\x00\xb1\x00\x00\x00\xb1\ \x01\xc6\x2d\x49\x8d\x00\x00\x00\x19\x74\x45\x58\x74\x53\x6f\x66\ \x74\x77\x61\x72\x65\x00\x77\x77\x77\x2e\x69\x6e\x6b\x73\x63\x61\ \x70\x65\x2e\x6f\x72\x67\x9b\xee\x3c\x1a\x00\x00\x01\xf6\x49\x44\ \x41\x54\x58\x85\xed\xd6\x3b\x68\x14\x51\x14\x06\xe0\x6f\x57\x93\ \x42\x2d\x22\x36\x3e\xd2\xd8\x99\x94\x81\x34\x16\x0a\x31\x06\x41\ \x63\x1a\xed\xd5\xc6\x42\x8c\xa9\x04\x0b\xad\xd5\x42\x90\x34\x3e\ \x4a\x3b\xc5\xc6\x60\x25\x3e\x40\x3b\xf1\x85\x8d\x60\xd0\x3a\x62\ \x54\x82\xcf\x08\xbb\x16\x73\x96\x0c\x71\x67\x67\x32\xcc\x2a\x88\ \x3f\x5c\xee\x65\xce\x7f\xfe\xff\xcc\x3d\x33\x77\x86\xff\xc8\x47\ \x1f\xce\xe0\x29\x3e\xc7\x78\x82\xd3\x11\xeb\x2a\x76\xe2\x1d\x9a\ \x19\x63\x0e\x3b\xba\x65\x3e\x8c\xaf\x61\x74\x0f\xa3\x58\x8b\x75\ \xd8\x8d\xfb\x11\xfb\x82\xa1\xaa\xcd\x57\xe1\x65\x18\x5c\x41\xbd\ \x0d\xa7\x8e\xab\xc1\x79\x91\xc1\x29\x8d\x3d\x21\x3c\x8b\xde\x0e\ \xbc\x5e\xbc\x09\xee\x58\x19\xa3\xac\xaa\x77\xc5\x7c\x0d\x8b\x1d\ \xf2\x17\x83\x93\xce\xa9\xa4\x80\x4d\x31\xcf\x16\xd0\x78\x1d\xf3\ \xe6\x8c\x78\x1f\x2e\x61\x64\x25\x05\x2c\xc4\xbc\xa1\x40\x01\x2d\ \xce\x42\x46\x7c\x08\x47\x71\x5b\xd2\xda\x42\x38\x22\xe9\xeb\x9d\ \x02\xdc\xbb\xc1\x3d\x94\x11\xaf\x61\x3a\x38\xdf\x8a\x16\xb1\x1e\ \x9f\x22\xe9\x40\x07\xde\xc1\xe0\x7c\xd0\xf9\x50\xaa\xe1\x62\x70\ \x7f\x60\xbc\x48\x11\xc7\x22\xe1\x3b\x8e\xa3\x27\x15\xeb\xc1\x89\ \x88\x35\x25\x5b\x9c\x87\xb6\x45\xd4\x72\x92\xce\xe1\x64\xac\xe7\ \xf1\x38\xd6\xc3\x96\x7a\x7f\x16\xa7\x42\x6b\x54\xfe\x4e\x1c\x96\ \xb4\xe1\xa7\xe4\x26\x73\x31\x8e\xe7\x7e\x3f\x86\x9f\x61\x6f\x8a\ \x37\xd2\x86\x93\x37\x1a\x79\x3b\x90\xc6\x56\x6c\x8b\xf5\x2b\xbc\ \x5d\x16\xef\xc3\x79\xf9\x1f\xa8\x8d\xd8\x2e\x39\x6d\x1f\xac\xc0\ \xbf\x12\x8c\x49\xde\x84\x26\x2e\xcb\x7f\x04\xfe\xbc\xf9\x04\x66\ \x24\x9f\xd9\x95\xf6\x73\x2e\x72\xf7\x97\x31\x5f\x83\x9b\x25\x4c\ \xb3\xc6\x8d\xd0\x84\xc1\x94\xf9\x74\xd6\x9d\xb7\xcc\xe7\x31\x89\ \x2d\xed\x48\x39\xe8\xc7\x14\x3e\x86\xd6\xf5\xb8\x3e\x80\xf7\xb8\ \x90\x65\x3e\x91\x32\x1f\x28\x61\xbc\x1c\x83\xa9\x22\xf6\x15\x49\ \x98\x09\xf2\x64\x05\xe6\x2d\x4c\x85\xe6\xad\x22\xe4\xd6\x3f\x5f\ \x99\x6d\xcf\x42\xbf\xa5\x07\x33\x17\x8d\x20\x57\xf9\x4e\xd6\x43\ \xb3\x51\x84\xdc\x7a\x72\xab\x46\x21\xdd\x4a\x7f\x24\xcb\xe0\xaf\ \x17\xb0\x3a\xb5\xee\x46\x1b\x72\x51\xc7\xa3\x2e\xea\x3f\xec\xa2\ \xf6\x3f\x82\x5f\x26\xa5\xa9\x30\xaa\xda\xab\x16\x00\x00\x00\x00\ \x49\x45\x4e\x44\xae\x42\x60\x82\ \x00\x00\x06\x19\ \x89\ \x50\x4e\x47\x0d\x0a\x1a\x0a\x00\x00\x00\x0d\x49\x48\x44\x52\x00\ \x00\x00\x80\x00\x00\x00\x80\x08\x03\x00\x00\x00\xf4\xe0\x91\xf9\ \x00\x00\x00\x03\x73\x42\x49\x54\x08\x08\x08\xdb\xe1\x4f\xe0\x00\ \x00\x00\x09\x70\x48\x59\x73\x00\x00\x06\x7a\x00\x00\x06\x7a\x01\ \xf2\x51\xe0\xf7\x00\x00\x00\x19\x74\x45\x58\x74\x53\x6f\x66\x74\ \x77\x61\x72\x65\x00\x77\x77\x77\x2e\x69\x6e\x6b\x73\x63\x61\x70\ \x65\x2e\x6f\x72\x67\x9b\xee\x3c\x1a\x00\x00\x01\xe0\x50\x4c\x54\ \x45\xff\xff\xff\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x97\x13\x17\x8e\x00\x00\x00\x9f\x74\x52\x4e\x53\x00\x01\x02\ \x03\x04\x05\x06\x07\x08\x0a\x0b\x0c\x0d\x0e\x0f\x10\x12\x13\x14\ \x15\x16\x17\x18\x19\x1a\x1b\x1d\x20\x21\x22\x25\x26\x27\x28\x2c\ \x2e\x2f\x31\x32\x33\x34\x36\x37\x38\x39\x3a\x3c\x3d\x3e\x40\x42\ \x43\x44\x45\x46\x49\x4b\x51\x52\x53\x54\x56\x59\x5b\x5d\x5e\x5f\ \x61\x63\x64\x65\x66\x6b\x6d\x6e\x70\x71\x73\x74\x75\x76\x7b\x7d\ \x7f\x80\x81\x82\x88\x8a\x8b\x8c\x8d\x90\x91\x92\x94\x95\x9a\x9b\ \x9e\x9f\xa0\xa2\xa5\xa9\xaa\xab\xad\xae\xaf\xb3\xb4\xb7\xba\xbb\ \xbe\xbf\xc1\xc3\xc5\xc6\xc7\xc9\xca\xcb\xcd\xce\xd0\xd3\xd5\xd6\ \xd7\xd8\xd9\xda\xdb\xdc\xde\xdf\xe2\xe3\xe4\xe6\xe7\xe8\xea\xef\ \xf0\xf1\xf2\xf3\xf4\xf7\xf9\xfa\xfb\xfc\xfd\xfe\xeb\x4a\x80\xf2\ \x00\x00\x03\x00\x49\x44\x41\x54\x78\xda\xed\x98\xed\x3f\x93\x51\ \x18\xc7\x7f\x13\x9a\x86\x54\xab\x44\x53\x8b\xa2\xd0\xb3\x48\xe9\ \x49\x45\x7a\xa2\x94\xb4\xd2\x13\x8b\xa2\x22\xa9\x94\x08\x25\x14\ \x32\xa1\xa8\xdf\xbf\xda\x8b\xb3\xcd\xee\x7b\x0f\x36\x3e\x3a\xbd\ \xb8\xbe\xaf\xce\xb9\x76\x76\xce\xf7\xde\xe7\xde\x39\xd7\x75\x00\ \x41\x10\x04\x41\x10\x04\x41\x10\x04\x41\x10\x04\x41\x10\x84\xff\ \x83\xc2\x2a\x77\xbf\xe7\x1f\xd2\xef\xae\x2a\x0c\x58\x3e\xa3\x9d\ \x1a\x68\xcf\xf0\xad\x5f\x3e\x45\x2d\x4c\x95\xab\xf5\x2b\xa8\x8d\ \x0a\x00\xc8\x9c\xd6\x27\x30\x9d\x09\x58\x3a\xa9\x91\x4e\x0b\x8a\ \xa8\x95\x22\xd4\xe8\x15\xa8\x41\x9b\x5e\x81\x36\x8c\xea\x15\x18\ \x85\xb1\xef\xce\xb3\x17\xf7\x86\x18\x37\xd8\x70\xca\x69\xb5\xda\ \xf2\x2f\xb8\x27\x0d\xf1\x9e\xfa\x32\x87\xd5\x9a\xb2\xe7\xdc\x83\ \x9f\xfe\x58\x53\xae\xbd\xa4\x4f\x35\xc7\x4a\xf3\x0a\x3a\x02\x1e\ \x37\x7f\xc3\xe1\xb7\xa6\x99\x8d\x02\xf7\x01\x60\xf5\x47\xf3\xf2\ \x73\x37\x12\xfc\xbb\x66\xfa\xb3\x85\xf8\x4c\xa5\xc5\x1f\xdf\xe6\ \xdb\x4d\x5d\x00\x90\x34\x44\x92\x9f\xed\x00\x2c\x37\x7d\xc3\x1f\ \x03\xc0\xaa\xee\x08\x02\x7f\xd2\x00\x00\x27\x4d\xeb\x0f\xef\x34\ \x9c\x1b\xa7\x7f\xf9\x1e\xdf\x61\x88\x5f\x25\x49\xce\xdb\xd4\xee\ \x4a\x92\xd7\xd4\x07\xad\xde\xf1\x5b\x01\x00\xc5\x11\x04\x46\xd4\ \x17\xb2\x8d\x43\x7e\x17\x98\x4e\xae\xeb\xde\xe7\x77\x98\xe2\xaf\ \x48\x72\x40\xb5\x73\x48\x32\x57\xb5\x53\x3e\x91\x24\x27\x55\x6f\ \x63\x04\x81\x41\x35\xc4\x69\x1c\x52\x6f\x3e\x3a\xe3\x3f\x90\x24\ \x2b\x11\x4a\xac\x37\x60\x0e\xa7\xf7\x83\x1d\x33\x24\x39\xa1\x3a\ \x6b\x63\x15\x18\xb3\x06\x1d\xde\xbb\x49\xb2\xc7\x62\x0e\xd7\x85\ \x13\xc0\x89\xe5\x08\x3c\x09\xce\x1e\x2c\x53\xa1\x7e\x98\x84\xc1\ \xb0\x02\x68\x58\x86\x40\xb5\x0a\x3a\x5a\x27\x3d\xe3\x77\xe2\x55\ \xe7\x25\xc9\x32\xd5\xdc\xd5\xe1\xf1\x8c\xba\x36\x01\x49\x6e\x86\ \x17\x48\x78\xbd\x74\x81\x83\x2a\xf8\x90\x24\x79\x4c\x75\x6e\x91\ \xf4\xbe\x82\xea\x6f\x3e\xfd\xbc\xe5\x3b\x23\x08\x20\x7d\x62\xc9\ \x02\xde\x59\xd4\xf6\x54\xa7\x3a\x17\x49\x7a\x5f\x0d\x8f\xe9\x3f\ \x1b\x46\x00\x07\xe6\x35\x0b\xe0\x8a\x6e\x01\xdc\xd3\x2d\x90\xb8\ \x82\x02\xdd\xae\xda\xda\xda\xc6\x6f\x61\x04\x12\x0d\x1e\x2b\x21\ \x70\x56\x35\x93\x9f\x86\x16\xb8\x1b\xbf\xc2\x02\x8f\x7c\x73\x27\ \x4f\x84\x14\xe8\xbd\xbd\xc2\x02\xa5\xfe\xc9\x5b\x42\x0b\xf0\xf8\ \x72\x04\x16\xdf\x88\xce\x2c\x2a\xf0\xc3\x19\x93\x40\x96\xaf\x82\ \x9b\x8d\x6e\x2b\x6e\xf2\x4f\x3e\x1c\x46\x80\xfd\xb6\x58\x04\xfc\ \xc4\x65\xbf\x88\xe1\x30\x02\xd6\x31\x9c\x00\x9b\x97\x24\x00\xc4\ \x75\xc5\x70\x1c\xa3\x2c\xbc\x00\x2f\x2d\x4d\x00\x25\x31\x24\x24\ \xa9\x5f\x23\x08\xcc\xed\x8b\x42\x60\x24\x58\x20\x2b\x86\x94\xac\ \xd1\x9c\x92\xe5\xa8\xf6\x00\x49\x72\x7c\xb3\xea\x6d\x59\x3c\x29\ \x0d\xe4\x68\xd4\x49\x69\x5c\x75\x50\x52\xaa\xca\x6f\xdb\xbc\x1a\ \xde\xa5\xde\xe0\xf3\x8b\xa6\xe5\x86\x2c\xa7\x37\xda\xb4\x7c\xfb\ \x9b\xe0\xb4\x7c\x28\x09\x00\x5c\xfe\xd9\x2d\x00\x52\xde\x45\x12\ \xa0\x3b\x6f\x8d\x75\x81\xb4\x23\xef\xa3\x2a\x4c\x52\xf7\x5f\x6e\ \x9e\x0d\x55\x98\xf4\x95\xd8\x73\x9b\x16\x46\xb7\xee\x5d\x7f\xe8\ \x8b\xb9\x30\xd1\x5e\x9a\x69\x2f\x4e\xb5\x97\xe7\xda\x2f\x28\xb4\ \x5f\xd1\x68\xbf\xa4\xd2\x7f\x4d\xa7\xff\xa2\x52\xff\x55\xad\xfe\ \xcb\x6a\x41\x10\x04\x41\x10\x04\x41\x10\x04\x41\x10\x04\x41\x10\ \x04\x9d\xfc\x05\xd8\xa2\x32\xbc\xf8\x3f\x0b\xac\x00\x00\x00\x00\ \x49\x45\x4e\x44\xae\x42\x60\x82\ \x00\x00\x01\xd1\ \x89\ \x50\x4e\x47\x0d\x0a\x1a\x0a\x00\x00\x00\x0d\x49\x48\x44\x52\x00\ \x00\x00\x20\x00\x00\x00\x20\x08\x06\x00\x00\x00\x73\x7a\x7a\xf4\ \x00\x00\x00\x04\x73\x42\x49\x54\x08\x08\x08\x08\x7c\x08\x64\x88\ \x00\x00\x00\x09\x70\x48\x59\x73\x00\x00\x00\xdd\x00\x00\x00\xdd\ \x01\x70\x53\xa2\x07\x00\x00\x00\x19\x74\x45\x58\x74\x53\x6f\x66\ \x74\x77\x61\x72\x65\x00\x77\x77\x77\x2e\x69\x6e\x6b\x73\x63\x61\ \x70\x65\x2e\x6f\x72\x67\x9b\xee\x3c\x1a\x00\x00\x01\x4e\x49\x44\ \x41\x54\x58\x85\xed\xd6\xb1\x6a\x94\x41\x14\x05\xe0\xef\x2c\x41\ \xb0\xd9\x2a\x10\xb0\x16\x3b\xb5\x49\xd8\x4e\x41\x7c\x81\x74\x29\ \x16\x85\xc5\xd6\x54\xc1\xa7\xb0\x4a\x0a\x21\xd8\x68\xeb\x2b\x88\ \xa0\xa5\xd9\x26\xd8\x89\x58\x8a\x96\x56\x29\xaf\x85\x43\x18\x74\ \x23\xb1\xf9\x37\xc5\x7f\x60\x60\xe6\xdc\x3b\xf7\x1c\x66\x86\x99\ \x49\x55\x59\x27\x26\x6b\x55\x1f\x0d\x8c\x06\x46\x03\x57\xc1\xc0\ \x06\x24\xb9\x8d\x27\xd8\x1a\x48\xf7\x07\x5e\x56\xd5\xa7\x49\x92\ \x39\x4e\x71\x67\x20\x71\x4d\xeb\x34\xc9\x3c\xf8\x88\x0f\x55\x75\ \x30\xa0\x01\x49\x9e\xe3\xde\x04\x3b\x58\x0e\x29\xde\xb0\xc4\xce\ \xca\x43\x98\x64\x96\x64\x76\x41\x6c\x91\x64\xba\x82\x9f\x26\x59\ \xfc\x6f\xbd\x8d\x3f\x12\x6f\xe0\x31\x1e\xb6\xf1\x5b\xbc\xaa\xaa\ \x6f\x49\x1e\xe0\x16\x5e\xe0\x6e\x92\x2f\x55\x75\xd4\xf2\x9e\xe2\ \x26\xf6\x93\x5c\xc3\xe7\xaa\x7a\xf7\xaf\x7a\xbd\x6e\x61\xaf\x3d\ \xcb\x9b\xf8\xda\xb8\x6a\xfd\xcd\x16\xdb\xc5\x59\x17\x3b\xae\x2a\ \x2d\x76\xdc\xf1\x67\xd8\xbd\x44\xbd\x3d\xd4\xd5\xb8\x07\x3a\x5c\ \xc7\x1b\x6c\xb7\xf1\xb2\x71\x10\x3c\xc3\x61\x6b\x3f\xbb\x79\xdf\ \x1b\xb7\xdf\x72\x72\x89\x7a\xe7\x38\xdf\x82\x6e\x49\x67\x98\xf5\ \x5c\x17\x5b\x60\xba\x82\x9f\x62\x71\xc1\x9c\xbf\xea\x69\x5b\xb0\ \xd2\xc0\x10\x4d\x77\x06\x4e\xba\x25\x1a\x12\xdb\x38\x09\xe6\x78\ \x8d\xf7\x7e\xdf\xd1\x43\x60\x0b\xf7\xf1\x28\x55\xb5\xd6\xc7\x28\ \xe3\xb7\x7c\x34\x30\x1a\x18\x0d\xac\xdb\xc0\x2f\x19\x8c\x01\x4b\ \xa7\x83\x74\xbb\x00\x00\x00\x00\x49\x45\x4e\x44\xae\x42\x60\x82\ \ " qt_resource_name = b"\ \x00\x03\ \x00\x00\x76\xf3\ \x00\x70\ \x00\x69\x00\x63\ \x00\x07\ \x08\xd0\x55\x07\ \x7a\x7a\ \x76\x7d\x56\xfe\x00\x2e\x00\x6a\x00\x70\x00\x67\ \x00\x08\ \x09\xc5\x58\xc7\ \x00\x75\ \x00\x73\x00\x65\x00\x72\x00\x2e\x00\x70\x00\x6e\x00\x67\ \x00\x0c\ \x04\xab\xdf\x07\ \x00\x75\ \x00\x73\x00\x65\x00\x72\x00\x20\x00\x28\x00\x31\x00\x29\x00\x2e\x00\x70\x00\x6e\x00\x67\ \x00\x09\ \x0e\x01\xb1\xe7\ \x00\x6c\ \x00\x6f\x00\x67\x00\x69\x00\x6e\x00\x2e\x00\x70\x00\x6e\x00\x67\ \x00\x0c\ \x08\x56\x02\x87\ \x00\x70\ \x00\x61\x00\x73\x00\x73\x00\x77\x00\x6f\x00\x72\x00\x64\x00\x2e\x00\x70\x00\x6e\x00\x67\ " qt_resource_struct_v1 = b"\ \x00\x00\x00\x00\x00\x02\x00\x00\x00\x01\x00\x00\x00\x01\ \x00\x00\x00\x00\x00\x02\x00\x00\x00\x05\x00\x00\x00\x02\ \x00\x00\x00\x36\x00\x00\x00\x00\x00\x01\x00\x00\x03\xa2\ \x00\x00\x00\x6c\x00\x00\x00\x00\x00\x01\x00\x00\x0c\x3c\ \x00\x00\x00\x0c\x00\x01\x00\x00\x00\x01\x00\x00\x00\x00\ \x00\x00\x00\x20\x00\x00\x00\x00\x00\x01\x00\x00\x02\x26\ \x00\x00\x00\x54\x00\x00\x00\x00\x00\x01\x00\x00\x06\x1f\ " qt_resource_struct_v2 = b"\ \x00\x00\x00\x00\x00\x02\x00\x00\x00\x01\x00\x00\x00\x01\ \x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x00\x00\x02\x00\x00\x00\x05\x00\x00\x00\x02\ \x00\x00\x00\x00\x00\x00\x00\x00\ \x00\x00\x00\x36\x00\x00\x00\x00\x00\x01\x00\x00\x03\xa2\ \x00\x00\x01\x77\xcd\xb0\x00\x4a\ \x00\x00\x00\x6c\x00\x00\x00\x00\x00\x01\x00\x00\x0c\x3c\ \x00\x00\x01\x77\xcd\xb2\x67\xb4\ \x00\x00\x00\x0c\x00\x01\x00\x00\x00\x01\x00\x00\x00\x00\ \x00\x00\x01\x77\xca\x59\x00\x9c\ \x00\x00\x00\x20\x00\x00\x00\x00\x00\x01\x00\x00\x02\x26\ \x00\x00\x01\x77\xcd\xae\xaa\x35\ \x00\x00\x00\x54\x00\x00\x00\x00\x00\x01\x00\x00\x06\x1f\ \x00\x00\x01\x77\xcd\xaa\xa6\x69\ " qt_version = [int(v) for v in QtCore.qVersion().split('.')] if qt_version < [5, 8, 0]: rcc_version = 1 qt_resource_struct = qt_resource_struct_v1 else: rcc_version = 2 qt_resource_struct = qt_resource_struct_v2 def qInitResources(): QtCore.qRegisterResourceData(rcc_version, qt_resource_struct, qt_resource_name, qt_resource_data) def qCleanupResources(): QtCore.qUnregisterResourceData(rcc_version, qt_resource_struct, qt_resource_name, qt_resource_data) qInitResources()

54.171875

103

0.725296

4,108

17,335

3.051363

0.074732

0.334583

0.430076

0.502593

0.31424

0.3073

0.301955

0.300279

0.294535

0.288313

0

0.349244

0.023479

17,335

319

104

54.341693

0.391245

0.008768

0

0.227723

0

0.79538

0.000058

0

1

0

1

0.006601

false

0

0.0033

0

0.009901

0

null

1

0

1

0

1

0

1

0

null

1

0

7

9b3be3e8ebca8e18058c1c930e8ddab7c8ef4da0

8,166

py

Python

horoma/experiments/ae.py

eeishaan/ift6759-block2

be7c870746cbe73cdab6ee63def2263b745d4591

[ "Apache-2.0" ]

null

horoma/experiments/ae.py

eeishaan/ift6759-block2

be7c870746cbe73cdab6ee63def2263b745d4591

[ "Apache-2.0" ]

null

horoma/experiments/ae.py

eeishaan/ift6759-block2

be7c870746cbe73cdab6ee63def2263b745d4591

[ "Apache-2.0" ]

null

from types import SimpleNamespace import torch from torch.nn import functional as F from horoma.cfg import DEVICE from horoma.experiments import HoromaExperiment class AEExperiment(HoromaExperiment): def _is_naive(self): return hasattr(self, 'naive') and self.naive is True def after_train(self, ctx): super().after_train(ctx) epoch = ctx.epoch bce_loss = ctx.bce.item() message = "BCE loss: {}".format(bce_loss) self._summary_writer.add_scalar( 'train_train_bce_loss', bce_loss, epoch) if not self._is_naive(): cluster_loss = ctx.cluster_error.item() message = "{} Cluster loss: {}".format( message, cluster_loss) self._summary_writer.add_scalar( 'train_train_cluster_loss', cluster_loss, epoch) print(message) # compute validation loss self._embedding_model.eval() eval_ctx = SimpleNamespace( bce=0, running_loss=0 ) if not self._is_naive(): eval_ctx.cluster_error = 0 with torch.no_grad(): for data in ctx.train_valid_loader: data = data.to(DEVICE) outputs = self._embedding_model(data) loss = self.compute_loss(eval_ctx, outputs, data) eval_ctx.running_loss += loss eval_ctx.running_loss /= len(ctx.train_valid_loader) eval_running_loss = eval_ctx.running_loss.item() eval_bce_loss = eval_ctx.bce.item() message = "BCE: {} Eval loss:{} "\ .format(eval_bce_loss, eval_running_loss) if not self._is_naive(): eval_cluster_loss = eval_ctx.cluster_error.item() message = "{} Cluster loss: {}".format(message, eval_cluster_loss) self._summary_writer.add_scalar( 'train_valid_cluster_loss', eval_cluster_loss, epoch) print(message) self._summary_writer.add_scalar( 'train_valid_bce_loss', eval_bce_loss, epoch) self._summary_writer.add_scalar( 'train_valid_loss', eval_running_loss, epoch) # add validation loss to the list of losses self._last_validation_loss.append(eval_running_loss) if len(self._last_validation_loss) < self._patience: return True if all(self._last_validation_loss[-i] >= self._last_validation_loss[-i - 1] for i in range(1, self._patience + 1)): return False return True def before_train(self, ctx, train_train_no_aug_loader): super().before_train(ctx, train_train_no_aug_loader) ctx.bce = 0 if not self._is_naive(): ctx.cluster_error = 0 # Add validation loss list attribute if not hasattr(self, '_last_validation_loss'): self._last_validation_loss = [] def compute_loss(self, ctx, outputs, x): recon_x, _, _, output_embedding = outputs BCE = F.binary_cross_entropy( recon_x, x.view(-1, 3072), reduction='sum') loss = BCE ctx.bce += BCE / len(x) if not self._is_naive(): numpy_embedding = output_embedding.detach().cpu().numpy() predicted_clusters = self._cluster_obj.predict( numpy_embedding).reshape(-1) cluster_centers = self._cluster_obj.cluster_centers_ \ if hasattr(self._cluster_obj, 'cluster_centers_') \ else self._cluster_obj.means_ predicted_centers = cluster_centers[predicted_clusters] predicted_centers = torch.Tensor(predicted_centers).to(DEVICE) _lambda = 50000 cluster_error = _lambda * torch.norm( output_embedding - predicted_centers).pow(2) loss += cluster_error ctx.cluster_error += cluster_error / len(x) return loss class VAEExperiment(HoromaExperiment): def _is_naive(self): return hasattr(self, 'naive') and self.naive is True def after_train(self, ctx): super().after_train(ctx) epoch = ctx.epoch bce_loss, kld_loss = ctx.bce.item(), ctx.kld.item() message = "BCE loss: {} KLD Loss: {}".format(bce_loss, kld_loss) if not self._is_naive(): cluster_loss = ctx.cluster_error.item() message = "{} Cluster loss: {}".format(message, cluster_loss) self._summary_writer.add_scalar( 'train_train_cluster_loss', cluster_loss, epoch) print(message) self._summary_writer.add_scalar( 'train_train_bce_loss', bce_loss, epoch) self._summary_writer.add_scalar( 'train_train_kld_loss', kld_loss, epoch) # compute validation loss self._embedding_model.eval() eval_ctx = SimpleNamespace( bce=0, running_loss=0, kld=0, ) if not self._is_naive(): eval_ctx.cluster_error = 0 with torch.no_grad(): for data in ctx.train_valid_loader: data = data.to(DEVICE) outputs = self._embedding_model(data) loss = self.compute_loss(eval_ctx, outputs, data) eval_ctx.running_loss += loss eval_ctx.running_loss /= len(ctx.train_valid_loader) eval_running_loss = eval_ctx.running_loss.item() eval_bce_loss = eval_ctx.bce.item() eval_kld_loss = eval_ctx.kld.item() message = "BCE: {} KDL: {} Eval loss:{}" \ .format(eval_bce_loss, eval_kld_loss, eval_running_loss) if not self._is_naive(): eval_cluster_loss = eval_ctx.cluster_error.item() message = "{} Cluster loss: {}".format(message, eval_cluster_loss) self._summary_writer.add_scalar( 'train_valid_cluster_loss', eval_cluster_loss, epoch) self._summary_writer.add_scalar( 'train_valid_bce_loss', eval_bce_loss, epoch) self._summary_writer.add_scalar( 'train_valid_loss', eval_running_loss, epoch) self._summary_writer.add_scalar( 'train_valid_kld_loss', eval_kld_loss, epoch) # add validation loss to the list of losses self._last_validation_loss.append(eval_running_loss) if len(self._last_validation_loss) < self._patience: return True if all(self._last_validation_loss[-i] >= self._last_validation_loss[-i - 1] for i in range(1, self._patience + 1)): return False return True def before_train(self, ctx, train_train_no_aug_loader): super().before_train(ctx, train_train_no_aug_loader) ctx.bce = 0 ctx.kld = 0 if not self._is_naive(): ctx.cluster_error = 0 # Add validation loss list attribute if not hasattr(self, '_last_validation_loss'): self._last_validation_loss = [] def compute_loss(self, ctx, outputs, x): recon_x, mu, logvar, output_embedding = outputs BCE = F.binary_cross_entropy( recon_x, x.view(-1, 3072), reduction='sum') KLD = -0.5 * torch.sum(1 + logvar - mu.pow(2) - logvar.exp()) loss = BCE + KLD if not self._is_naive(): numpy_embedding = output_embedding.detach().cpu().numpy() predicted_clusters = self._cluster_obj.predict( numpy_embedding).reshape(-1) cluster_centers = self._cluster_obj.cluster_centers_ \ if hasattr(self._cluster_obj, 'cluster_centers_') \ else self._cluster_obj.means_ predicted_centers = cluster_centers[predicted_clusters] predicted_centers = torch.Tensor(predicted_centers).to(DEVICE) _lambda = 50000 cluster_error = _lambda * torch.norm( output_embedding - predicted_centers).pow(2) loss += cluster_error ctx.cluster_error += cluster_error / len(x) ctx.bce += BCE / len(x) ctx.kld += KLD / len(x) return loss

38.158879

83

0.608866

985

8,166

4.694416

0.111675

0.036332

0.044118

0.051903

0.917604

0.896843

0.895978

0.882785

0.88192

0.867431

0

0.008025

0.298065

8,166

213

84

38.338028

0.798674

0.024614

0

0.817143

0

0.06283

0.017341

0

1

0.045714

false

0

0.028571

0.011429

0.142857

0.017143

0

null

0

1

0

1

0

null

0

7

9b87bfbb40cd8c240c651612abadd166148deebb

2,779

py

Python

plenum/test/monitoring/test_request_time_tracker.py

rhzs/indy-plenum

a1ee6f3d081e802b404637026dc6f8ef3ec82a40

[ "Apache-2.0" ]

null

plenum/test/monitoring/test_request_time_tracker.py

rhzs/indy-plenum

a1ee6f3d081e802b404637026dc6f8ef3ec82a40

[ "Apache-2.0" ]

null

plenum/test/monitoring/test_request_time_tracker.py

rhzs/indy-plenum

a1ee6f3d081e802b404637026dc6f8ef3ec82a40

[ "Apache-2.0" ]

1

2020-01-24T09:36:13.000Z

from plenum.server.monitor import RequestTimeTracker INSTANCE_COUNT = 4 def test_request_tracker_start_adds_request(): req_tracker = RequestTimeTracker(INSTANCE_COUNT) req = ("id", 42) now = 1.0 req_tracker.start(req[0], req[1], now) assert req in req_tracker assert req in [req for req, _ in req_tracker.unordered()] def test_request_tracker_order_by_master_makes_request_ordered_and_returns_time_to_order(): req_tracker = RequestTimeTracker(INSTANCE_COUNT) req = ("id", 42) now = 1.0 req_tracker.start(req[0], req[1], now) tto = req_tracker.order(0, req[0], req[1], now + 5) assert req not in [req for req, _ in req_tracker.unordered()] assert int(tto) == 5 def test_request_tracker_order_by_backup_returns_time_to_order(): req_tracker = RequestTimeTracker(INSTANCE_COUNT) req = ("id", 42) now = 1.0 req_tracker.start(req[0], req[1], now) tto = req_tracker.order(1, req[0], req[1], now + 5) assert req in [req for req, _ in req_tracker.unordered()] assert int(tto) == 5 def test_request_tracker_deletes_request_only_when_it_is_ordered_by_all_instances(): req_tracker = RequestTimeTracker(INSTANCE_COUNT) req = ("id", 42) now = 1.0 req_tracker.start(req[0], req[1], now) for instId in range(INSTANCE_COUNT - 1): req_tracker.order(instId, req[0], req[1], now) assert req in req_tracker req_tracker.order(INSTANCE_COUNT - 1, req[0], req[1], now) assert req not in req_tracker def test_request_tracker_doesnt_wait_for_new_instances_on_old_requests(): req_tracker = RequestTimeTracker(INSTANCE_COUNT) req = ("id", 42) now = 1.0 req_tracker.start(req[0], req[1], now) req_tracker.add_instance() for instId in range(INSTANCE_COUNT): req_tracker.order(instId, req[0], req[1], now) assert req not in req_tracker def test_request_tracker_waits_for_new_instances_on_new_requests(): req_tracker = RequestTimeTracker(INSTANCE_COUNT) req = ("id", 42) now = 1.0 req_tracker.add_instance() req_tracker.start(req[0], req[1], now) for instId in range(INSTANCE_COUNT): req_tracker.order(instId, req[0], req[1], now) assert req in req_tracker req_tracker.order(INSTANCE_COUNT, req[0], req[1], now) assert req not in req_tracker def test_request_tracker_performs_garbage_collection_on_remove_instance(): req_tracker = RequestTimeTracker(INSTANCE_COUNT) req = ("id", 42) now = 1.0 req_tracker.start(req[0], req[1], now) req_tracker.order(1, req[0], req[1], now) req_tracker.order(2, req[0], req[1], now) req_tracker.remove_instance(0) assert req in req_tracker req_tracker.remove_instance(2) assert req not in req_tracker

27.79

91

0.700612

430

2,779

4.239535

0.14186

0.208448

0.061437

0.070214

0.81898

0.817334

0.784421

0.755897

0.735601

0.719693

0

0.032387

0.188917

2,779

99

92

28.070707

0.776398

0

0.712121

0

0.00504

0

0.19697

1

0.106061

false

0

0.015152

0

0.121212

0

null

1

0

1

0

1

0

null

0

8

9ba3312c338c3346805cf356370181baa8e84a94

3,835

py

Python

test/test_input.py

storborg/livetest

63d7fe395a1fa6772a85174d01e78300415a66e0

[ "MIT" ]

null

test/test_input.py

storborg/livetest

63d7fe395a1fa6772a85174d01e78300415a66e0

[ "MIT" ]

2

2019-05-19T15:42:54.000Z

2020-07-17T17:02:01.000Z

test/test_input.py

storborg/livetest

63d7fe395a1fa6772a85174d01e78300415a66e0

[ "MIT" ]

3

2015-11-06T08:24:56.000Z

2020-07-11T10:30:49.000Z

from webob import Request from fixtures import ServerFixture class TestInput(ServerFixture): def make_app(self): def app(environ, start_response): req = Request(environ) status = "200 OK" body =\ """ <html> <head><title>form page</title></head> <body> <form method="POST" id="text_input_form"> <input name="foo" type="text" value="bar"> <input name="button" type="submit" value="text"> </form> <form method="POST" id="radio_input_form"> <input name="foo" type="radio" value="bar"> <input name="foo" type="radio" value="baz" checked> <input name="button" type="submit" value="radio"> </form> <form method="POST" id="checkbox_input_form"> <input name="foo" type="checkbox" value="bar" checked> <input name="button" type="submit" value="text"> </form> </body> </html> """ headers = [ ('Content-Type', 'text/html'), ('Content-Length', str(len(body)))] start_response(status, headers) return [body] return app def test_input(self): res = self.app.get('/') assert res.status_int == 200 assert res.headers['content-type'] == 'text/html' assert res.content_type == 'text/html' form = res.forms['text_input_form'] assert form['foo'].value == 'bar' assert form.submit_fields() == [('foo', 'bar')] form = res.forms['radio_input_form'] assert form['foo'].value == 'baz' assert form.submit_fields() == [('foo', 'baz')] form = res.forms['checkbox_input_form'] assert form['foo'].value == 'bar' assert form.submit_fields() == [('foo', 'bar')] class TestInputNoDefault(ServerFixture): def make_app(self): def app(environ, start_response): req = Request(environ) status = "200 OK" body =\ """ <html> <head><title>form page</title></head> <body> <form method="POST" id="text_input_form"> <input name="foo" type="text"> <input name="button" type="submit" value="text"> </form> <form method="POST" id="radio_input_form"> <input name="foo" type="radio" value="bar"> <input name="foo" type="radio" value="baz"> <input name="button" type="submit" value="radio"> </form> <form method="POST" id="checkbox_input_form"> <input name="foo" type="checkbox" value="bar"> <input name="button" type="submit" value="text"> </form> </body> </html> """ headers = [ ('Content-Type', 'text/html'), ('Content-Length', str(len(body)))] start_response(status, headers) return [body] return app def test_input_no_default(self): res = self.app.get('/') assert res.status_int == 200 assert res.headers['content-type'] == 'text/html' assert res.content_type == 'text/html' form = res.forms['text_input_form'] assert form['foo'].value == '' assert form.submit_fields() == [('foo', '')] form = res.forms['radio_input_form'] assert form['foo'].value is None assert form.submit_fields() == [] form = res.forms['checkbox_input_form'] assert form['foo'].value is None assert form.submit_fields() == []

35.841121

74

0.497784

400

3,835

4.6625

0.1475

0.06756

0.051475

0.068633

0.9437

0.91689

0.909383

0

0.004831

0.352282

3,835

106

75

36.179245

0.745974

0

0.814815

0

0.137283

0

0.333333

1

0.111111

false

0

0.037037

0

0.259259

0

null

0

1

0

1

0

null

0

7

9ba84f29b2f41319a53380f36751fb235d2e6d58

5,777

py

Python

tests/test_user.py

SiriusKoan/shorten-url-with-kv

55d108a263441cc17dbec2ce3c8419b4b4ea111d

[ "MIT" ]

3

2022-02-16T09:11:39.000Z

2022-03-25T06:07:34.000Z

tests/test_user.py

SiriusKoan/shorten-url-with-kv

55d108a263441cc17dbec2ce3c8419b4b4ea111d

[ "MIT" ]

null

tests/test_user.py

SiriusKoan/shorten-url-with-kv

55d108a263441cc17dbec2ce3c8419b4b4ea111d

[ "MIT" ]

null

from flask import url_for from tests.helper import TestModel class LoginPageTest(TestModel): def setUp(self) -> None: super().setUp() self.route = url_for("user.login_page") self.user_data_bad_wrong_password = {"username": "user", "password": "bad"} self.user_data_bad_empty_field = {"username": "user"} def test_get_with_no_auth(self): res = self.get() self.assertEqual(res.status_code, 200) self.assertIn(b"Login", res.data) def test_get_with_auth(self): res = self.get(login="user") self.assertEqual(res.status_code, 200) self.assertIn(b"Dashboard", res.data) def test_post_ok(self): res = self.post(data=self.user_data) self.assertEqual(res.status_code, 200) self.assertIn(b"Dashboard", res.data) def test_post_bad_wrong_password(self): res = self.post(data=self.user_data_bad_wrong_password) self.assertEqual(res.status_code, 200) self.assertIn(b"Wrong username or password.", res.data) def test_post_bad_empty_field(self): res = self.post(data=self.user_data_bad_empty_field) self.assertEqual(res.status_code, 200) self.assertIn(b"This field is required.", res.data) class RegisterPageTest(TestModel): def setUp(self) -> None: super().setUp() self.route = url_for("user.register_page") self.register_data_ok = { "username": "user2", "password": "useruser", "repeat_password": "useruser", "email": "user@a.a", } self.register_data_bad_username_duplicate = { "username": "user", "password": "useruser", "repeat_password": "useruser", "email": "user@a.a", } self.register_data_bad_email_duplicate = { "username": "user2", "password": "useruser", "repeat_password": "useruser", "email": "user@user.com", } self.register_data_bad_too_short_password = { "username": "user2", "password": "short", "repeat_password": "short", "email": "user@a.a", } self.register_data_bad_empty_field = { "username": "user2", } def test_get_with_no_auth(self): res = self.get() self.assertEqual(res.status_code, 200) self.assertIn(b"Login", res.data) def test_get_with_auth(self): res = self.get(login="user") self.assertEqual(res.status_code, 200) self.assertIn(b"Dashboard", res.data) def test_post_ok(self): res = self.post(data=self.register_data_ok) self.assertEqual(res.status_code, 200) self.assertIn(b"Login", res.data) def test_post_bad_username_duplicate(self): res = self.post(data=self.register_data_bad_username_duplicate) self.assertEqual(res.status_code, 200) self.assertIn(b"The username or the email has been used.", res.data) def test_post_bad_email_duplicate(self): res = self.post(data=self.register_data_bad_email_duplicate) self.assertEqual(res.status_code, 200) self.assertIn(b"The username or the email has been used.", res.data) def test_post_bad_too_short_password(self): res = self.post(data=self.register_data_bad_too_short_password) self.assertEqual(res.status_code, 200) self.assertIn(b"The password must contain at least 6 characters.", res.data) def test_post_bad_empty_field(self): res = self.post(data=self.register_data_bad_empty_field) self.assertEqual(res.status_code, 200) self.assertIn(b"This field is required.", res.data) class DashboardPageTest(TestModel): def setUp(self) -> None: super().setUp() self.route = url_for("user.dashboard_page") def test_get_with_no_auth(self): res = self.get() self.assertEqual(res.status_code, 200) self.assertIn(b"Login", res.data) def test_get_with_auth(self): res = self.get(login="user") self.assertEqual(res.status_code, 200) self.assertIn(b"Dashboard", res.data) class SettingPageTest(TestModel): def setUp(self) -> None: super().setUp() self.route = url_for("user.setting_page") self.data_ok = {"email": "user@a.a"} self.data_bad_too_short_password = {"email": "user@a.a", "password": "short"} self.data_bad_empty_field = {"email": ""} self.data_bad_duplicate_email = {"email": "user2@user.com"} def test_get_with_no_auth(self): res = self.get() self.assertEqual(res.status_code, 200) self.assertIn(b"Login", res.data) def test_get_with_auth(self): res = self.get(login="user") self.assertEqual(res.status_code, 200) self.assertIn(b"Setting", res.data) def test_post_ok(self): res = self.post(login="user", data=self.data_ok) self.assertEqual(res.status_code, 200) self.assertIn(b"OK.", res.data) def test_post_bad_too_short_password(self): res = self.post(login="user", data=self.data_bad_too_short_password) self.assertEqual(res.status_code, 200) self.assertIn(b"The password must contain at least 6 characters.", res.data) def test_post_bad_empty_field(self): res = self.post(login="user", data=self.data_bad_empty_field) self.assertEqual(res.status_code, 200) self.assertIn(b"This field is required.", res.data) def test_post_bad_duplicate_email(self): res = self.post(login="user", data=self.data_bad_duplicate_email) self.assertEqual(res.status_code, 200) self.assertIn(b"The email has been used.", res.data)

36.10625

85

0.639432

768

5,777

4.572917

0.089844

0.039863

0.062642

0.136674

0.88582

0.861048

0.814636

0.795843

0.782745

0.739465

0

0.015162

0.23507

5,777

159

86

36.333333

0.779588

0

0.618321

0

0.144885

0

0.305344

1

0.183206

false

0.152672

0.015267

0

0.229008

0

null

0

1

0

null

0

1

0

7

9bbc84b5d5e1dd8535bbe4724a9d0fe667d2eb65

160,141

py

Python

TEST3D/GUI/0011202_page_bc/log.py

usnistgov/OOF3D

4fd423a48aea9c5dc207520f02de53ae184be74c

[ "X11" ]

31

2015-04-01T15:59:36.000Z

2022-03-18T20:21:47.000Z

TEST3D/GUI/0011202_page_bc/log.py

usnistgov/OOF3D

4fd423a48aea9c5dc207520f02de53ae184be74c

[ "X11" ]

3

2015-02-06T19:30:24.000Z

2017-05-25T14:14:31.000Z

TEST3D/GUI/0011202_page_bc/log.py

usnistgov/OOF3D

4fd423a48aea9c5dc207520f02de53ae184be74c

[ "X11" ]

7

2015-01-23T15:19:22.000Z

2021-06-09T09:03:59.000Z

# -*- python -*- # This software was produced by NIST, an agency of the U.S. government, # and by statute is not subject to copyright in the United States. # Recipients of this software assume all responsibilities associated # with its operation, modification and maintenance. However, to # facilitate maintenance we ask that before distributing modified # versions of this software, you first contact the authors at # oof_manager@nist.gov. import tests #Testing Boundary Condition creation using Dirichlet on a Displacement Field #The field component is x here findWidget('OOF3D').resize(550, 350) setComboBox(findWidget('OOF3D:Navigation:PageMenu'), 'Microstructure') checkpoint page installed Microstructure findWidget('OOF3D:Microstructure Page:Pane').set_position(225) findWidget('OOF3D:Microstructure Page:Pane').set_position(156) checkpoint meshable button set checkpoint microstructure page sensitized checkpoint microstructure page sensitized checkpoint meshable button set findMenu(findWidget('OOF3D:MenuBar'), 'File:Load:Data').activate() checkpoint toplevel widget mapped Dialog-Data findWidget('Dialog-Data').resize(190, 67) findWidget('Dialog-Data:filename').set_text('TEST_DATA/two_walls.skeleton') findWidget('Dialog-Data:gtk-ok').clicked() checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint pixel page updated checkpoint named analysis chooser set checkpoint active area status updated checkpoint microstructure page sensitized checkpoint meshable button set checkpoint Field page sensitized checkpoint Materials page updated checkpoint mesh page subproblems sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint pinnodes page sensitized checkpoint boundary page updated checkpoint skeleton selection page selection sensitized checkpoint skeleton selection page updated checkpoint skeleton selection page groups sensitized checkpoint skeleton selection page groups sensitized checkpoint Solver page sensitized checkpoint microstructure page sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint skeleton selection page groups sensitized checkpoint microstructure page sensitized checkpoint meshable button set checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint skeleton selection page groups sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint skeleton selection page groups sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint skeleton selection page groups sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint skeleton selection page groups sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint meshable button set checkpoint meshable button set checkpoint microstructure page sensitized checkpoint skeleton selection page groups sensitized checkpoint skeleton selection page selection sensitized checkpoint skeleton selection page updated checkpoint skeleton selection page groups sensitized checkpoint named analysis chooser set checkpoint Field page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint pinnodes page sensitized checkpoint boundary page updated checkpoint skeleton selection page selection sensitized checkpoint Solver page sensitized checkpoint skeleton selection page groups sensitized checkpoint skeleton selection page groups sensitized checkpoint skeleton selection page updated checkpoint pinnodes page sensitized findWidget('OOF3D Activity Viewer').resize(400, 300) checkpoint pinnodes page sensitized checkpoint pinnodes page sensitized checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint boundary page updated checkpoint OOF.File.Load.Data setComboBox(findWidget('OOF3D:Navigation:PageMenu'), 'FE Mesh') checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint page installed FE Mesh findWidget('OOF3D:FE Mesh Page:Pane').set_position(304) findWidget('OOF3D:FE Mesh Page:New').clicked() checkpoint toplevel widget mapped Dialog-Create a new mesh findWidget('Dialog-Create a new mesh').resize(345, 153) findWidget('Dialog-Create a new mesh:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Field page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint mesh page subproblems sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint OOF.Mesh.New setComboBox(findWidget('OOF3D:Navigation:PageMenu'), 'Fields & Equations') checkpoint Field page sensitized checkpoint Field page sensitized checkpoint page installed Fields & Equations findWidget('OOF3D').resize(675, 350) findWidget('OOF3D:Fields & Equations Page:HPane').set_position(301) findWidget('OOF3D:Fields & Equations Page:HPane:Fields:Displacement defined').clicked() checkpoint Field page sensitized checkpoint Field page sensitized checkpoint Field page sensitized checkpoint Field page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint OOF.Subproblem.Field.Define findWidget('OOF3D:Fields & Equations Page:HPane:Fields:Displacement active').clicked() checkpoint Field page sensitized checkpoint Field page sensitized checkpoint Field page sensitized checkpoint Field page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint OOF.Subproblem.Field.Activate findWidget('OOF3D:Fields & Equations Page:HPane:Equations:Force_Balance active').clicked() checkpoint Field page sensitized checkpoint Field page sensitized checkpoint Field page sensitized checkpoint Field page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint mesh page subproblems sensitized checkpoint mesh page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint OOF.Subproblem.Equation.Activate setComboBox(findWidget('OOF3D:Navigation:PageMenu'), 'Boundary Conditions') checkpoint page installed Boundary Conditions findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 289) findWidget('Dialog-New Boundary Condition:name:Auto').clicked() findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New assert tests.boundaryConditionCheck(['dirichlet_fieldx_componentx_constantXmax']) findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Xmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New assert tests.boundaryConditionCheck(['dirichlet_fieldx_componentx_constantXmax','dirichlet_fieldx_componentx_constantXmin']) findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Ymax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Ymin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantYmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Zmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Zmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxYmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXmaxYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXmaxYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_constantXminYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentx_continuumXminYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 289) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Xmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:eqn_component'), 'y') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Xmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Ymax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Ymin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantYmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Zmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Zmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxYmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXmaxYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXmaxYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_constantXminYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componenty_continuumXminYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 289) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Xmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:eqn_component'), 'z') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Xmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Ymax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Ymin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantYmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Zmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'Zmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxYmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminYmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminYmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminYmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'YminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmaxZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYmaxZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYminZmax') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XmaxYminZmin') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXmaxYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXmaxYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmaxZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminYmaxZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminYmaxZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminYmaxZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYminZmax') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminYminZmax') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(467, 309) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:boundary'), 'XminYminZmin') setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Constant Profile') findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_constantXminYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New findWidget('OOF3D Messages 1').resize(983, 200) findWidget('OOF3D:Boundary Conditions Page:Condition:New').clicked() checkpoint toplevel widget mapped Dialog-New Boundary Condition findWidget('Dialog-New Boundary Condition').resize(412, 265) setComboBox(findWidget('Dialog-New Boundary Condition:condition:Dirichlet:profile:Chooser'), 'Continuum Profile') findWidget('Dialog-New Boundary Condition').resize(467, 309) findWidget('Dialog-New Boundary Condition:name:Text').set_text('dirichlet_fieldx_componentz_continuumXminYminZmin') findWidget('Dialog-New Boundary Condition:gtk-ok').clicked() checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint Field page sensitized checkpoint Solver page sensitized checkpoint named analysis chooser set checkpoint Solver page sensitized checkpoint OOF.Mesh.Boundary_Conditions.New assert tests.boundaryConditionCheck(['dirichlet_fieldx_componentx_constantXmax', 'dirichlet_fieldx_componentx_constantXmaxYmax', 'dirichlet_fieldx_componentx_constantXmaxYmaxZmax', 'dirichlet_fieldx_componentx_constantXmaxYmaxZmin', 'dirichlet_fieldx_componentx_constantXmaxYmin', 'dirichlet_fieldx_componentx_constantXmaxYminZmax', 'dirichlet_fieldx_componentx_constantXmaxYminZmin', 'dirichlet_fieldx_componentx_constantXmaxZmax', 'dirichlet_fieldx_componentx_constantXmaxZmin', 'dirichlet_fieldx_componentx_constantXmin', 'dirichlet_fieldx_componentx_constantXminYmax', 'dirichlet_fieldx_componentx_constantXminYmaxZmax', 'dirichlet_fieldx_componentx_constantXminYmaxZmin', 'dirichlet_fieldx_componentx_constantXminYmin', 'dirichlet_fieldx_componentx_constantXminYminZmax', 'dirichlet_fieldx_componentx_constantXminYminZmin', 'dirichlet_fieldx_componentx_constantXminZmax', 'dirichlet_fieldx_componentx_constantXminZmin', 'dirichlet_fieldx_componentx_constantYmax', 'dirichlet_fieldx_componentx_constantYmaxZmax', 'dirichlet_fieldx_componentx_constantYmaxZmin', 'dirichlet_fieldx_componentx_constantYmin', 'dirichlet_fieldx_componentx_constantYminZmax', 'dirichlet_fieldx_componentx_constantYminZmin', 'dirichlet_fieldx_componentx_constantZmax', 'dirichlet_fieldx_componentx_constantZmin', 'dirichlet_fieldx_componentx_continuumXmaxYmax', 'dirichlet_fieldx_componentx_continuumXmaxYmaxZmax', 'dirichlet_fieldx_componentx_continuumXmaxYmaxZmin', 'dirichlet_fieldx_componentx_continuumXmaxYmin', 'dirichlet_fieldx_componentx_continuumXmaxYminZmax', 'dirichlet_fieldx_componentx_continuumXmaxYminZmin', 'dirichlet_fieldx_componentx_continuumXmaxZmax', 'dirichlet_fieldx_componentx_continuumXmaxZmin', 'dirichlet_fieldx_componentx_continuumXmin', 'dirichlet_fieldx_componentx_continuumXminYmax', 'dirichlet_fieldx_componentx_continuumXminYmaxZmax', 'dirichlet_fieldx_componentx_continuumXminYmaxZmin', 'dirichlet_fieldx_componentx_continuumXminYmin', 'dirichlet_fieldx_componentx_continuumXminYminZmax', 'dirichlet_fieldx_componentx_continuumXminYminZmin', 'dirichlet_fieldx_componentx_continuumXminZmax', 'dirichlet_fieldx_componentx_continuumXminZmin', 'dirichlet_fieldx_componentx_continuumYmax', 'dirichlet_fieldx_componentx_continuumYmaxZmax', 'dirichlet_fieldx_componentx_continuumYmaxZmin', 'dirichlet_fieldx_componentx_continuumYmin', 'dirichlet_fieldx_componentx_continuumYminZmax', 'dirichlet_fieldx_componentx_continuumYminZmin', 'dirichlet_fieldx_componentx_continuumZmax', 'dirichlet_fieldx_componentx_continuumZmin', 'dirichlet_fieldx_componenty_constantXmax', 'dirichlet_fieldx_componenty_constantXmaxYmax', 'dirichlet_fieldx_componenty_constantXmaxYmaxZmax', 'dirichlet_fieldx_componenty_constantXmaxYmaxZmin', 'dirichlet_fieldx_componenty_constantXmaxYmin', 'dirichlet_fieldx_componenty_constantXmaxYminZmax', 'dirichlet_fieldx_componenty_constantXmaxYminZmin', 'dirichlet_fieldx_componenty_constantXmaxZmax', 'dirichlet_fieldx_componenty_constantXmaxZmin', 'dirichlet_fieldx_componenty_constantXmin', 'dirichlet_fieldx_componenty_constantXminYmax', 'dirichlet_fieldx_componenty_constantXminYmaxZmax', 'dirichlet_fieldx_componenty_constantXminYmaxZmin', 'dirichlet_fieldx_componenty_constantXminYmin', 'dirichlet_fieldx_componenty_constantXminYminZmax', 'dirichlet_fieldx_componenty_constantXminYminZmin', 'dirichlet_fieldx_componenty_constantXminZmax', 'dirichlet_fieldx_componenty_constantXminZmin', 'dirichlet_fieldx_componenty_constantYmax', 'dirichlet_fieldx_componenty_constantYmaxZmax', 'dirichlet_fieldx_componenty_constantYmaxZmin', 'dirichlet_fieldx_componenty_constantYmin', 'dirichlet_fieldx_componenty_constantYminZmax', 'dirichlet_fieldx_componenty_constantYminZmin', 'dirichlet_fieldx_componenty_constantZmax', 'dirichlet_fieldx_componenty_constantZmin', 'dirichlet_fieldx_componenty_continuumXmaxYmax', 'dirichlet_fieldx_componenty_continuumXmaxYmaxZmax', 'dirichlet_fieldx_componenty_continuumXmaxYmaxZmin', 'dirichlet_fieldx_componenty_continuumXmaxYmin', 'dirichlet_fieldx_componenty_continuumXmaxYminZmax', 'dirichlet_fieldx_componenty_continuumXmaxYminZmin', 'dirichlet_fieldx_componenty_continuumXmaxZmax', 'dirichlet_fieldx_componenty_continuumXmaxZmin', 'dirichlet_fieldx_componenty_continuumXmin', 'dirichlet_fieldx_componenty_continuumXminYmax', 'dirichlet_fieldx_componenty_continuumXminYmaxZmax', 'dirichlet_fieldx_componenty_continuumXminYmaxZmin', 'dirichlet_fieldx_componenty_continuumXminYmin', 'dirichlet_fieldx_componenty_continuumXminYminZmax', 'dirichlet_fieldx_componenty_continuumXminYminZmin', 'dirichlet_fieldx_componenty_continuumXminZmax', 'dirichlet_fieldx_componenty_continuumXminZmin', 'dirichlet_fieldx_componenty_continuumYmax', 'dirichlet_fieldx_componenty_continuumYmaxZmax', 'dirichlet_fieldx_componenty_continuumYmaxZmin', 'dirichlet_fieldx_componenty_continuumYmin', 'dirichlet_fieldx_componenty_continuumYminZmax', 'dirichlet_fieldx_componenty_continuumYminZmin', 'dirichlet_fieldx_componenty_continuumZmax', 'dirichlet_fieldx_componenty_continuumZmin', 'dirichlet_fieldx_componentz_constantXmax', 'dirichlet_fieldx_componentz_constantXmaxYmax', 'dirichlet_fieldx_componentz_constantXmaxYmaxZmax', 'dirichlet_fieldx_componentz_constantXmaxYmaxZmin', 'dirichlet_fieldx_componentz_constantXmaxYmin', 'dirichlet_fieldx_componentz_constantXmaxYminZmax', 'dirichlet_fieldx_componentz_constantXmaxYminZmin', 'dirichlet_fieldx_componentz_constantXmaxZmax', 'dirichlet_fieldx_componentz_constantXmaxZmin', 'dirichlet_fieldx_componentz_constantXmin', 'dirichlet_fieldx_componentz_constantXminYmax', 'dirichlet_fieldx_componentz_constantXminYmaxZmax', 'dirichlet_fieldx_componentz_constantXminYmaxZmin', 'dirichlet_fieldx_componentz_constantXminYmin', 'dirichlet_fieldx_componentz_constantXminYminZmax', 'dirichlet_fieldx_componentz_constantXminYminZmin', 'dirichlet_fieldx_componentz_constantXminZmax', 'dirichlet_fieldx_componentz_constantXminZmin', 'dirichlet_fieldx_componentz_constantYmax', 'dirichlet_fieldx_componentz_constantYmaxZmax', 'dirichlet_fieldx_componentz_constantYmaxZmin', 'dirichlet_fieldx_componentz_constantYmin', 'dirichlet_fieldx_componentz_constantYminZmax', 'dirichlet_fieldx_componentz_constantYminZmin', 'dirichlet_fieldx_componentz_constantZmax', 'dirichlet_fieldx_componentz_constantZmin', 'dirichlet_fieldx_componentz_continuumXmaxYmax', 'dirichlet_fieldx_componentz_continuumXmaxYmaxZmax', 'dirichlet_fieldx_componentz_continuumXmaxYmaxZmin', 'dirichlet_fieldx_componentz_continuumXmaxYmin', 'dirichlet_fieldx_componentz_continuumXmaxYminZmax', 'dirichlet_fieldx_componentz_continuumXmaxYminZmin', 'dirichlet_fieldx_componentz_continuumXmaxZmax', 'dirichlet_fieldx_componentz_continuumXmaxZmin', 'dirichlet_fieldx_componentz_continuumXmin', 'dirichlet_fieldx_componentz_continuumXminYmax', 'dirichlet_fieldx_componentz_continuumXminYmaxZmax', 'dirichlet_fieldx_componentz_continuumXminYmaxZmin', 'dirichlet_fieldx_componentz_continuumXminYmin', 'dirichlet_fieldx_componentz_continuumXminYminZmax', 'dirichlet_fieldx_componentz_continuumXminYminZmin', 'dirichlet_fieldx_componentz_continuumXminZmax', 'dirichlet_fieldx_componentz_continuumXminZmin', 'dirichlet_fieldx_componentz_continuumYmax', 'dirichlet_fieldx_componentz_continuumYmaxZmax', 'dirichlet_fieldx_componentz_continuumYmaxZmin', 'dirichlet_fieldx_componentz_continuumYmin', 'dirichlet_fieldx_componentz_continuumYminZmax', 'dirichlet_fieldx_componentz_continuumYminZmin', 'dirichlet_fieldx_componentz_continuumZmax', 'dirichlet_fieldx_componentz_continuumZmin']) findMenu(findWidget('OOF3D:MenuBar'), 'File:Save:Python_Log').activate() checkpoint toplevel widget mapped Dialog-Python_Log findWidget('Dialog-Python_Log').resize(190, 92) findWidget('Dialog-Python_Log:filename').set_text('bcpage.log') findWidget('Dialog-Python_Log:gtk-ok').clicked() checkpoint OOF.File.Save.Python_Log assert tests.filediff('bcpage.log') widget_2=findWidget('OOF3D') handled_2=widget_2.event(event(gtk.gdk.DELETE,window=widget_2.window)) postpone if not handled_2: widget_2.destroy() checkpoint OOF.Graphics_1.File.Close

55.954228

7,516

0.846691

19,165

160,141

7.009236

0.013566

0.152458

0.177054

0.178066

0.942724

0.939597

0.936992

0.935779

0.93493

0.933396

0

0.019049

0.073623

160,141

2,862

7,517

55.954228

0.886452

0.003297

0

0.927669

0

0.372787

0.149671

0

0.001404

0

null

0

0.000351

null

0

null

0

1

0

1

0

1

0

null

0

1

0

10

1fae3b6c4afbe83ac58ddfd038418c206fcadd4f

815

py

Python

tests/data/fstring.py

qualname/grey

f2ed7cc92c1b15c1b47919caab2787b465e2766b

[ "MIT" ]

1

2019-07-19T21:03:39.000Z

tests/data/fstring.py

qualname/grey

f2ed7cc92c1b15c1b47919caab2787b465e2766b

[ "MIT" ]

4

2020-03-24T17:09:13.000Z

2021-06-01T23:45:52.000Z

tests/data/fstring.py

qualname/grey

f2ed7cc92c1b15c1b47919caab2787b465e2766b

[ "MIT" ]

null

f"f-string without formatted values is just a string" f"{{NOT a formatted value}}" f"{{NOT 'a' \"formatted\" \"value\"}}" f"some f-string with {a} {few():.2f} {formatted.values!r}" f'some f-string with {a} {few(""):.2f} {formatted.values!r}' f"{f'''{'nested'} inner'''} outer" f"\"{f'{nested} inner'}\" outer" f"space between opening braces: { {a for a in (1, 2, 3)}}" f'Hello \'{tricky + "example"}\'' # output f'f-string without formatted values is just a string' f'{{NOT a formatted value}}' f'{{NOT \'a\' "formatted" "value"}}' f'some f-string with {a} {few():.2f} {formatted.values!r}' f'some f-string with {a} {few(""):.2f} {formatted.values!r}' f"{f'''{'nested'} inner'''} outer" f"\"{f'{nested} inner'}\" outer" f'space between opening braces: { {a for a in (1, 2, 3)}}' f'Hello \'{tricky + "example"}\''

37.045455

60

0.615951

137

815

3.664234

0.226277

0.023904

0.039841

0.111554

0.988048

0

0.014065

0.127607

815

21

61

38.809524

0.691983

0.007362

0

0.444444

0

0.817844

0

1

0

true

0

null

0

1

0

1

0

null

0

1

0

8

9520d254344e19046472103b0a996d0eef465945

93

py

Python

src/stk/molecular/atoms/__init__.py

stevenbennett96/stk

6e5af87625b83e0bfc7243bc42d8c7a860cbeb76

[ "MIT" ]

21

2018-04-12T16:25:24.000Z

2022-02-14T23:05:43.000Z

src/stk/molecular/atoms/__init__.py

stevenbennett96/stk

6e5af87625b83e0bfc7243bc42d8c7a860cbeb76

[ "MIT" ]

8

2019-03-19T12:36:36.000Z

2020-11-11T12:46:00.000Z

src/stk/molecular/atoms/__init__.py

stevenbennett96/stk

6e5af87625b83e0bfc7243bc42d8c7a860cbeb76

[ "MIT" ]

5

2018-08-07T13:00:16.000Z

2021-11-01T00:55:10.000Z

from .atom import * # noqa from .atom_info import * # noqa from .elements import * # noqa

23.25

32

0.677419

13

93

4.769231

0.461538

0.483871

0.451613

0

0.225806

93

3

33

31

0.861111

0.150538

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

952ede37270738be1a784a297266e9e84e3bd15c

10,198

py

Python

scripts/results/results-figures.py

nmstreethran/WindTurbineClassification

b0ea6de909ccd5bb425cee291ca3c252c11df4eb

[ "MIT" ]

34

2019-03-01T21:24:40.000Z

2022-03-20T09:59:17.000Z

scripts/results/results-figures.py

nmstreethran/WindTurbineClassification

b0ea6de909ccd5bb425cee291ca3c252c11df4eb

[ "MIT" ]

null

scripts/results/results-figures.py

nmstreethran/WindTurbineClassification

b0ea6de909ccd5bb425cee291ca3c252c11df4eb

[ "MIT" ]

8

2019-03-01T21:24:46.000Z

2021-06-26T15:04:14.000Z

"""Plots of results """ # import libraries import pandas as pd import matplotlib.pyplot as plt import numpy as np # decision trees d = pd.read_csv('data/DT.csv') # per turbine d0 = d.groupby('turbine', as_index=False)['f1'].mean() d1 = d.groupby('turbine', as_index=False)['f1'].max() d2 = d.groupby('turbine', as_index=False)['f1'].min() d3 = d.groupby('turbine', as_index=False)['f'].mean() d4 = d.groupby('turbine', as_index=False)['f'].max() d5 = d.groupby('turbine', as_index=False)['f'].min() x = np.array(d0['turbine']) y = np.array(d0['f1']) eh = np.array(d1['f1']) el = np.array(d2['f1']) y1 = np.array(d3['f']) eh1 = np.array(d4['f']) el1 = np.array(d5['f']) fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y1, linestyle='None', color='#3F2B78', marker='o', label='imbalanced') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='#3F2B78', capsize=3) plt.xticks(list(range(1, 26))) plt.xlabel('Turbine') plt.ylabel('F1 score') plt.legend(loc=4) plt.show() # per turbine category d0 = d.groupby('fault', as_index=False)['f1'].mean() d1 = d.groupby('fault', as_index=False)['f1'].max() d2 = d.groupby('fault', as_index=False)['f1'].min() d3 = d.groupby('fault', as_index=False)['f'].mean() d4 = d.groupby('fault', as_index=False)['f'].max() d5 = d.groupby('fault', as_index=False)['f'].min() x = np.array(list(range(1, 15))) y = np.array(d0['f1']) eh = np.array(d1['f1']) el = np.array(d2['f1']) y1 = np.array(d3['f']) eh1 = np.array(d4['f']) el1 = np.array(d5['f']) fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y1, linestyle='None', color='#3F2B78', marker='o', label='imbalanced') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='#3F2B78', capsize=3) plt.xticks(range(1, 15), sorted(d0['fault'].tolist(), key=int)) plt.xlabel('Turbine category') plt.ylabel('F1 score') plt.legend(loc=4) plt.show() # random forests d = pd.read_csv('data/RF.csv') # per turbine d0 = d.groupby('turbine', as_index=False)['f1'].mean() d1 = d.groupby('turbine', as_index=False)['f1'].max() d2 = d.groupby('turbine', as_index=False)['f1'].min() d3 = d.groupby('turbine', as_index=False)['f'].mean() d4 = d.groupby('turbine', as_index=False)['f'].max() d5 = d.groupby('turbine', as_index=False)['f'].min() x = np.array(d0['turbine']) y = np.array(d0['f1']) eh = np.array(d1['f1']) el = np.array(d2['f1']) y1 = np.array(d3['f']) eh1 = np.array(d4['f']) el1 = np.array(d5['f']) fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y1, linestyle='None', color='#3F2B78', marker='o', label='imbalanced') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='#3F2B78', capsize=3) plt.xticks(list(range(1, 26))) plt.xlabel('Turbine') plt.ylabel('F1 score') plt.legend(loc=4) plt.show() # per turbine category d0 = d.groupby('fault', as_index=False)['f1'].mean() d1 = d.groupby('fault', as_index=False)['f1'].max() d2 = d.groupby('fault', as_index=False)['f1'].min() d3 = d.groupby('fault', as_index=False)['f'].mean() d4 = d.groupby('fault', as_index=False)['f'].max() d5 = d.groupby('fault', as_index=False)['f'].min() fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y1, linestyle='None', color='#3F2B78', marker='o', label='imbalanced') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='#3F2B78', capsize=3) plt.xticks(range(1, 15), sorted(d0['fault'].tolist(), key=int)) plt.xlabel('Turbine category') plt.ylabel('F1 score') plt.legend(loc=4) plt.show() # k nearest neighbours d = pd.read_csv('data/knn.csv') # per turbine d0 = d.groupby('turbine', as_index=False)['f1'].mean() d1 = d.groupby('turbine', as_index=False)['f1'].max() d2 = d.groupby('turbine', as_index=False)['f1'].min() d3 = d.groupby('turbine', as_index=False)['f'].mean() d4 = d.groupby('turbine', as_index=False)['f'].max() d5 = d.groupby('turbine', as_index=False)['f'].min() x = np.array(d0['turbine']) y = np.array(d0['f1']) eh = np.array(d1['f1']) el = np.array(d2['f1']) y1 = np.array(d3['f']) eh1 = np.array(d4['f']) el1 = np.array(d5['f']) fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y1, linestyle='None', color='#3F2B78', marker='o', label='imbalanced') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='#3F2B78', capsize=3) plt.xticks(list(range(1, 26))) plt.xlabel('Turbine') plt.ylabel('F1 score') plt.legend(loc=4) plt.show() # per turbine category d0 = d.groupby('fault', as_index=False)['f1'].mean() d1 = d.groupby('fault', as_index=False)['f1'].max() d2 = d.groupby('fault', as_index=False)['f1'].min() d3 = d.groupby('fault', as_index=False)['f'].mean() d4 = d.groupby('fault', as_index=False)['f'].max() d5 = d.groupby('fault', as_index=False)['f'].min() x = np.array(list(range(1, 15))) y = np.array(d0['f1']) eh = np.array(d1['f1']) el = np.array(d2['f1']) y1 = np.array(d3['f']) eh1 = np.array(d4['f']) el1 = np.array(d5['f']) fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y1, linestyle='None', color='#3F2B78', marker='o', label='imbalanced') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='#3F2B78', capsize=3) plt.xticks(range(1, 15), sorted(d0['fault'].tolist(), key=int)) plt.xlabel('Turbine category') plt.ylabel('F1 score') plt.legend(loc=4) plt.show() # kNN optimised k d_k = pd.read_csv('data/knn-k.csv') # per turbine d0 = d_k.groupby('turbine', as_index=False)['f1'].mean() d1 = d_k.groupby('turbine', as_index=False)['f1'].max() d2 = d_k.groupby('turbine', as_index=False)['f1'].min() d3 = d_k.groupby('turbine', as_index=False)['f'].mean() d4 = d_k.groupby('turbine', as_index=False)['f'].max() d5 = d_k.groupby('turbine', as_index=False)['f'].min() x = np.array(d0['turbine']) y = np.array(d0['f1']) eh = np.array(d1['f1']) el = np.array(d2['f1']) y1 = np.array(d3['f']) eh1 = np.array(d4['f']) el1 = np.array(d5['f']) d6 = d.groupby('turbine', as_index=False)['f1'].mean() d7 = d.groupby('turbine', as_index=False)['f1'].max() d8 = d.groupby('turbine', as_index=False)['f1'].min() y2 = np.array(d6['f1']) eh2 = np.array(d7['f1']) el2 = np.array(d8['f1']) fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y2, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y2, [y2 - el2, eh2 - y2], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y, linestyle='None', color='#3F2B78', marker='o', label='imbalanced, without k optimisation') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#3F2B78', capsize=3) plt.errorbar( x, y1, linestyle='None', color='C0', marker='o', label='imbalanced, with k optimisation') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='C0', capsize=3) plt.xticks(list(range(1, 26))) plt.xlabel('Turbine') plt.ylabel('F1 score') plt.legend() plt.show() # per turbine category d0 = d_k.groupby('fault', as_index=False)['f1'].mean() d1 = d_k.groupby('fault', as_index=False)['f1'].max() d2 = d_k.groupby('fault', as_index=False)['f1'].min() d3 = d_k.groupby('fault', as_index=False)['f'].mean() d4 = d_k.groupby('fault', as_index=False)['f'].max() d5 = d_k.groupby('fault', as_index=False)['f'].min() d6 = d.groupby('fault', as_index=False)['f1'].mean() d7 = d.groupby('fault', as_index=False)['f1'].max() d8 = d.groupby('fault', as_index=False)['f1'].min() y2 = np.array(d6['f1']) eh2 = np.array(d7['f1']) el2 = np.array(d8['f1']) x = np.array(list(range(1, 15))) y = np.array(d0['f1']) eh = np.array(d1['f1']) el = np.array(d2['f1']) y1 = np.array(d3['f']) eh1 = np.array(d4['f']) el1 = np.array(d5['f']) fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.errorbar( x, y2, linestyle='None', color='#098A63', marker='o', label='balanced') plt.errorbar( x, y2, [y2 - el2, eh2 - y2], linestyle='None', ecolor='#098A63', capsize=3) plt.errorbar( x, y, linestyle='None', color='#3F2B78', marker='o', label='imbalanced, without k optimisation') plt.errorbar( x, y, [y - el, eh - y], linestyle='None', ecolor='#3F2B78', capsize=3) plt.errorbar( x, y1, linestyle='None', color='C0', marker='o', label='imbalanced, with k optimisation') plt.errorbar( x, y1, [y1 - el1, eh1 - y1], linestyle='None', ecolor='C0', capsize=3) plt.xticks(range(1, 15), sorted(d0['fault'].tolist(), key=int)) plt.xlabel('Turbine category') plt.ylabel('F1 score') plt.legend() plt.show() # optimal k d = pd.read_csv('data/knn-optimal.csv') x = d['turbine'] y = d['k_p'] y1 = d['k_r'] y2 = d['k_f'] fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.plot(x, y, color='c', label='k_precision', marker='o') plt.plot(x, y1, color='#098A63', label='k_recall', marker='o') plt.plot(x, y2, color='#3F2B78', label='k_F1-score', marker='o') plt.xlabel('Turbine') plt.ylabel('Optimal k value') plt.xticks(range(1, 26)) plt.legend() plt.show() # optimal k - F1 score fig, ax = plt.subplots(figsize=(10, 4), dpi=500) plt.plot(x, y2, color='#3F2B78', label='k_F1-score', marker='o') plt.xlabel('Turbine') plt.ylabel('Optimal k value') plt.xticks(range(1, 26)) plt.show()

31.86875

77

0.629731

1,706

10,198

3.718054

0.064478

0.060697

0.10216

0.066215

0.961375

0.948605

0.938673

0.935047

0.903831

0.849125

0

0.061734

0.120024

10,198

319

78

31.968652

0.645086

0.025887

0

0.880597

0

0.154157

0

1

0

false

0

0.011194

0

0.011194

0

null

0

1

0

1

0

null

0

7

20fd36fb3b13c374c22e20d970b6857329f20aba

143

py

Python

mvt/blocks/__init__.py

JackMing1986/MultipleVsiualTasks

7f2bd81c41bcd41af34f6953101038201a4f7d37

[ "MIT" ]

2

2021-08-29T16:54:42.000Z

2021-09-27T12:22:10.000Z

mvt/blocks/__init__.py

visriv/multi-visual-tasks

7f2bd81c41bcd41af34f6953101038201a4f7d37

[ "MIT" ]

null

mvt/blocks/__init__.py

visriv/multi-visual-tasks

7f2bd81c41bcd41af34f6953101038201a4f7d37

[ "MIT" ]

1

2022-01-16T20:17:50.000Z

from .backbones import * from .cls_heads import * from .det_heads import * from .losses import * from .necks import * from .roi_heads import *

20.428571

24

0.748252

21

143

4.952381

0.428571

0.480769

0.288462

0

0.167832

143

6

25

23.833333

0.87395

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

1f132019e95ef30d90b31a00df1bb6fad570cd67

6,782

py

Python

thing_gym_ros/envs/reaching/visual.py

utiasSTARS/thing-gym-ros

6e8a034ac0d1686f29bd29e2aaa63f39a5b188d4

[ "MIT" ]

1

2021-12-25T01:10:32.000Z

thing_gym_ros/envs/reaching/visual.py

utiasSTARS/thing-gym-ros

6e8a034ac0d1686f29bd29e2aaa63f39a5b188d4

[ "MIT" ]

null

thing_gym_ros/envs/reaching/visual.py

utiasSTARS/thing-gym-ros

6e8a034ac0d1686f29bd29e2aaa63f39a5b188d4

[ "MIT" ]

null

from thing_gym_ros.envs.reaching.generic import ThingRosReachingGeneric from thing_gym_ros.envs.thing_ros_mb_generic import ThingRosMBEnv REACHING_IMAGE_DEFAULTS = dict( img_in_state=True, depth_in_state=True, dense_reward=False, num_objs=1, state_data=('pose'), max_real_time=5, grip_in_action=False ) REACH_AND_GRASP_IMAGE_DEFAULTS = dict(**REACHING_IMAGE_DEFAULTS) REACH_AND_GRASP_IMAGE_DEFAULTS['grip_in_action'] = True REACH_AND_GRASP_IMAGE_DEFAULTS['state_data'] = ('pose', 'grip_pos', 'prev_grip_pos') # ------------------------------------------------------------------------------------------------------------ # XY Image Envs # ------------------------------------------------------------------------------------------------------------ REACHING_XY_DEFAULTS = dict( valid_act_t_dof=(1, 1, 0), valid_act_r_dof=(0, 0, 0) ) REACHING_XY_IMAGE_DEFAULTS = dict(**REACHING_IMAGE_DEFAULTS, **REACHING_XY_DEFAULTS) REACH_AND_GRASP_XY_IMAGE_DEFAULTS = dict(**REACH_AND_GRASP_IMAGE_DEFAULTS, **REACHING_XY_DEFAULTS) class ThingRosReachingXYImage(ThingRosReachingGeneric): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACHING_XY_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachingXYImageMB(ThingRosReachingGeneric, ThingRosMBEnv): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACHING_XY_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachAndGraspXYImage(ThingRosReachingGeneric): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACH_AND_GRASP_XY_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachAndGraspXYImageMB(ThingRosReachingGeneric, ThingRosMBEnv): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACH_AND_GRASP_XY_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) # ------------------------------------------------------------------------------------------------------------ # XYZ Image Envs # ------------------------------------------------------------------------------------------------------------ REACHING_XYZ_DEFAULTS = dict( valid_act_t_dof=(1, 1, 1), valid_act_r_dof=(0, 0, 0) ) REACHING_XYZ_IMAGE_DEFAULTS = dict(**REACHING_IMAGE_DEFAULTS, **REACHING_XYZ_DEFAULTS) REACH_AND_GRASP_XYZ_IMAGE_DEFAULTS = dict(**REACH_AND_GRASP_IMAGE_DEFAULTS, **REACHING_XYZ_DEFAULTS) class ThingRosReachingXYZImage(ThingRosReachingGeneric): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACHING_XYZ_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachingXYZImageMB(ThingRosReachingGeneric, ThingRosMBEnv): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACHING_XYZ_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachAndGraspXYZImage(ThingRosReachingGeneric): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACH_AND_GRASP_XYZ_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachAndGraspXYZImageMB(ThingRosReachingGeneric, ThingRosMBEnv): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACH_AND_GRASP_XYZ_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) # ------------------------------------------------------------------------------------------------------------ # 6Dof Image Envs # ------------------------------------------------------------------------------------------------------------ REACHING_6DOF_DEFAULTS = dict( valid_act_t_dof=(1, 1, 1), valid_act_r_dof=(1, 1, 1) ) REACHING_6DOF_IMAGE_DEFAULTS = dict(**REACHING_IMAGE_DEFAULTS, **REACHING_6DOF_DEFAULTS) REACH_AND_GRASP_6DOF_IMAGE_DEFAULTS = dict(**REACH_AND_GRASP_IMAGE_DEFAULTS, **REACHING_6DOF_DEFAULTS) class ThingRosReaching6DOFImage(ThingRosReachingGeneric): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACHING_6DOF_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReaching6DOFImageMB(ThingRosReachingGeneric, ThingRosMBEnv): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACHING_6DOF_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachAndGrasp6DOFImage(ThingRosReachingGeneric): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACH_AND_GRASP_6DOF_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs) class ThingRosReachAndGrasp6DOFImageMB(ThingRosReachingGeneric, ThingRosMBEnv): def __init__(self, reset_teleop_available=False, success_feedback_available=False, **kwargs): super().__init__(**REACH_AND_GRASP_6DOF_IMAGE_DEFAULTS, reset_teleop_available=reset_teleop_available, success_feedback_available=success_feedback_available, **kwargs)

49.50365

110

0.675022

647

6,782

6.448223

0.108192

0.094919

0.172579

0.189837

0.83629

0.795781

0.775168

0.74209

0.727709

0.691035

0

0.00596

0.158803

6,782

137

111

49.50365

0.725329

0.102919

0

0.565217

0

0.008724

0

1

0.130435

false

0

0.021739

0

0.282609

0

null

0

1

0

null

0

7

1f8876a54a2bda06bfea60bad2dc4c165d75b998

224,402

py

Python

cast/c_Parser.py

scottfrazer/cAST

a947e20cd76a9cf41b7a5e4998fe1eec31183655

[ "MIT" ]

6

2017-03-26T05:37:36.000Z

2021-11-06T15:25:01.000Z

cast/c_Parser.py

scottfrazer/cAST

a947e20cd76a9cf41b7a5e4998fe1eec31183655

[ "MIT" ]

null

cast/c_Parser.py

scottfrazer/cAST

a947e20cd76a9cf41b7a5e4998fe1eec31183655

[ "MIT" ]

3

2015-04-22T11:47:51.000Z

2019-01-20T09:14:43.000Z

import sys, inspect from cast.ParserCommon import * def whoami(): return inspect.stack()[1][3] def whosdaddy(): return inspect.stack()[2][3] def parse( iterator, entry ): p = c_Parser() return p.parse(iterator, entry) class c_ExpressionParser__expr: def __init__(self, parent): self.__dict__.update(locals()) self.infixBp = { 0: 1000, 2: 5000, 8: 15000, 11: 12000, 12: 15000, 18: 11000, 19: 15000, 21: 1000, 27: 16000, 30: 1000, 31: 1000, 35: 4000, 39: 2000, 40: 1000, 43: 7000, 45: 8000, 46: 1000, 51: 1000, 52: 12000, 55: 8000, 58: 3000, 59: 1000, 63: 15000, 65: 10000, 66: 15000, 69: 15000, 74: 9000, 75: 6000, 76: 1000, 81: 9000, 84: 1000, 88: 9000, 94: 14000, 101: 10000, 103: 9000, 106: 1000, 107: 11000, 111: 12000, } self.prefixBp = { 2: 13000, 3: 13000, 5: 13000, 12: 13000, 18: 13000, 19: 13000, 52: 13000, } def getInfixBp(self, tokenId): try: return self.infixBp[tokenId] except: return 0 def getPrefixBp(self, tokenId): try: return self.prefixBp[tokenId] except: return 0 def getCurrentToken(self): return self.parent.tokens.current() def expect(self, token): return self.parent.expect(token) def parse(self, rbp = 0): left = self.nud() if isinstance(left, ParseTree): left.isExpr = True left.isNud = True while self.getCurrentToken() and rbp < self.getInfixBp(self.getCurrentToken().getId()): left = self.led(left) if left: left.isExpr = True return left def nud(self): tree = ParseTree( NonTerminal(119, '_expr') ) current = self.getCurrentToken() if not current: return tree elif current.getId() in [108]: tree.astTransform = AstTransformNodeCreator('TypeInitializion', {'type': 1, 'initializer': 4}) tree.nudMorphemeCount = 3 tree.add( self.expect(108) ) tree.add( self.parent.parse_type_name() ) tree.add( self.expect(1) ) elif current.getId() in [63]: tree.astTransform = AstTransformSubstitution(2) tree.nudMorphemeCount = 3 tree.add( self.expect(63) ) tree.add( self.parent.parse__expr() ) tree.add( self.expect(1) ) elif current.getId() in [52]: tree.astTransform = AstTransformNodeCreator('Dereference', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(52) ) tree.add( self.parent.parse__expr( self.getPrefixBp(52) ) ) tree.isPrefix = True elif current.getId() in [118]: tree.astTransform = AstTransformNodeCreator('SizeOf', {'var': 1}) tree.nudMorphemeCount = 1 tree.add( self.expect(118) ) elif current.getId() in [12]: tree.astTransform = AstTransformNodeCreator('PreDecr', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(12) ) tree.add( self.parent.parse__expr( self.getPrefixBp(12) ) ) tree.isPrefix = True elif current.getId() in [19]: tree.astTransform = AstTransformNodeCreator('PreIncr', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(19) ) tree.add( self.parent.parse__expr( self.getPrefixBp(19) ) ) tree.isPrefix = True elif current.getId() in [80]: tree.astTransform = AstTransformSubstitution(0) tree.nudMorphemeCount = 1 tree.add( self.expect(80) ) elif current.getId() in [2]: tree.astTransform = AstTransformNodeCreator('AddressOf', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(2) ) tree.add( self.parent.parse__expr( self.getPrefixBp(2) ) ) tree.isPrefix = True elif current.getId() in [80]: tree.astTransform = AstTransformNodeCreator('FuncCall', {'params': 2, 'name': 0}) tree.nudMorphemeCount = 1 tree.add( self.expect(80) ) elif current.getId() in [44]: tree.astTransform = AstTransformSubstitution(0) tree.nudMorphemeCount = 1 tree.add( self.expect(44) ) elif current.getId() in [24, 117, 15, 10, 97, 99]: tree.astTransform = AstTransformSubstitution(0) tree.nudMorphemeCount = 1 tree.add( self.parent.parse_constant() ) elif current.getId() in [80]: tree.astTransform = AstTransformNodeCreator('ArrayIndex', {'params': 2, 'name': 0}) tree.nudMorphemeCount = 1 tree.add( self.expect(80) ) return tree def led(self, left): tree = ParseTree( NonTerminal(119, '_expr') ) current = self.getCurrentToken() if current.getId() == 76: # 'addeq' tree.astTransform = AstTransformNodeCreator('AddAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(76) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(76) - modifier ) ) return tree if current.getId() == 11: # 'mod' tree.astTransform = AstTransformNodeCreator('Mod', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(11) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(11) - modifier ) ) return tree if current.getId() == 94: # 'lbrace' tree.astTransform = AstTransformNodeCreator('TypeInitializion', {'type': 1, 'initializer': 4}) tree.add(left) tree.add( self.expect(94) ) tree.add( self.parent.parse__gen12() ) tree.add( self.parent.parse_trailing_comma_opt() ) tree.add( self.expect(100) ) return tree if current.getId() == 75: # 'bitxor' tree.astTransform = AstTransformNodeCreator('BitXOR', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(75) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(75) - modifier ) ) return tree if current.getId() == 103: # 'gt' tree.astTransform = AstTransformNodeCreator('GreaterThan', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(103) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(103) - modifier ) ) return tree if current.getId() == 40: # 'bitxoreq' tree.astTransform = AstTransformNodeCreator('XORAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(40) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(40) - modifier ) ) return tree if current.getId() == 8: # 'arrow' tree.astTransform = AstTransformNodeCreator('DerefMemberSelect', {'member': 2, 'object': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(8) ) modifier = 0 tree.add( self.parent.parse__expr( self.getInfixBp(8) - modifier ) ) return tree if current.getId() == 82: # 'sizeof_separator' tree.astTransform = AstTransformNodeCreator('SizeOf', {'var': 1}) tree.add(left) tree.add( self.expect(82) ) tree.add( self.parent.parse_sizeof_body() ) return tree if current.getId() == 88: # 'lt' tree.astTransform = AstTransformNodeCreator('LessThan', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(88) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(88) - modifier ) ) return tree if current.getId() == 21: # 'assign' tree.astTransform = AstTransformNodeCreator('Assign', {'var': 0, 'value': 2}) tree.add(left) tree.add( self.expect(21) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(21) - modifier ) ) return tree if current.getId() == 39: # 'questionmark' tree.astTransform = AstTransformNodeCreator('TernaryOperator', {'true': 2, 'false': 4, 'cond': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(39) ) modifier = 1 tree.add( self.parent.parse__expr( self.getInfixBp(39) - modifier ) ) tree.add( self.expect(28) ) modifier = 1 tree.add( self.parent.parse__expr( self.getInfixBp(39) - modifier ) ) return tree if current.getId() == 30: # 'subeq' tree.astTransform = AstTransformNodeCreator('SubtractAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(30) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(30) - modifier ) ) return tree if current.getId() == 2: # 'bitand' tree.astTransform = AstTransformNodeCreator('BitAND', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(2) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(2) - modifier ) ) return tree if current.getId() == 84: # 'modeq' tree.astTransform = AstTransformNodeCreator('ModAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(84) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(84) - modifier ) ) return tree if current.getId() == 101: # 'lshift' tree.astTransform = AstTransformNodeCreator('LeftShift', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(101) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(101) - modifier ) ) return tree if current.getId() == 31: # 'bitoreq' tree.astTransform = AstTransformNodeCreator('ORAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(31) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(31) - modifier ) ) return tree if current.getId() == 106: # 'muleq' tree.astTransform = AstTransformNodeCreator('MultiplyAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(106) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(106) - modifier ) ) return tree if current.getId() == 111: # 'div' tree.astTransform = AstTransformNodeCreator('Div', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(111) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(111) - modifier ) ) return tree if current.getId() == 27: # 'comma' tree.astTransform = AstTransformNodeCreator('Comma', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(27) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(27) - modifier ) ) return tree if current.getId() == 52: # 'asterisk' tree.astTransform = AstTransformNodeCreator('Mul', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(52) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(52) - modifier ) ) return tree if current.getId() == 43: # 'bitor' tree.astTransform = AstTransformNodeCreator('BitOR', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(43) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(43) - modifier ) ) return tree if current.getId() == 0: # 'diveq' tree.astTransform = AstTransformNodeCreator('DivideAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(0) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(0) - modifier ) ) return tree if current.getId() == 107: # 'add' tree.astTransform = AstTransformNodeCreator('Add', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(107) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(107) - modifier ) ) return tree if current.getId() == 19: # 'incr' tree.astTransform = AstTransformNodeCreator('PostIncr', {'var': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(19) ) return tree if current.getId() == 18: # 'sub' tree.astTransform = AstTransformNodeCreator('Sub', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(18) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(18) - modifier ) ) return tree if current.getId() == 74: # 'lteq' tree.astTransform = AstTransformNodeCreator('LessThanEq', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(74) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(74) - modifier ) ) return tree if current.getId() == 69: # 'dot' tree.astTransform = AstTransformNodeCreator('MemberSelect', {'member': 2, 'object': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(69) ) modifier = 0 tree.add( self.parent.parse__expr( self.getInfixBp(69) - modifier ) ) return tree if current.getId() == 65: # 'rshift' tree.astTransform = AstTransformNodeCreator('RightShift', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(65) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(65) - modifier ) ) return tree if current.getId() == 12: # 'decr' tree.astTransform = AstTransformNodeCreator('PostDecr', {'var': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(12) ) return tree if current.getId() == 45: # 'eq' tree.astTransform = AstTransformNodeCreator('Equals', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(45) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(45) - modifier ) ) return tree if current.getId() == 63: # 'lparen' tree.astTransform = AstTransformNodeCreator('FuncCall', {'params': 2, 'name': 0}) tree.add(left) tree.add( self.expect(63) ) tree.add( self.parent.parse__gen44() ) tree.add( self.expect(1) ) return tree if current.getId() == 81: # 'gteq' tree.astTransform = AstTransformNodeCreator('GreaterThanEq', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(81) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(81) - modifier ) ) return tree if current.getId() == 51: # 'lshifteq' tree.astTransform = AstTransformNodeCreator('LeftShiftAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(51) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(51) - modifier ) ) return tree if current.getId() == 46: # 'bitandeq' tree.astTransform = AstTransformNodeCreator('ANDAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(46) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(46) - modifier ) ) return tree if current.getId() == 66: # 'lsquare' tree.astTransform = AstTransformNodeCreator('ArrayIndex', {'params': 2, 'name': 0}) tree.add(left) tree.add( self.expect(66) ) tree.add( self.parent.parse__gen44() ) tree.add( self.expect(77) ) return tree if current.getId() == 59: # 'rshifteq' tree.astTransform = AstTransformNodeCreator('RightShiftAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(59) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr( self.getInfixBp(59) - modifier ) ) return tree return tree class c_ExpressionParser__expr_sans_comma: def __init__(self, parent): self.__dict__.update(locals()) self.infixBp = { 0: 1000, 2: 5000, 8: 15000, 11: 12000, 12: 15000, 18: 11000, 19: 15000, 21: 1000, 30: 1000, 31: 1000, 35: 4000, 39: 2000, 40: 1000, 43: 7000, 45: 8000, 46: 1000, 51: 1000, 52: 12000, 55: 8000, 58: 3000, 59: 1000, 63: 15000, 65: 10000, 66: 15000, 69: 15000, 74: 9000, 75: 6000, 76: 1000, 81: 9000, 84: 1000, 88: 9000, 94: 14000, 101: 10000, 103: 9000, 106: 1000, 107: 11000, 111: 12000, } self.prefixBp = { 2: 13000, 3: 13000, 5: 13000, 12: 13000, 18: 13000, 19: 13000, 52: 13000, } def getInfixBp(self, tokenId): try: return self.infixBp[tokenId] except: return 0 def getPrefixBp(self, tokenId): try: return self.prefixBp[tokenId] except: return 0 def getCurrentToken(self): return self.parent.tokens.current() def expect(self, token): return self.parent.expect(token) def parse(self, rbp = 0): left = self.nud() if isinstance(left, ParseTree): left.isExpr = True left.isNud = True while self.getCurrentToken() and rbp < self.getInfixBp(self.getCurrentToken().getId()): left = self.led(left) if left: left.isExpr = True return left def nud(self): tree = ParseTree( NonTerminal(185, '_expr_sans_comma') ) current = self.getCurrentToken() if not current: return tree if current.getId() in [2]: tree.astTransform = AstTransformNodeCreator('AddressOf', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(2) ) tree.add( self.parent.parse__expr_sans_comma( self.getPrefixBp(2) ) ) tree.isPrefix = True elif current.getId() in [44]: tree.astTransform = AstTransformSubstitution(0) tree.nudMorphemeCount = 1 tree.add( self.expect(44) ) elif current.getId() in [108]: tree.astTransform = AstTransformNodeCreator('TypeInitializion', {'type': 1, 'initializer': 4}) tree.nudMorphemeCount = 3 tree.add( self.expect(108) ) tree.add( self.parent.parse_type_name() ) tree.add( self.expect(1) ) elif current.getId() in [63]: tree.astTransform = AstTransformSubstitution(2) tree.nudMorphemeCount = 3 tree.add( self.expect(63) ) tree.add( self.parent.parse__expr_sans_comma() ) tree.add( self.expect(1) ) elif current.getId() in [52]: tree.astTransform = AstTransformNodeCreator('Dereference', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(52) ) tree.add( self.parent.parse__expr_sans_comma( self.getPrefixBp(52) ) ) tree.isPrefix = True elif current.getId() in [80]: tree.astTransform = AstTransformSubstitution(0) tree.nudMorphemeCount = 1 tree.add( self.expect(80) ) elif current.getId() in [118]: tree.astTransform = AstTransformNodeCreator('SizeOf', {'var': 1}) tree.nudMorphemeCount = 1 tree.add( self.expect(118) ) elif current.getId() in [12]: tree.astTransform = AstTransformNodeCreator('PreDecr', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(12) ) tree.add( self.parent.parse__expr_sans_comma( self.getPrefixBp(12) ) ) tree.isPrefix = True elif current.getId() in [19]: tree.astTransform = AstTransformNodeCreator('PreIncr', {'var': 1}) tree.nudMorphemeCount = 2 tree.add( self.expect(19) ) tree.add( self.parent.parse__expr_sans_comma( self.getPrefixBp(19) ) ) tree.isPrefix = True elif current.getId() in [80]: tree.astTransform = AstTransformNodeCreator('ArrayIndex', {'params': 2, 'name': 0}) tree.nudMorphemeCount = 1 tree.add( self.expect(80) ) elif current.getId() in [24, 117, 15, 10, 97, 99]: tree.astTransform = AstTransformSubstitution(0) tree.nudMorphemeCount = 1 tree.add( self.parent.parse_constant() ) elif current.getId() in [80]: tree.astTransform = AstTransformNodeCreator('FuncCall', {'params': 2, 'name': 0}) tree.nudMorphemeCount = 1 tree.add( self.expect(80) ) return tree def led(self, left): tree = ParseTree( NonTerminal(185, '_expr_sans_comma') ) current = self.getCurrentToken() if current.getId() == 103: # 'gt' tree.astTransform = AstTransformNodeCreator('GreaterThan', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(103) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(103) - modifier ) ) return tree if current.getId() == 19: # 'incr' tree.astTransform = AstTransformNodeCreator('PostIncr', {'var': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(19) ) return tree if current.getId() == 40: # 'bitxoreq' tree.astTransform = AstTransformNodeCreator('XORAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(40) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(40) - modifier ) ) return tree if current.getId() == 39: # 'questionmark' tree.astTransform = AstTransformNodeCreator('TernaryOperator', {'true': 2, 'false': 4, 'cond': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(39) ) modifier = 1 tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(39) - modifier ) ) tree.add( self.expect(28) ) modifier = 1 tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(39) - modifier ) ) return tree if current.getId() == 21: # 'assign' tree.astTransform = AstTransformNodeCreator('Assign', {'var': 0, 'value': 2}) tree.add(left) tree.add( self.expect(21) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(21) - modifier ) ) return tree if current.getId() == 30: # 'subeq' tree.astTransform = AstTransformNodeCreator('SubtractAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(30) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(30) - modifier ) ) return tree if current.getId() == 107: # 'add' tree.astTransform = AstTransformNodeCreator('Add', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(107) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(107) - modifier ) ) return tree if current.getId() == 75: # 'bitxor' tree.astTransform = AstTransformNodeCreator('BitXOR', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(75) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(75) - modifier ) ) return tree if current.getId() == 88: # 'lt' tree.astTransform = AstTransformNodeCreator('LessThan', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(88) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(88) - modifier ) ) return tree if current.getId() == 94: # 'lbrace' tree.astTransform = AstTransformNodeCreator('TypeInitializion', {'type': 1, 'initializer': 4}) tree.add(left) tree.add( self.expect(94) ) tree.add( self.parent.parse__gen12() ) tree.add( self.parent.parse_trailing_comma_opt() ) tree.add( self.expect(100) ) return tree if current.getId() == 51: # 'lshifteq' tree.astTransform = AstTransformNodeCreator('LeftShiftAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(51) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(51) - modifier ) ) return tree if current.getId() == 101: # 'lshift' tree.astTransform = AstTransformNodeCreator('LeftShift', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(101) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(101) - modifier ) ) return tree if current.getId() == 11: # 'mod' tree.astTransform = AstTransformNodeCreator('Mod', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(11) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(11) - modifier ) ) return tree if current.getId() == 0: # 'diveq' tree.astTransform = AstTransformNodeCreator('DivideAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(0) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(0) - modifier ) ) return tree if current.getId() == 18: # 'sub' tree.astTransform = AstTransformNodeCreator('Sub', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(18) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(18) - modifier ) ) return tree if current.getId() == 2: # 'bitand' tree.astTransform = AstTransformNodeCreator('BitAND', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(2) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(2) - modifier ) ) return tree if current.getId() == 82: # 'sizeof_separator' tree.astTransform = AstTransformNodeCreator('SizeOf', {'var': 1}) tree.add(left) tree.add( self.expect(82) ) tree.add( self.parent.parse_sizeof_body() ) return tree if current.getId() == 8: # 'arrow' tree.astTransform = AstTransformNodeCreator('DerefMemberSelect', {'member': 2, 'object': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(8) ) modifier = 0 tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(8) - modifier ) ) return tree if current.getId() == 106: # 'muleq' tree.astTransform = AstTransformNodeCreator('MultiplyAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(106) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(106) - modifier ) ) return tree if current.getId() == 74: # 'lteq' tree.astTransform = AstTransformNodeCreator('LessThanEq', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(74) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(74) - modifier ) ) return tree if current.getId() == 12: # 'decr' tree.astTransform = AstTransformNodeCreator('PostDecr', {'var': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(12) ) return tree if current.getId() == 81: # 'gteq' tree.astTransform = AstTransformNodeCreator('GreaterThanEq', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(81) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(81) - modifier ) ) return tree if current.getId() == 66: # 'lsquare' tree.astTransform = AstTransformNodeCreator('ArrayIndex', {'params': 2, 'name': 0}) tree.add(left) tree.add( self.expect(66) ) tree.add( self.parent.parse__gen44() ) tree.add( self.expect(77) ) return tree if current.getId() == 31: # 'bitoreq' tree.astTransform = AstTransformNodeCreator('ORAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(31) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(31) - modifier ) ) return tree if current.getId() == 59: # 'rshifteq' tree.astTransform = AstTransformNodeCreator('RightShiftAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(59) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(59) - modifier ) ) return tree if current.getId() == 52: # 'asterisk' tree.astTransform = AstTransformNodeCreator('Mul', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(52) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(52) - modifier ) ) return tree if current.getId() == 84: # 'modeq' tree.astTransform = AstTransformNodeCreator('ModAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(84) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(84) - modifier ) ) return tree if current.getId() == 43: # 'bitor' tree.astTransform = AstTransformNodeCreator('BitOR', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(43) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(43) - modifier ) ) return tree if current.getId() == 45: # 'eq' tree.astTransform = AstTransformNodeCreator('Equals', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(45) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(45) - modifier ) ) return tree if current.getId() == 69: # 'dot' tree.astTransform = AstTransformNodeCreator('MemberSelect', {'member': 2, 'object': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(69) ) modifier = 0 tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(69) - modifier ) ) return tree if current.getId() == 63: # 'lparen' tree.astTransform = AstTransformNodeCreator('FuncCall', {'params': 2, 'name': 0}) tree.add(left) tree.add( self.expect(63) ) tree.add( self.parent.parse__gen44() ) tree.add( self.expect(1) ) return tree if current.getId() == 76: # 'addeq' tree.astTransform = AstTransformNodeCreator('AddAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(76) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(76) - modifier ) ) return tree if current.getId() == 46: # 'bitandeq' tree.astTransform = AstTransformNodeCreator('ANDAssign', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(46) ) modifier = 1 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(46) - modifier ) ) return tree if current.getId() == 65: # 'rshift' tree.astTransform = AstTransformNodeCreator('RightShift', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(65) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(65) - modifier ) ) return tree if current.getId() == 111: # 'div' tree.astTransform = AstTransformNodeCreator('Div', {'right': 2, 'left': 0}) tree.add(left) tree.add( self.expect(111) ) modifier = 0 tree.isInfix = True tree.add( self.parent.parse__expr_sans_comma( self.getInfixBp(111) - modifier ) ) return tree return tree class c_ExpressionParser__direct_declarator: def __init__(self, parent): self.__dict__.update(locals()) self.infixBp = { 63: 1000, 66: 1000, } self.prefixBp = { } def getInfixBp(self, tokenId): try: return self.infixBp[tokenId] except: return 0 def getPrefixBp(self, tokenId): try: return self.prefixBp[tokenId] except: return 0 def getCurrentToken(self): return self.parent.tokens.current() def expect(self, token): return self.parent.expect(token) def parse(self, rbp = 0): left = self.nud() if isinstance(left, ParseTree): left.isExpr = True left.isNud = True while self.getCurrentToken() and rbp < self.getInfixBp(self.getCurrentToken().getId()): left = self.led(left) if left: left.isExpr = True return left def nud(self): tree = ParseTree( NonTerminal(247, '_direct_declarator') ) current = self.getCurrentToken() if not current: return tree elif current.getId() in [80]: tree.astTransform = AstTransformSubstitution(0) tree.nudMorphemeCount = 1 tree.add( self.expect(80) ) elif current.getId() in [63]: tree.astTransform = AstTransformSubstitution(1) tree.nudMorphemeCount = 3 tree.add( self.expect(63) ) tree.add( self.parent.parse_declarator() ) tree.add( self.expect(1) ) return tree def led(self, left): tree = ParseTree( NonTerminal(247, '_direct_declarator') ) current = self.getCurrentToken() if current.getId() == 66: # 'lsquare' tree.astTransform = AstTransformNodeCreator('Array', {'name': 0, 'size': 2}) tree.isExprNud = True tree.add(left) tree.add( self.expect(66) ) tree.add( self.parent.parse_direct_declarator_expr() ) tree.add( self.expect(77) ) return tree if current.getId() == 63: # 'lparen' tree.astTransform = AstTransformNodeCreator('FunctionSignature', {'params': 2, 'declarator': 0}) tree.isExprNud = True tree.add(left) tree.add( self.expect(63) ) tree.add( self.parent.parse_direct_declarator_parameter_list() ) tree.add( self.expect(1) ) return tree return tree class c_ExpressionParser__direct_abstract_declarator: def __init__(self, parent): self.__dict__.update(locals()) self.infixBp = { 63: 1000, 66: 1000, } self.prefixBp = { 63: 2000, } def getInfixBp(self, tokenId): try: return self.infixBp[tokenId] except: return 0 def getPrefixBp(self, tokenId): try: return self.prefixBp[tokenId] except: return 0 def getCurrentToken(self): return self.parent.tokens.current() def expect(self, token): return self.parent.expect(token) def parse(self, rbp = 0): left = self.nud() if isinstance(left, ParseTree): left.isExpr = True left.isNud = True while self.getCurrentToken() and rbp < self.getInfixBp(self.getCurrentToken().getId()): left = self.led(left) if left: left.isExpr = True return left def nud(self): tree = ParseTree( NonTerminal(228, '_direct_abstract_declarator') ) current = self.getCurrentToken() if not current: return tree elif current.getId() in [63]: tree.astTransform = AstTransformSubstitution(1) tree.nudMorphemeCount = 3 tree.add( self.expect(63) ) tree.add( self.parent.parse_abstract_declarator() ) tree.add( self.expect(1) ) return tree def led(self, left): tree = ParseTree( NonTerminal(228, '_direct_abstract_declarator') ) current = self.getCurrentToken() if current.getId() == 63: # 'lparen' tree.astTransform = AstTransformNodeCreator('AbstractFunction', {'object': '$', 'params': 2}) tree.isExprNud = True tree.add(left) tree.add( self.expect(63) ) tree.add( self.parent.parse__gen46() ) tree.add( self.expect(1) ) return tree if current.getId() == 66: # 'lsquare' tree.astTransform = AstTransformNodeCreator('AbstractArray', {'object': '$', 'size': 2}) tree.isExprNud = True tree.add(left) tree.add( self.expect(66) ) tree.add( self.parent.parse_direct_abstract_declarator_expr() ) tree.add( self.expect(77) ) return tree return tree class c_Parser: # Quark - finite string set maps one string to exactly one int, and vice versa terminals = { 0: 'diveq', 1: 'rparen', 2: 'bitand', 3: 'not', 4: 'register', 5: 'bitnot', 6: 'pound', 7: 'defined_separator', 8: 'arrow', 9: 'if', 10: 'integer_constant', 11: 'mod', 12: 'decr', 13: 'pp_number', 14: 'elipsis', 15: 'floating_constant', 16: 'continue', 17: 'comma_va_args', 18: 'sub', 19: 'incr', 20: 'poundpound', 21: 'assign', 22: 'union', 23: 'else_if', 24: 'enumeration_constant', 25: '_direct_abstract_declarator', 26: 'semi', 27: 'comma', 28: 'colon', 29: 'label_hint', 30: 'subeq', 31: 'bitoreq', 32: 'ampersand', 33: '_expr_sans_comma', 34: 'inline', 35: 'and', 36: 'tilde', 37: 'enum', 38: 'struct', 39: 'questionmark', 40: 'bitxoreq', 41: 'long', 42: 'variable_length_array', 43: 'bitor', 44: 'string_literal', 45: 'eq', 46: 'bitandeq', 47: 'restrict', 48: 'complex', 49: 'int', 50: 'const', 51: 'lshifteq', 52: 'asterisk', 53: 'short', 54: 'typedef_identifier', 55: 'neq', 56: 'break', 57: 'typedef', 58: 'or', 59: 'rshifteq', 60: 'signed', 61: 'for', 62: 'float', 63: 'lparen', 64: 'abstract_parameter_hint', 65: 'rshift', 66: 'lsquare', 67: 'endif', 68: 'else', 69: 'dot', 70: 'default', 71: 'function_definition_hint', 72: 'double', 73: '_expr', 74: 'lteq', 75: 'bitxor', 76: 'addeq', 77: 'rsquare', 78: 'bool', 79: 'unsigned', 80: 'identifier', 81: 'gteq', 82: 'sizeof_separator', 83: 'volatile', 84: 'modeq', 85: 'while', 86: 'defined', 87: 'goto', 88: 'lt', 89: '_direct_declarator', 90: 'static', 91: 'imaginary', 92: 'do', 93: 'declarator_hint', 94: 'lbrace', 95: 'named_parameter_hint', 96: 'void', 97: 'hexadecimal_floating_constant', 98: 'extern', 99: 'decimal_floating_constant', 100: 'rbrace', 101: 'lshift', 102: 'external_declaration_hint', 103: 'gt', 104: 'trailing_comma', 105: 'universal_character_name', 106: 'muleq', 107: 'add', 108: 'lparen_cast', 109: 'exclamation_point', 110: 'return', 111: 'div', 112: 'case', 113: 'switch', 114: 'char', 115: 'auto', 116: 'function_prototype_hint', 117: 'character_constant', 118: 'sizeof', 'diveq': 0, 'rparen': 1, 'bitand': 2, 'not': 3, 'register': 4, 'bitnot': 5, 'pound': 6, 'defined_separator': 7, 'arrow': 8, 'if': 9, 'integer_constant': 10, 'mod': 11, 'decr': 12, 'pp_number': 13, 'elipsis': 14, 'floating_constant': 15, 'continue': 16, 'comma_va_args': 17, 'sub': 18, 'incr': 19, 'poundpound': 20, 'assign': 21, 'union': 22, 'else_if': 23, 'enumeration_constant': 24, '_direct_abstract_declarator': 25, 'semi': 26, 'comma': 27, 'colon': 28, 'label_hint': 29, 'subeq': 30, 'bitoreq': 31, 'ampersand': 32, '_expr_sans_comma': 33, 'inline': 34, 'and': 35, 'tilde': 36, 'enum': 37, 'struct': 38, 'questionmark': 39, 'bitxoreq': 40, 'long': 41, 'variable_length_array': 42, 'bitor': 43, 'string_literal': 44, 'eq': 45, 'bitandeq': 46, 'restrict': 47, 'complex': 48, 'int': 49, 'const': 50, 'lshifteq': 51, 'asterisk': 52, 'short': 53, 'typedef_identifier': 54, 'neq': 55, 'break': 56, 'typedef': 57, 'or': 58, 'rshifteq': 59, 'signed': 60, 'for': 61, 'float': 62, 'lparen': 63, 'abstract_parameter_hint': 64, 'rshift': 65, 'lsquare': 66, 'endif': 67, 'else': 68, 'dot': 69, 'default': 70, 'function_definition_hint': 71, 'double': 72, '_expr': 73, 'lteq': 74, 'bitxor': 75, 'addeq': 76, 'rsquare': 77, 'bool': 78, 'unsigned': 79, 'identifier': 80, 'gteq': 81, 'sizeof_separator': 82, 'volatile': 83, 'modeq': 84, 'while': 85, 'defined': 86, 'goto': 87, 'lt': 88, '_direct_declarator': 89, 'static': 90, 'imaginary': 91, 'do': 92, 'declarator_hint': 93, 'lbrace': 94, 'named_parameter_hint': 95, 'void': 96, 'hexadecimal_floating_constant': 97, 'extern': 98, 'decimal_floating_constant': 99, 'rbrace': 100, 'lshift': 101, 'external_declaration_hint': 102, 'gt': 103, 'trailing_comma': 104, 'universal_character_name': 105, 'muleq': 106, 'add': 107, 'lparen_cast': 108, 'exclamation_point': 109, 'return': 110, 'div': 111, 'case': 112, 'switch': 113, 'char': 114, 'auto': 115, 'function_prototype_hint': 116, 'character_constant': 117, 'sizeof': 118, } # Quark - finite string set maps one string to exactly one int, and vice versa nonterminals = { 119: '_expr', 120: 'struct_declarator_body', 121: 'direct_declarator_size', 122: '_gen7', 123: '_gen44', 124: '_gen21', 125: '_gen45', 126: 'struct_or_union_sub', 127: 'type_name', 128: 'for_init', 129: 'direct_declarator_modifier', 130: 'keyword', 131: 'block_item', 132: 'external_declaration', 133: 'init_declarator_list', 134: '_gen8', 135: 'struct_or_union_body', 136: 'sizeof_body', 137: '_gen16', 138: '_gen28', 139: 'constant', 140: '_gen0', 141: 'enum_specifier_sub', 142: 'storage_class_specifier', 143: 'typedef_name', 144: '_gen18', 145: 'identifier', 146: 'enum_specifier_body', 147: '_gen11', 148: 'type_specifier', 149: 'struct_declaration', 150: 'block_item_list', 151: '_gen17', 152: 'declaration', 153: 'type_qualifier', 154: 'misc', 155: 'struct_specifier', 156: 'function_specifier', 157: '_gen39', 158: 'else_if_statement_list', 159: 'type_qualifier_list_opt', 160: 'specifier_qualifier', 161: '_gen9', 162: '_gen24', 163: 'translation_unit', 164: 'else_statement', 165: '_gen42', 166: '_gen22', 167: 'struct_declarator', 168: '_gen19', 169: '_gen20', 170: '_gen10', 171: 'enumeration_constant', 172: '_gen15', 173: 'punctuator', 174: '_gen43', 175: '_gen27', 176: 'external_declarator', 177: 'else_if_statement', 178: 'init_declarator', 179: 'parameter_type_list', 180: 'initializer', 181: 'designation', 182: 'initializer_list_item', 183: 'external_declaration_sub', 184: 'declarator_initializer', 185: '_expr_sans_comma', 186: 'external_function', 187: 'expression_opt', 188: 'direct_abstract_declarator_expr', 189: 'enumerator_assignment', 190: '_gen12', 191: '_gen13', 192: 'external_declaration_sub_sub', 193: 'named_parameter_declaration', 194: '_gen3', 195: 'designator', 196: '_gen4', 197: '_gen14', 198: 'direct_declarator_parameter_list', 199: 'abstract_parameter_declaration', 200: 'trailing_comma_opt', 201: '_gen25', 202: 'statement', 203: 'for_cond', 204: 'for_incr', 205: '_gen34', 206: '_gen46', 207: 'static_opt', 208: '_gen41', 209: 'parameter_declaration', 210: 'declaration_specifier', 211: '_gen29', 212: '_gen30', 213: 'direct_declarator_expr', 214: '_gen40', 215: 'labeled_statement', 216: 'external_prototype', 217: 'union_specifier', 218: 'abstract_declarator', 219: 'pointer', 220: '_gen35', 221: 'va_args', 222: 'declarator', 223: 'expression_statement', 224: 'pointer_sub', 225: '_gen5', 226: '_gen26', 227: 'selection_statement', 228: '_direct_abstract_declarator', 229: 'compound_statement', 230: 'iteration_statement', 231: '_gen31', 232: '_gen36', 233: 'direct_declarator_modifier_list', 234: 'jump_statement', 235: 'token', 236: '_gen38', 237: '_gen32', 238: 'declaration_list', 239: '_gen33', 240: 'enumerator', 241: 'pp', 242: '_gen1', 243: '_gen2', 244: '_gen6', 245: '_gen37', 246: '_gen23', 247: '_direct_declarator', 248: 'enum_specifier', '_expr': 119, 'struct_declarator_body': 120, 'direct_declarator_size': 121, '_gen7': 122, '_gen44': 123, '_gen21': 124, '_gen45': 125, 'struct_or_union_sub': 126, 'type_name': 127, 'for_init': 128, 'direct_declarator_modifier': 129, 'keyword': 130, 'block_item': 131, 'external_declaration': 132, 'init_declarator_list': 133, '_gen8': 134, 'struct_or_union_body': 135, 'sizeof_body': 136, '_gen16': 137, '_gen28': 138, 'constant': 139, '_gen0': 140, 'enum_specifier_sub': 141, 'storage_class_specifier': 142, 'typedef_name': 143, '_gen18': 144, 'identifier': 145, 'enum_specifier_body': 146, '_gen11': 147, 'type_specifier': 148, 'struct_declaration': 149, 'block_item_list': 150, '_gen17': 151, 'declaration': 152, 'type_qualifier': 153, 'misc': 154, 'struct_specifier': 155, 'function_specifier': 156, '_gen39': 157, 'else_if_statement_list': 158, 'type_qualifier_list_opt': 159, 'specifier_qualifier': 160, '_gen9': 161, '_gen24': 162, 'translation_unit': 163, 'else_statement': 164, '_gen42': 165, '_gen22': 166, 'struct_declarator': 167, '_gen19': 168, '_gen20': 169, '_gen10': 170, 'enumeration_constant': 171, '_gen15': 172, 'punctuator': 173, '_gen43': 174, '_gen27': 175, 'external_declarator': 176, 'else_if_statement': 177, 'init_declarator': 178, 'parameter_type_list': 179, 'initializer': 180, 'designation': 181, 'initializer_list_item': 182, 'external_declaration_sub': 183, 'declarator_initializer': 184, '_expr_sans_comma': 185, 'external_function': 186, 'expression_opt': 187, 'direct_abstract_declarator_expr': 188, 'enumerator_assignment': 189, '_gen12': 190, '_gen13': 191, 'external_declaration_sub_sub': 192, 'named_parameter_declaration': 193, '_gen3': 194, 'designator': 195, '_gen4': 196, '_gen14': 197, 'direct_declarator_parameter_list': 198, 'abstract_parameter_declaration': 199, 'trailing_comma_opt': 200, '_gen25': 201, 'statement': 202, 'for_cond': 203, 'for_incr': 204, '_gen34': 205, '_gen46': 206, 'static_opt': 207, '_gen41': 208, 'parameter_declaration': 209, 'declaration_specifier': 210, '_gen29': 211, '_gen30': 212, 'direct_declarator_expr': 213, '_gen40': 214, 'labeled_statement': 215, 'external_prototype': 216, 'union_specifier': 217, 'abstract_declarator': 218, 'pointer': 219, '_gen35': 220, 'va_args': 221, 'declarator': 222, 'expression_statement': 223, 'pointer_sub': 224, '_gen5': 225, '_gen26': 226, 'selection_statement': 227, '_direct_abstract_declarator': 228, 'compound_statement': 229, 'iteration_statement': 230, '_gen31': 231, '_gen36': 232, 'direct_declarator_modifier_list': 233, 'jump_statement': 234, 'token': 235, '_gen38': 236, '_gen32': 237, 'declaration_list': 238, '_gen33': 239, 'enumerator': 240, 'pp': 241, '_gen1': 242, '_gen2': 243, '_gen6': 244, '_gen37': 245, '_gen23': 246, '_direct_declarator': 247, 'enum_specifier': 248, } # table[nonterminal][terminal] = rule table = [ [-1, 23, 331, -1, -1, -1, -1, -1, 23, -1, 331, -1, 23, -1, -1, 331, -1, -1, -1, 23, -1, 390, -1, -1, 331, -1, 23, 23, 23, -1, -1, -1, -1, 331, -1, -1, -1, -1, -1, 23, -1, -1, -1, -1, 331, -1, -1, -1, -1, -1, -1, -1, 331, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 331, -1, -1, 390, -1, -1, 23, -1, -1, -1, -1, -1, -1, -1, 23, -1, -1, 331, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 390, -1, -1, 331, -1, 331, -1, -1, -1, -1, 23, -1, -1, -1, 331, -1, -1, -1, -1, -1, -1, -1, -1, 331, 331], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 17, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 360, -1, -1, -1, -1, -1, -1, -1, 360, -1, 360, -1, -1, 360, -1, -1, -1, 360, -1, -1, -1, -1, 360, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 217, -1, 360, -1, -1, -1, -1, -1, -1, -1, 360, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 360, -1, -1, -1, -1, -1, -1, -1, -1, -1, 360, -1, -1, -1, -1, -1, -1, 360, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 360, -1, 360, -1, -1, -1, -1, -1, -1, -1, -1, 360, -1, -1, -1, -1, -1, -1, -1, -1, 360, 360], [-1, -1, -1, -1, 183, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 183, -1, -1, -1, 86, 86, -1, -1, -1, -1, -1, -1, 183, -1, -1, 183, 183, -1, -1, 183, -1, -1, -1, -1, -1, 183, 183, 183, 183, -1, -1, 183, 183, -1, -1, 183, -1, -1, 183, -1, 183, -1, -1, -1, -1, -1, -1, -1, -1, -1, 183, -1, -1, -1, -1, -1, 183, 183, -1, -1, -1, 183, -1, -1, -1, -1, -1, -1, 183, 183, -1, -1, 86, -1, 183, -1, 183, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 183, 183, -1, -1, -1], [-1, -1, 105, -1, -1, -1, -1, -1, -1, -1, 105, -1, 105, -1, -1, 105, -1, -1, -1, 105, -1, -1, -1, -1, 105, -1, -1, -1, -1, -1, -1, -1, -1, 105, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 105, -1, -1, -1, -1, -1, -1, -1, 105, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 105, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 105, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 105, -1, 105, -1, -1, -1, -1, -1, -1, -1, -1, 105, -1, -1, -1, -1, -1, -1, -1, -1, 105, 105], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 339, 339, 211, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 18, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 7, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 6, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 291, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 359, -1, -1, -1, -1], [-1, -1, 132, -1, 187, -1, -1, -1, -1, -1, 132, -1, 132, -1, -1, 132, -1, -1, -1, 132, -1, -1, 187, -1, 132, -1, 14, -1, -1, -1, -1, -1, -1, -1, 187, -1, -1, 187, 187, -1, -1, 187, -1, -1, 132, -1, -1, 187, 187, 187, 187, -1, 132, 187, 187, -1, -1, 187, -1, -1, 187, -1, 187, 132, -1, -1, -1, -1, -1, -1, -1, -1, 187, 132, -1, -1, -1, -1, 187, 187, 132, -1, -1, 187, -1, -1, -1, -1, -1, -1, 187, 187, -1, -1, -1, -1, 187, 132, 187, 132, -1, -1, -1, -1, -1, -1, -1, -1, 132, -1, -1, -1, -1, -1, 187, 187, -1, 132, 132], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 81, -1, -1, 81, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 81, -1, -1, -1, -1, -1, -1, 230, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, 330, -1, -1, -1, -1, 121, -1, -1, -1, -1, -1, -1, 29, -1, -1, -1, -1, -1, 249, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 405, -1, -1, 410, 397, -1, -1, 138, -1, -1, -1, -1, -1, 344, 5, 30, 395, -1, -1, 185, -1, -1, 325, 37, -1, -1, 178, 348, 338, -1, -1, -1, -1, -1, 123, -1, 106, -1, 35, -1, -1, -1, -1, -1, 416, 327, -1, -1, -1, 372, -1, 310, -1, 116, -1, -1, 259, 21, 115, -1, -1, -1, 357, -1, 394, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 2, -1, 413, 219, 136, 314, -1, -1, 34], [-1, -1, 55, -1, 46, -1, -1, -1, -1, 55, 55, -1, 55, -1, -1, 55, 55, -1, -1, 55, -1, -1, 46, -1, 55, -1, 55, -1, -1, 55, -1, -1, -1, -1, 46, -1, -1, 46, 46, -1, -1, 46, -1, -1, 55, -1, -1, 46, 46, 46, 46, -1, 55, 46, 46, -1, 55, 46, -1, -1, 46, 55, 46, 55, -1, -1, -1, -1, -1, -1, 55, -1, 46, 55, -1, -1, -1, -1, 46, 46, 55, -1, -1, 46, -1, 55, -1, 55, -1, -1, 46, 46, 55, -1, 55, -1, 46, 55, 46, 55, -1, -1, -1, -1, -1, -1, -1, -1, 55, -1, 55, -1, 55, 55, 46, 46, -1, 55, 55], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 71, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 56, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 56, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 56, -1, -1, -1, -1, -1, -1, -1, -1, 56, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 193, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 373, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 373, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 373, -1, -1, -1, -1, -1, -1, -1, -1, 373, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 296, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 381, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 52, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, 248, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 248, -1, -1, -1, -1, 248, -1, -1, 248, 248, 248, 248, -1, -1, -1, -1, -1, 248, -1, -1, 248, 248, -1, -1, 248, -1, -1, -1, -1, -1, 248, 248, 248, 248, -1, 248, 248, 248, -1, -1, 248, -1, -1, 248, -1, 248, 248, -1, -1, -1, -1, -1, -1, -1, 248, 248, -1, -1, -1, -1, -1, 248, 248, 248, -1, -1, 248, -1, -1, -1, -1, -1, 248, 248, 248, -1, 248, 231, -1, 248, -1, 248, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 248, 248, 248, -1, -1], [-1, -1, 108, -1, -1, -1, -1, -1, -1, -1, 108, -1, 108, -1, -1, 108, -1, -1, -1, 108, -1, -1, -1, -1, 108, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 108, -1, 108, -1, -1, 243, -1, -1, 243, -1, 108, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 108, -1, -1, -1, -1, -1, -1, -1, -1, -1, 108, -1, -1, -1, -1, -1, -1, 108, -1, -1, 243, -1, -1, -1, -1, -1, -1, 243, -1, -1, -1, -1, -1, -1, 108, -1, 108, -1, -1, -1, -1, -1, -1, -1, -1, 108, -1, -1, -1, -1, -1, -1, -1, -1, 108, 108], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 294, -1, -1, -1, -1, 358, -1, -1, -1, -1, -1, -1, -1, -1, 68, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 57, -1, 207, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 48, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 396, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 306, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 85, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, 276, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 326, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 84, -1, -1, -1, -1, -1, -1, -1, 356, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 58, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 220, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 262, -1, -1, -1, -1, -1, 266, -1, -1, -1, -1, -1, -1, -1, -1, 262, 262, -1, -1, 262, -1, -1, -1, -1, -1, 262, 262, 262, 262, -1, 266, 262, 262, -1, -1, -1, -1, -1, 262, -1, 262, 266, -1, -1, -1, -1, -1, -1, -1, -1, 262, -1, -1, -1, -1, -1, 262, 262, 266, -1, -1, 262, -1, -1, -1, -1, -1, 266, -1, 262, -1, -1, -1, -1, 262, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 262, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 44, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 12, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 134, -1, -1, -1, -1, 92, 92, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 308, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 375, 153, -1, -1, 75, -1, -1, -1, -1, -1, -1, 150, 316, -1, -1, -1, 96, 16, -1, -1, -1, -1, -1, 301, -1, 346, -1, -1, -1, -1, -1, -1, -1, -1, -1, 198, -1, -1, -1, -1, -1, 305, 206, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 297, -1, -1, -1, -1, 352, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 341, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 36, -1, -1, -1, -1, -1, 36, -1, -1, -1, -1, -1, -1, -1, -1, 36, 36, -1, -1, 36, -1, -1, -1, -1, -1, 36, 36, 36, 36, -1, 36, 36, 36, -1, -1, -1, -1, -1, 36, -1, 36, 36, -1, -1, -1, -1, -1, -1, -1, -1, 36, -1, -1, -1, -1, -1, 36, 36, 36, -1, -1, 36, -1, -1, -1, -1, -1, 36, -1, 36, -1, -1, -1, -1, 36, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 36, -1, -1, -1, -1], [-1, -1, 281, -1, 281, -1, -1, -1, -1, 281, 281, -1, 281, -1, -1, 281, 281, -1, -1, 281, -1, -1, 281, -1, 281, -1, 281, -1, -1, 281, -1, -1, -1, -1, 281, -1, -1, 281, 281, -1, -1, 281, -1, -1, 281, -1, -1, 281, 281, 281, 281, -1, 281, 281, 281, -1, 281, 281, -1, -1, 281, 281, 281, 281, -1, -1, -1, -1, -1, -1, 281, -1, 281, 281, -1, -1, -1, -1, 281, 281, 281, -1, -1, 281, -1, 281, -1, 281, -1, -1, 281, 281, 281, -1, 281, -1, 281, 281, 281, 281, 281, -1, -1, -1, -1, -1, -1, -1, 281, -1, 281, -1, 281, 281, 281, 281, -1, 281, 281], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 258, -1, -1, -1, -1, -1, 258, -1, -1, -1, -1, -1, -1, -1, -1, 258, 258, -1, -1, 258, -1, -1, -1, -1, -1, 258, 258, 258, 258, -1, 258, 258, 258, -1, -1, -1, -1, -1, 258, -1, 258, 258, -1, -1, -1, -1, -1, -1, -1, -1, 258, -1, -1, -1, -1, -1, 258, 258, 258, -1, -1, 258, -1, -1, -1, -1, -1, 258, -1, 258, -1, -1, -1, -1, 258, -1, -1, -1, 252, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 258, -1, -1, -1, -1], [-1, -1, -1, -1, 412, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 412, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 412, -1, -1, 412, 412, -1, -1, 412, -1, -1, -1, -1, -1, 412, 412, 412, 412, -1, -1, 412, 412, -1, -1, 412, -1, -1, 412, -1, 412, -1, -1, -1, -1, -1, -1, -1, -1, -1, 412, -1, -1, -1, -1, -1, 412, 412, -1, -1, -1, 412, -1, -1, -1, -1, -1, -1, 412, 412, -1, -1, -1, -1, 412, -1, 412, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 412, 412, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 240, -1, -1, 286, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 70, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 315, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 225, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 421, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 275, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 10, -1, 10, -1, -1, -1, -1, 10, 10, -1, 10, -1, -1, 10, 10, -1, -1, 10, -1, -1, 10, -1, 10, -1, 10, -1, -1, 10, -1, -1, -1, -1, 10, -1, -1, 10, 10, -1, -1, 10, -1, -1, 10, -1, -1, 10, 10, 10, 10, -1, 10, 10, 10, -1, 10, 10, -1, -1, 10, 10, 10, 10, -1, -1, -1, -1, -1, -1, 10, -1, 10, 10, -1, -1, -1, -1, 10, 10, 10, -1, -1, 10, -1, 10, -1, 10, -1, -1, 10, 10, 10, -1, 10, -1, 10, 10, 10, 10, 10, -1, -1, -1, -1, -1, -1, -1, 10, -1, 10, -1, 10, 10, 10, 10, -1, 10, 10], [-1, -1, 147, -1, 147, -1, -1, -1, -1, 147, 147, -1, 147, -1, -1, 147, 147, -1, -1, 147, -1, -1, 147, 147, 147, -1, 147, -1, -1, 147, -1, -1, -1, -1, 147, -1, -1, 147, 147, -1, -1, 147, -1, -1, 147, -1, -1, 147, 147, 147, 147, -1, 147, 147, 147, -1, 147, 147, -1, -1, 147, 147, 147, 147, -1, -1, -1, 147, 147, -1, 147, -1, 147, 147, -1, -1, -1, -1, 147, 147, 147, -1, -1, 147, -1, 147, -1, 147, -1, -1, 147, 147, 147, -1, 147, -1, 147, 147, 147, 147, 147, -1, -1, -1, -1, -1, -1, -1, 147, -1, 147, -1, 147, 147, 147, 147, -1, 147, 147], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 19, -1, -1, -1, -1, -1, -1, -1, 19, -1, 19, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 19, -1, -1, 19, -1, 19, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 19, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 19, -1, -1, 19, -1, -1, -1, -1, -1, 19, 19, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 273, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 273, 273, -1, -1, 273, -1, -1, -1, -1, -1, 426, 273, 273, 426, -1, -1, 273, 273, -1, -1, -1, -1, -1, 273, -1, 273, -1, -1, -1, -1, -1, -1, -1, -1, -1, 273, -1, -1, -1, -1, -1, 273, 273, -1, -1, -1, 426, -1, -1, -1, -1, -1, -1, -1, 273, -1, -1, -1, -1, 273, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 273, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 67, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 67, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 67, -1, -1, -1, -1, -1, -1, -1, -1, 67, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 267, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 271, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 367, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 419, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 69, -1, 69, -1, -1, -1, -1, 69, 69, -1, 69, -1, -1, 69, 69, -1, -1, 69, -1, -1, 69, -1, 69, -1, 69, -1, -1, 69, -1, -1, -1, -1, 69, -1, -1, 69, 69, -1, -1, 69, -1, -1, 69, -1, -1, 69, 69, 69, 69, -1, 69, 69, 69, -1, 69, 69, -1, -1, 69, 69, 69, 69, -1, -1, -1, 69, 51, -1, 69, -1, 69, 69, -1, -1, -1, -1, 69, 69, 69, -1, -1, 69, -1, 69, -1, 69, -1, -1, 69, 69, 69, -1, 69, -1, 69, 69, 69, 69, 69, -1, -1, -1, -1, -1, -1, -1, 69, -1, 69, -1, 69, 69, 69, 69, -1, 69, 69], [-1, -1, -1, -1, 245, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 245, -1, -1, -1, -1, 245, -1, -1, 245, 245, 245, 245, -1, -1, -1, -1, -1, 245, -1, -1, 245, 245, -1, -1, 245, -1, -1, -1, -1, -1, 245, 245, 245, 245, -1, 245, 245, 245, -1, -1, 245, -1, -1, 245, -1, 245, 245, -1, -1, -1, -1, -1, -1, -1, 245, 245, -1, -1, -1, -1, -1, 245, 245, 245, -1, -1, 245, -1, -1, -1, -1, -1, 245, 245, 245, -1, 245, 242, -1, 245, -1, 245, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 245, 245, 245, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 79, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 223, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 223, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 223, -1, -1, -1, -1, -1, -1, -1, -1, 223, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 277, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 277, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 277, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 277, -1, -1, -1, -1, -1, -1, -1, -1, 277, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 284, 107, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 59, 72, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 90, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 274, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 278, -1, -1, 278, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, 128, -1, -1, -1, -1, 241, -1, 40, -1, -1, 269, 261, -1, 189, -1, -1, -1, 391, 28, 370, 374, -1, -1, -1, -1, 152, 162, 312, -1, 354, 288, 177, -1, -1, 250, 270, -1, -1, 366, 287, -1, -1, 65, -1, 77, 53, -1, -1, -1, -1, 130, -1, -1, -1, 22, -1, -1, 199, 25, -1, -1, -1, 415, -1, 145, 292, -1, -1, 64, -1, -1, -1, -1, 208, 32, 300, 362, -1, -1, -1, 201, -1, -1, 244, -1, -1, -1, 329, -1, -1, -1, -1, -1, 411, -1, -1, -1, -1, -1, 114, 192, -1, 1, -1, -1, 47, 214, -1, 251, -1, 157, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 95, -1, 95, -1, -1, -1, -1, 95, 95, -1, 95, -1, -1, 95, 95, -1, -1, 95, -1, -1, 95, 142, 95, -1, 95, -1, -1, 95, -1, -1, -1, -1, 95, -1, -1, 95, 95, -1, -1, 95, -1, -1, 95, -1, -1, 95, 95, 95, 95, -1, 95, 95, 95, -1, 95, 95, -1, -1, 95, 95, 95, 95, -1, -1, -1, 95, 95, -1, 95, -1, 95, 95, -1, -1, -1, -1, 95, 95, 95, -1, -1, 95, -1, 95, -1, 95, -1, -1, 95, 95, 95, -1, 95, -1, 95, 95, 95, 95, 95, -1, -1, -1, -1, -1, -1, -1, 95, -1, 95, -1, 95, 95, 95, 95, -1, 95, 95], [-1, -1, 318, -1, -1, -1, -1, -1, -1, -1, 318, -1, 318, -1, -1, 318, -1, -1, -1, 318, -1, -1, -1, -1, 318, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 318, -1, 318, -1, -1, 408, -1, -1, 408, -1, 318, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 318, -1, -1, -1, -1, -1, -1, -1, -1, -1, 318, -1, -1, -1, -1, -1, -1, 318, -1, -1, 408, -1, -1, -1, -1, -1, -1, 408, -1, -1, -1, -1, -1, -1, 318, -1, 318, -1, -1, -1, -1, -1, -1, -1, -1, 318, -1, -1, -1, -1, -1, -1, -1, -1, 318, 318], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 382, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 165, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 137, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 137, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 137, -1, -1, -1, -1, -1, -1, -1, -1, 137, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 236, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 236, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 309, -1, -1, -1, -1, -1, -1, -1, 309, -1, 309, -1, -1, 309, -1, -1, -1, 309, -1, -1, -1, -1, 309, -1, -1, -1, -1, -1, -1, -1, -1, 309, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 309, -1, -1, -1, -1, -1, -1, -1, 309, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 309, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 309, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 317, -1, -1, 309, -1, 309, -1, -1, -1, -1, -1, -1, -1, -1, 309, -1, -1, -1, -1, -1, -1, -1, -1, 309, 309], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 365, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 365, -1, -1, 365, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 126, -1, -1, -1, -1, -1, -1, -1, 126, -1, 126, -1, -1, 126, -1, -1, -1, 126, -1, 126, -1, -1, 126, -1, -1, -1, -1, -1, -1, -1, -1, 126, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 126, -1, -1, -1, -1, -1, -1, -1, 126, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 126, -1, -1, 126, -1, -1, 126, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 126, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 126, -1, -1, 126, -1, 126, -1, -1, -1, -1, -1, -1, -1, -1, 126, -1, -1, -1, -1, -1, -1, -1, -1, 126, 126], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 93, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 298, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 93, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 93, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 158, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 377, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, 39, 227, -1, -1, -1, -1, -1, -1, -1, 227, -1, 227, -1, -1, 227, -1, -1, -1, 227, -1, -1, -1, -1, 227, -1, 39, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 227, -1, -1, -1, -1, -1, -1, -1, 227, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 227, -1, -1, -1, -1, -1, -1, -1, -1, -1, 227, -1, -1, -1, -1, -1, -1, 227, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 227, -1, 227, -1, -1, -1, -1, -1, -1, -1, -1, 227, -1, -1, -1, -1, -1, -1, -1, -1, 227, 227], [-1, -1, 49, -1, -1, -1, -1, -1, -1, -1, 49, -1, 49, -1, -1, 49, -1, -1, -1, 49, -1, -1, -1, -1, 49, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 94, -1, 49, -1, -1, 49, -1, -1, 49, -1, 49, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 49, -1, -1, -1, -1, -1, -1, -1, -1, -1, 49, -1, -1, -1, -1, -1, -1, 49, -1, -1, 49, -1, -1, -1, -1, -1, -1, 49, -1, -1, -1, -1, -1, -1, 49, -1, 49, -1, -1, -1, -1, -1, -1, -1, -1, 49, -1, -1, -1, -1, -1, -1, -1, -1, 49, 49], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 41, -1, -1, -1, -1, -1, 43, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 43, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 332, -1, -1, -1, -1, -1, -1, -1, 332, -1, 332, -1, -1, 332, -1, -1, -1, 332, -1, 332, -1, -1, 332, -1, -1, -1, -1, -1, -1, -1, -1, 332, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 332, -1, -1, -1, -1, -1, -1, -1, 332, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 332, -1, -1, 332, -1, -1, 332, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 332, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 332, -1, -1, 332, -1, 332, -1, -1, -1, -1, -1, -1, -1, -1, 332, -1, -1, -1, -1, -1, -1, -1, -1, 332, 332], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 336, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 340, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 202, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 224, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 290, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 355, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 260, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 260, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 334, -1, -1, 13, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 351, 347, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 295, -1, -1, -1, -1, -1, -1, -1, 295, -1, 295, -1, -1, 295, -1, -1, -1, 295, -1, 299, -1, -1, 295, -1, -1, -1, -1, -1, -1, -1, -1, 295, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 295, -1, -1, -1, -1, -1, -1, -1, 295, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 295, -1, -1, 299, -1, -1, 299, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 295, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 295, -1, -1, 295, -1, 295, -1, -1, -1, -1, -1, -1, -1, -1, 295, -1, -1, -1, -1, -1, -1, -1, -1, 295, 295], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 379, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 182, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 379, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 3, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 323, -1, -1, -1, 9, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 194, -1, -1, -1, -1, -1, -1, -1, 194, -1, 194, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 26, -1, -1, 26, -1, 194, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 194, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 194, -1, -1, 26, -1, -1, -1, -1, -1, 194, 194, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 218, -1, -1, -1, -1, -1, -1, 166, 218, -1, 218, -1, -1, 218, 151, -1, -1, 218, -1, -1, -1, -1, 218, -1, 218, -1, -1, 265, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 218, -1, -1, -1, -1, -1, -1, -1, 218, -1, -1, -1, 151, -1, -1, -1, -1, 264, -1, 218, -1, -1, -1, -1, -1, -1, 265, -1, -1, 218, -1, -1, -1, -1, -1, -1, 218, -1, -1, -1, -1, 264, -1, 151, -1, -1, -1, -1, 264, -1, 89, -1, -1, 218, -1, 218, -1, -1, -1, -1, -1, -1, -1, -1, 218, -1, 151, -1, 265, 166, -1, -1, -1, 218, 218], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 172, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, 228, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 179, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 82, -1, -1, -1, -1, -1, -1, -1, -1, -1, 82, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 61, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 61, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 61, -1, -1, -1, -1, -1, -1, -1, -1, 61, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 235, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 235, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 255, -1, -1, -1, -1, -1, -1, -1, 255, -1, 255, -1, -1, 255, -1, -1, -1, 255, -1, -1, -1, -1, 255, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 255, -1, -1, -1, -1, -1, -1, -1, 255, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 255, -1, -1, -1, -1, -1, -1, -1, -1, -1, 255, -1, -1, -1, -1, -1, -1, 255, -1, -1, -1, -1, -1, -1, -1, -1, -1, 209, -1, -1, -1, -1, -1, -1, 255, -1, 255, -1, -1, -1, -1, -1, -1, -1, -1, 255, -1, -1, -1, -1, -1, -1, -1, -1, 255, 255], [-1, -1, 234, -1, 234, -1, -1, -1, -1, 234, 234, -1, 234, -1, -1, 234, 234, -1, -1, 234, -1, -1, 234, 234, 234, -1, 234, -1, -1, 234, -1, -1, -1, -1, 234, -1, -1, 234, 234, -1, -1, 234, -1, -1, 234, -1, -1, 234, 234, 234, 234, -1, 234, 234, 234, -1, 234, 234, -1, -1, 234, 234, 234, 234, -1, -1, -1, 234, 234, -1, 234, -1, 234, 234, -1, -1, -1, -1, 234, 234, 234, -1, -1, 234, -1, 234, -1, 234, -1, -1, 234, 234, 234, -1, 234, -1, 234, 234, 234, 234, 234, -1, -1, -1, -1, -1, -1, -1, 234, -1, 234, -1, 234, 234, 234, 234, -1, 234, 234], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 141, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 387, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, 350, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 186, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 24, -1, -1, 186, 186, -1, -1, 186, -1, -1, -1, -1, -1, 167, 186, 186, 167, -1, -1, 186, 186, -1, -1, 350, -1, -1, 186, -1, 186, -1, -1, -1, -1, -1, -1, -1, -1, -1, 186, -1, -1, -1, -1, -1, 186, 186, -1, -1, -1, 167, -1, -1, -1, -1, -1, -1, 350, 186, -1, -1, -1, -1, 186, -1, 350, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 186, 350, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 109, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 109, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 144, -1, -1, -1, -1, -1, -1, -1, -1, -1, 149, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 99, -1, -1, -1, -1, -1, -1, -1, 99, -1, 99, -1, -1, 99, -1, -1, -1, 99, -1, -1, -1, -1, 99, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 99, -1, 99, -1, -1, 99, -1, -1, 99, -1, 99, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 99, -1, -1, -1, -1, -1, -1, -1, -1, -1, 99, -1, -1, -1, -1, -1, -1, 99, -1, -1, 99, -1, -1, -1, -1, -1, -1, 99, -1, -1, -1, -1, -1, -1, 99, -1, 99, -1, -1, -1, -1, -1, -1, -1, -1, 99, -1, -1, -1, -1, -1, -1, -1, -1, 99, 99], [-1, -1, 27, -1, 27, -1, -1, -1, -1, 27, 27, -1, 27, -1, -1, 27, 27, -1, -1, 27, -1, -1, 27, -1, 27, -1, 27, -1, -1, 27, -1, -1, -1, -1, 27, -1, -1, 27, 27, -1, -1, 27, -1, -1, 27, -1, -1, 27, 27, 27, 27, -1, 27, 27, 27, -1, 27, 27, -1, -1, 27, 27, 27, 27, -1, -1, -1, -1, -1, -1, 27, -1, 27, 27, -1, -1, -1, -1, 27, 27, 27, -1, -1, 27, -1, 27, -1, 27, -1, -1, 27, 27, 27, -1, 27, -1, 27, 27, 27, 27, 31, -1, -1, -1, -1, -1, -1, -1, 27, -1, 27, -1, 27, 27, 27, 27, -1, 27, 27], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 369, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 8, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 383, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 335, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 424, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 237, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 173, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 237, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 215, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 88, -1, -1, -1, -1, -1, -1, -1, 171, -1, 88, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 171, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 171, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 403, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 122, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 122, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 122, -1, -1, -1, -1, -1, -1, -1, -1, 122, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 285, -1, -1, -1, -1, -1, -1, -1, 285, -1, 285, -1, -1, 285, -1, -1, -1, 285, -1, -1, -1, -1, 285, -1, 285, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 285, -1, -1, -1, -1, -1, -1, -1, 285, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 285, -1, -1, -1, -1, -1, -1, -1, -1, -1, 285, -1, -1, -1, -1, -1, -1, 285, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 285, -1, 285, -1, -1, -1, -1, -1, -1, -1, -1, 285, -1, -1, -1, -1, -1, -1, -1, -1, 285, 285], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 321, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, 302, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 302, -1, -1, -1, 302, 302, -1, -1, -1, -1, -1, -1, 302, -1, -1, 302, 302, -1, -1, 302, -1, -1, -1, -1, -1, 302, 302, 302, 302, -1, -1, 302, 302, -1, -1, 302, -1, -1, 302, -1, 302, -1, -1, -1, -1, -1, -1, -1, -1, -1, 302, -1, -1, -1, -1, -1, 302, 302, -1, -1, -1, 302, -1, -1, -1, -1, -1, -1, 302, 302, -1, -1, 302, -1, 302, -1, 302, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 302, 302, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 385, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 389, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 389, -1, -1, -1, -1, -1, -1, -1, -1, 389, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, 423, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 169, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 175, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 256, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 283, -1, -1, -1, -1, -1, -1, 388, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 159, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 313, -1, -1, -1, -1, -1, -1, -1, 404, -1, 313, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 404, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, 272, -1, -1, -1, -1, -1, -1, -1, 272, -1, 272, -1, -1, 272, -1, -1, -1, 272, -1, -1, -1, -1, 272, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 272, -1, 272, -1, -1, 272, -1, -1, 272, -1, 272, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 272, -1, -1, -1, -1, -1, -1, -1, -1, -1, 272, -1, -1, -1, -1, -1, -1, 272, -1, -1, 272, -1, -1, -1, -1, -1, -1, 272, -1, -1, -1, -1, -1, -1, 272, -1, 272, -1, -1, -1, -1, -1, -1, -1, -1, 272, -1, -1, -1, -1, -1, -1, -1, -1, 272, 272], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 118, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 311, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 254, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 156, -1, -1, -1, -1, -1, -1, -1, -1], [-1, 102, -1, -1, 0, -1, 102, -1, 102, 0, 100, 102, 102, 131, 102, 100, 0, -1, 102, 102, 102, 102, 0, -1, 100, -1, 102, 102, 102, -1, 102, 102, 102, -1, 0, 102, 102, 0, 0, 102, 102, 0, -1, 102, 392, 102, 102, 0, 0, 0, 0, 102, -1, 0, -1, 102, 0, 0, 102, 102, 0, 0, 0, 102, -1, 102, 102, -1, 0, 102, 0, -1, 0, -1, 102, 102, 102, 102, 0, 0, 345, 102, -1, 0, 102, 0, -1, 0, 102, -1, 0, 0, 0, -1, 102, -1, 0, 100, 0, 100, 102, 102, -1, 102, -1, -1, 102, 102, -1, 102, 0, 102, 0, 0, 0, 0, -1, 100, 0], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 353, -1, -1, -1, -1, -1, -1, -1, 353, -1, 353, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 104, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 353, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 353, -1, -1, -1, -1, -1, -1, -1, -1, 353, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 349, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, 280, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 280, -1, -1, -1, 280, 280, -1, -1, -1, -1, -1, -1, 280, -1, -1, 280, 280, -1, -1, 280, -1, -1, -1, -1, -1, 280, 280, 280, 280, -1, -1, 280, 280, -1, -1, 280, -1, -1, 280, -1, 280, -1, -1, -1, -1, -1, -1, -1, -1, -1, 280, -1, -1, -1, -1, -1, 280, 280, -1, -1, -1, 280, -1, -1, -1, -1, -1, -1, 280, 280, -1, -1, 280, -1, 280, -1, 280, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 280, 280, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 184, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 111, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, 364, -1, -1, -1, -1, -1, 247, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 386, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, 140, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 140, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 140, -1, -1, 140, 140, -1, -1, 140, -1, -1, -1, -1, -1, 140, 140, 140, 140, -1, -1, 140, 140, -1, -1, 140, -1, -1, 140, -1, 140, -1, -1, -1, -1, -1, -1, -1, -1, -1, 140, -1, -1, -1, -1, -1, 140, 140, -1, -1, -1, 140, -1, -1, -1, -1, -1, -1, 140, 140, -1, -1, -1, -1, 140, -1, 140, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 140, 140, -1, -1, -1], [-1, -1, -1, -1, 303, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 307, -1, -1, -1, -1, 303, -1, -1, 307, 307, 307, -1, -1, -1, -1, -1, -1, 303, -1, -1, 303, 303, -1, -1, 303, -1, -1, -1, -1, -1, 303, 303, 303, 303, -1, 307, 303, 303, -1, -1, 303, -1, -1, 303, -1, 303, 307, -1, -1, -1, -1, -1, -1, -1, 307, 303, -1, -1, -1, -1, -1, 303, 303, 307, -1, -1, 303, -1, -1, -1, -1, -1, 307, 303, 303, -1, 307, -1, -1, 303, -1, 303, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 303, 303, 307, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 361, 361, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 337, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 337, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 337, -1, -1, -1, -1, -1, -1, -1, -1, 337, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 205, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 420, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], [-1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, 20, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1, -1], ] TERMINAL_DIVEQ = 0 TERMINAL_RPAREN = 1 TERMINAL_BITAND = 2 TERMINAL_NOT = 3 TERMINAL_REGISTER = 4 TERMINAL_BITNOT = 5 TERMINAL_POUND = 6 TERMINAL_DEFINED_SEPARATOR = 7 TERMINAL_ARROW = 8 TERMINAL_IF = 9 TERMINAL_INTEGER_CONSTANT = 10 TERMINAL_MOD = 11 TERMINAL_DECR = 12 TERMINAL_PP_NUMBER = 13 TERMINAL_ELIPSIS = 14 TERMINAL_FLOATING_CONSTANT = 15 TERMINAL_CONTINUE = 16 TERMINAL_COMMA_VA_ARGS = 17 TERMINAL_SUB = 18 TERMINAL_INCR = 19 TERMINAL_POUNDPOUND = 20 TERMINAL_ASSIGN = 21 TERMINAL_UNION = 22 TERMINAL_ELSE_IF = 23 TERMINAL_ENUMERATION_CONSTANT = 24 TERMINAL__DIRECT_ABSTRACT_DECLARATOR = 25 TERMINAL_SEMI = 26 TERMINAL_COMMA = 27 TERMINAL_COLON = 28 TERMINAL_LABEL_HINT = 29 TERMINAL_SUBEQ = 30 TERMINAL_BITOREQ = 31 TERMINAL_AMPERSAND = 32 TERMINAL__EXPR_SANS_COMMA = 33 TERMINAL_INLINE = 34 TERMINAL_AND = 35 TERMINAL_TILDE = 36 TERMINAL_ENUM = 37 TERMINAL_STRUCT = 38 TERMINAL_QUESTIONMARK = 39 TERMINAL_BITXOREQ = 40 TERMINAL_LONG = 41 TERMINAL_VARIABLE_LENGTH_ARRAY = 42 TERMINAL_BITOR = 43 TERMINAL_STRING_LITERAL = 44 TERMINAL_EQ = 45 TERMINAL_BITANDEQ = 46 TERMINAL_RESTRICT = 47 TERMINAL_COMPLEX = 48 TERMINAL_INT = 49 TERMINAL_CONST = 50 TERMINAL_LSHIFTEQ = 51 TERMINAL_ASTERISK = 52 TERMINAL_SHORT = 53 TERMINAL_TYPEDEF_IDENTIFIER = 54 TERMINAL_NEQ = 55 TERMINAL_BREAK = 56 TERMINAL_TYPEDEF = 57 TERMINAL_OR = 58 TERMINAL_RSHIFTEQ = 59 TERMINAL_SIGNED = 60 TERMINAL_FOR = 61 TERMINAL_FLOAT = 62 TERMINAL_LPAREN = 63 TERMINAL_ABSTRACT_PARAMETER_HINT = 64 TERMINAL_RSHIFT = 65 TERMINAL_LSQUARE = 66 TERMINAL_ENDIF = 67 TERMINAL_ELSE = 68 TERMINAL_DOT = 69 TERMINAL_DEFAULT = 70 TERMINAL_FUNCTION_DEFINITION_HINT = 71 TERMINAL_DOUBLE = 72 TERMINAL__EXPR = 73 TERMINAL_LTEQ = 74 TERMINAL_BITXOR = 75 TERMINAL_ADDEQ = 76 TERMINAL_RSQUARE = 77 TERMINAL_BOOL = 78 TERMINAL_UNSIGNED = 79 TERMINAL_IDENTIFIER = 80 TERMINAL_GTEQ = 81 TERMINAL_SIZEOF_SEPARATOR = 82 TERMINAL_VOLATILE = 83 TERMINAL_MODEQ = 84 TERMINAL_WHILE = 85 TERMINAL_DEFINED = 86 TERMINAL_GOTO = 87 TERMINAL_LT = 88 TERMINAL__DIRECT_DECLARATOR = 89 TERMINAL_STATIC = 90 TERMINAL_IMAGINARY = 91 TERMINAL_DO = 92 TERMINAL_DECLARATOR_HINT = 93 TERMINAL_LBRACE = 94 TERMINAL_NAMED_PARAMETER_HINT = 95 TERMINAL_VOID = 96 TERMINAL_HEXADECIMAL_FLOATING_CONSTANT = 97 TERMINAL_EXTERN = 98 TERMINAL_DECIMAL_FLOATING_CONSTANT = 99 TERMINAL_RBRACE = 100 TERMINAL_LSHIFT = 101 TERMINAL_EXTERNAL_DECLARATION_HINT = 102 TERMINAL_GT = 103 TERMINAL_TRAILING_COMMA = 104 TERMINAL_UNIVERSAL_CHARACTER_NAME = 105 TERMINAL_MULEQ = 106 TERMINAL_ADD = 107 TERMINAL_LPAREN_CAST = 108 TERMINAL_EXCLAMATION_POINT = 109 TERMINAL_RETURN = 110 TERMINAL_DIV = 111 TERMINAL_CASE = 112 TERMINAL_SWITCH = 113 TERMINAL_CHAR = 114 TERMINAL_AUTO = 115 TERMINAL_FUNCTION_PROTOTYPE_HINT = 116 TERMINAL_CHARACTER_CONSTANT = 117 TERMINAL_SIZEOF = 118 def __init__(self, tokens=None): self.__dict__.update(locals()) self.expressionParsers = dict() def isTerminal(self, id): return 0 <= id <= 118 def isNonTerminal(self, id): return 119 <= id <= 248 def parse(self, tokens): self.tokens = tokens self.start = 'TRANSLATION_UNIT' tree = self.parse_translation_unit() if self.tokens.current() != None: raise SyntaxError( 'Finished parsing without consuming all tokens.' ) return tree def expect(self, terminalId): currentToken = self.tokens.current() if not currentToken: raise SyntaxError( 'No more tokens. Expecting %s' % (self.terminals[terminalId]) ) if currentToken.getId() != terminalId: raise SyntaxError( 'Unexpected symbol when parsing %s. Expected %s, got %s.' %(whosdaddy(), self.terminals[terminalId], currentToken if currentToken else 'None') ) nextToken = self.tokens.advance() if nextToken and not self.isTerminal(nextToken.getId()): raise SyntaxError( 'Invalid symbol ID: %d (%s)' % (nextToken.getId(), nextToken) ) return currentToken def parse_struct_declarator_body(self): current = self.tokens.current() rule = self.table[1][current.getId()] if current else -1 tree = ParseTree( NonTerminal(120, self.nonterminals[120])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 17: tree.astTransform = AstTransformSubstitution(0) t = self.expect(28) # colon tree.add(t) subtree = self.parse_declarator() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_direct_declarator_size(self): current = self.tokens.current() rule = self.table[2][current.getId()] if current else -1 tree = ParseTree( NonTerminal(121, self.nonterminals[121])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 217: tree.astTransform = AstTransformSubstitution(0) t = self.expect(42) # variable_length_array tree.add(t) return tree elif rule == 360: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen7(self): current = self.tokens.current() rule = self.table[3][current.getId()] if current else -1 tree = ParseTree( NonTerminal(122, self.nonterminals[122])) tree.list = 'nlist' if current != None and (current.getId() in [94, 26, 27]): return tree if current == None: return tree if rule == 183: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declaration() tree.add( subtree ) subtree = self.parse__gen7() tree.add( subtree ) return tree return tree def parse__gen44(self): current = self.tokens.current() rule = self.table[4][current.getId()] if current else -1 tree = ParseTree( NonTerminal(123, self.nonterminals[123])) tree.list = 'slist' if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 105: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr_sans_comma() tree.add( subtree ) subtree = self.parse__gen45() tree.add( subtree ) return tree return tree def parse__gen21(self): current = self.tokens.current() rule = self.table[5][current.getId()] if current else -1 tree = ParseTree( NonTerminal(124, self.nonterminals[124])) tree.list = False if current != None and (current.getId() in [27, 26]): return tree if current == None: return tree if rule == 211: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_declarator_body() tree.add( subtree ) return tree return tree def parse__gen45(self): current = self.tokens.current() rule = self.table[6][current.getId()] if current else -1 tree = ParseTree( NonTerminal(125, self.nonterminals[125])) tree.list = 'slist' if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 18: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse__expr_sans_comma() tree.add( subtree ) subtree = self.parse__gen45() tree.add( subtree ) return tree return tree def parse_struct_or_union_sub(self): current = self.tokens.current() rule = self.table[7][current.getId()] if current else -1 tree = ParseTree( NonTerminal(126, self.nonterminals[126])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 6: tree.astTransform = AstTransformNodeCreator('StructOrUnion', {'body': 0}) subtree = self.parse_struct_or_union_body() tree.add( subtree ) return tree elif rule == 7: tree.astTransform = AstTransformNodeCreator('StructOrUnion', {'body': 1, 'name': 0}) t = self.expect(80) # identifier tree.add(t) subtree = self.parse__gen16() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_type_name(self): current = self.tokens.current() rule = self.table[8][current.getId()] if current else -1 tree = ParseTree( NonTerminal(127, self.nonterminals[127])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 291: tree.astTransform = AstTransformSubstitution(0) t = self.expect(49) # int tree.add(t) return tree elif rule == 359: tree.astTransform = AstTransformSubstitution(0) t = self.expect(114) # char tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_for_init(self): current = self.tokens.current() rule = self.table[9][current.getId()] if current else -1 tree = ParseTree( NonTerminal(128, self.nonterminals[128])) tree.list = False if current != None and (current.getId() in [26]): return tree if current == None: return tree if rule == 132: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr() tree.add( subtree ) return tree elif rule == 187: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declaration() tree.add( subtree ) subtree = self.parse_expression_opt() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr() tree.add( subtree ) return tree def parse_direct_declarator_modifier(self): current = self.tokens.current() rule = self.table[10][current.getId()] if current else -1 tree = ParseTree( NonTerminal(129, self.nonterminals[129])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 81: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_qualifier() tree.add( subtree ) return tree elif rule == 230: tree.astTransform = AstTransformSubstitution(0) t = self.expect(90) # static tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_keyword(self): current = self.tokens.current() rule = self.table[11][current.getId()] if current else -1 tree = ParseTree( NonTerminal(130, self.nonterminals[130])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 2: tree.astTransform = AstTransformSubstitution(0) t = self.expect(110) # return tree.add(t) return tree elif rule == 5: tree.astTransform = AstTransformSubstitution(0) t = self.expect(48) # complex tree.add(t) return tree elif rule == 21: tree.astTransform = AstTransformSubstitution(0) t = self.expect(91) # imaginary tree.add(t) return tree elif rule == 29: tree.astTransform = AstTransformSubstitution(0) t = self.expect(16) # continue tree.add(t) return tree elif rule == 30: tree.astTransform = AstTransformSubstitution(0) t = self.expect(49) # int tree.add(t) return tree elif rule == 34: tree.astTransform = AstTransformSubstitution(0) t = self.expect(118) # sizeof tree.add(t) return tree elif rule == 35: tree.astTransform = AstTransformSubstitution(0) t = self.expect(72) # double tree.add(t) return tree elif rule == 37: tree.astTransform = AstTransformSubstitution(0) t = self.expect(57) # typedef tree.add(t) return tree elif rule == 106: tree.astTransform = AstTransformSubstitution(0) t = self.expect(70) # default tree.add(t) return tree elif rule == 115: tree.astTransform = AstTransformSubstitution(0) t = self.expect(92) # do tree.add(t) return tree elif rule == 116: tree.astTransform = AstTransformSubstitution(0) t = self.expect(87) # goto tree.add(t) return tree elif rule == 121: tree.astTransform = AstTransformSubstitution(0) t = self.expect(9) # if tree.add(t) return tree elif rule == 123: tree.astTransform = AstTransformSubstitution(0) t = self.expect(68) # else tree.add(t) return tree elif rule == 136: tree.astTransform = AstTransformSubstitution(0) t = self.expect(114) # char tree.add(t) return tree elif rule == 138: tree.astTransform = AstTransformSubstitution(0) t = self.expect(41) # long tree.add(t) return tree elif rule == 178: tree.astTransform = AstTransformSubstitution(0) t = self.expect(60) # signed tree.add(t) return tree elif rule == 185: tree.astTransform = AstTransformSubstitution(0) t = self.expect(53) # short tree.add(t) return tree elif rule == 219: tree.astTransform = AstTransformSubstitution(0) t = self.expect(113) # switch tree.add(t) return tree elif rule == 249: tree.astTransform = AstTransformSubstitution(0) t = self.expect(22) # union tree.add(t) return tree elif rule == 259: tree.astTransform = AstTransformSubstitution(0) t = self.expect(90) # static tree.add(t) return tree elif rule == 310: tree.astTransform = AstTransformSubstitution(0) t = self.expect(85) # while tree.add(t) return tree elif rule == 314: tree.astTransform = AstTransformSubstitution(0) t = self.expect(115) # auto tree.add(t) return tree elif rule == 325: tree.astTransform = AstTransformSubstitution(0) t = self.expect(56) # break tree.add(t) return tree elif rule == 327: tree.astTransform = AstTransformSubstitution(0) t = self.expect(79) # unsigned tree.add(t) return tree elif rule == 330: tree.astTransform = AstTransformSubstitution(0) t = self.expect(4) # register tree.add(t) return tree elif rule == 338: tree.astTransform = AstTransformSubstitution(0) t = self.expect(62) # float tree.add(t) return tree elif rule == 344: tree.astTransform = AstTransformSubstitution(0) t = self.expect(47) # restrict tree.add(t) return tree elif rule == 348: tree.astTransform = AstTransformSubstitution(0) t = self.expect(61) # for tree.add(t) return tree elif rule == 357: tree.astTransform = AstTransformSubstitution(0) t = self.expect(96) # void tree.add(t) return tree elif rule == 372: tree.astTransform = AstTransformSubstitution(0) t = self.expect(83) # volatile tree.add(t) return tree elif rule == 394: tree.astTransform = AstTransformSubstitution(0) t = self.expect(98) # extern tree.add(t) return tree elif rule == 395: tree.astTransform = AstTransformSubstitution(0) t = self.expect(50) # const tree.add(t) return tree elif rule == 397: tree.astTransform = AstTransformSubstitution(0) t = self.expect(38) # struct tree.add(t) return tree elif rule == 405: tree.astTransform = AstTransformSubstitution(0) t = self.expect(34) # inline tree.add(t) return tree elif rule == 410: tree.astTransform = AstTransformSubstitution(0) t = self.expect(37) # enum tree.add(t) return tree elif rule == 413: tree.astTransform = AstTransformSubstitution(0) t = self.expect(112) # case tree.add(t) return tree elif rule == 416: tree.astTransform = AstTransformSubstitution(0) t = self.expect(78) # bool tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_block_item(self): current = self.tokens.current() rule = self.table[12][current.getId()] if current else -1 tree = ParseTree( NonTerminal(131, self.nonterminals[131])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 46: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declaration() tree.add( subtree ) return tree elif rule == 55: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_statement() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_statement() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_external_declaration(self): current = self.tokens.current() rule = self.table[13][current.getId()] if current else -1 tree = ParseTree( NonTerminal(132, self.nonterminals[132])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 71: tree.astTransform = AstTransformNodeCreator('ExternalDeclaration', {'declarations': 2, 'declaration_specifiers': 1}) t = self.expect(102) # external_declaration_hint tree.add(t) subtree = self.parse__gen1() tree.add( subtree ) subtree = self.parse_external_declaration_sub() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_init_declarator_list(self): current = self.tokens.current() rule = self.table[14][current.getId()] if current else -1 tree = ParseTree( NonTerminal(133, self.nonterminals[133])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 56: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen9() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen9() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen8(self): current = self.tokens.current() rule = self.table[15][current.getId()] if current else -1 tree = ParseTree( NonTerminal(134, self.nonterminals[134])) tree.list = False if current != None and (current.getId() in [26]): return tree if current == None: return tree if rule == 373: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_init_declarator_list() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_init_declarator_list() tree.add( subtree ) return tree def parse_struct_or_union_body(self): current = self.tokens.current() rule = self.table[16][current.getId()] if current else -1 tree = ParseTree( NonTerminal(135, self.nonterminals[135])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 296: tree.astTransform = AstTransformSubstitution(1) t = self.expect(94) # lbrace tree.add(t) subtree = self.parse__gen17() tree.add( subtree ) t = self.expect(100) # rbrace tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_sizeof_body(self): current = self.tokens.current() rule = self.table[17][current.getId()] if current else -1 tree = ParseTree( NonTerminal(136, self.nonterminals[136])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 52: tree.astTransform = AstTransformSubstitution(0) t = self.expect(80) # identifier tree.add(t) return tree elif rule == 381: tree.astTransform = AstTransformSubstitution(1) t = self.expect(63) # lparen tree.add(t) subtree = self.parse_type_name() tree.add( subtree ) t = self.expect(1) # rparen tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen16(self): current = self.tokens.current() rule = self.table[18][current.getId()] if current else -1 tree = ParseTree( NonTerminal(137, self.nonterminals[137])) tree.list = False if current != None and (current.getId() in [57, 41, 34, 17, 63, 54, 53, 79, 38, 50, 78, 96, 26, 83, 4, 48, 22, 27, 28, 89, 72, 90, 91, 60, 93, 37, 47, 98, 52, 25, 71, 62, 115, 49, 114, 116, 80]): return tree if current == None: return tree if rule == 231: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_or_union_body() tree.add( subtree ) return tree return tree def parse__gen28(self): current = self.tokens.current() rule = self.table[19][current.getId()] if current else -1 tree = ParseTree( NonTerminal(138, self.nonterminals[138])) tree.list = 'nlist' if current != None and (current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 42, 15, 97, 19, 118, 117, 24, 108, 44]): return tree if current == None: return tree if rule == 243: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_direct_declarator_modifier() tree.add( subtree ) subtree = self.parse__gen28() tree.add( subtree ) return tree return tree def parse_constant(self): current = self.tokens.current() rule = self.table[20][current.getId()] if current else -1 tree = ParseTree( NonTerminal(139, self.nonterminals[139])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 48: tree.astTransform = AstTransformSubstitution(0) t = self.expect(117) # character_constant tree.add(t) return tree elif rule == 57: tree.astTransform = AstTransformSubstitution(0) t = self.expect(97) # hexadecimal_floating_constant tree.add(t) return tree elif rule == 68: tree.astTransform = AstTransformSubstitution(0) t = self.expect(24) # enumeration_constant tree.add(t) return tree elif rule == 207: tree.astTransform = AstTransformSubstitution(0) t = self.expect(99) # decimal_floating_constant tree.add(t) return tree elif rule == 294: tree.astTransform = AstTransformSubstitution(0) t = self.expect(10) # integer_constant tree.add(t) return tree elif rule == 358: tree.astTransform = AstTransformSubstitution(0) t = self.expect(15) # floating_constant tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen0(self): current = self.tokens.current() rule = self.table[21][current.getId()] if current else -1 tree = ParseTree( NonTerminal(140, self.nonterminals[140])) tree.list = 'nlist' if current != None and (current.getId() in [-1]): return tree if current == None: return tree if rule == 396: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_external_declaration() tree.add( subtree ) subtree = self.parse__gen0() tree.add( subtree ) return tree return tree def parse_enum_specifier_sub(self): current = self.tokens.current() rule = self.table[22][current.getId()] if current else -1 tree = ParseTree( NonTerminal(141, self.nonterminals[141])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 85: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_enum_specifier_body() tree.add( subtree ) return tree elif rule == 306: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_identifier() tree.add( subtree ) subtree = self.parse__gen22() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_storage_class_specifier(self): current = self.tokens.current() rule = self.table[23][current.getId()] if current else -1 tree = ParseTree( NonTerminal(142, self.nonterminals[142])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 58: tree.astTransform = AstTransformSubstitution(0) t = self.expect(115) # auto tree.add(t) return tree elif rule == 84: tree.astTransform = AstTransformSubstitution(0) t = self.expect(90) # static tree.add(t) return tree elif rule == 276: tree.astTransform = AstTransformSubstitution(0) t = self.expect(4) # register tree.add(t) return tree elif rule == 326: tree.astTransform = AstTransformSubstitution(0) t = self.expect(57) # typedef tree.add(t) return tree elif rule == 356: tree.astTransform = AstTransformSubstitution(0) t = self.expect(98) # extern tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_typedef_name(self): current = self.tokens.current() rule = self.table[24][current.getId()] if current else -1 tree = ParseTree( NonTerminal(143, self.nonterminals[143])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 220: tree.astTransform = AstTransformSubstitution(0) t = self.expect(54) # typedef_identifier tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen18(self): current = self.tokens.current() rule = self.table[25][current.getId()] if current else -1 tree = ParseTree( NonTerminal(144, self.nonterminals[144])) tree.list = 'nlist' if current != None and (current.getId() in [80, 28, 89, 63, 52]): return tree if current == None: return tree if rule == 262: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_specifier_qualifier() tree.add( subtree ) subtree = self.parse__gen18() tree.add( subtree ) return tree return tree def parse_identifier(self): current = self.tokens.current() rule = self.table[26][current.getId()] if current else -1 tree = ParseTree( NonTerminal(145, self.nonterminals[145])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 44: tree.astTransform = AstTransformSubstitution(0) t = self.expect(80) # identifier tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_enum_specifier_body(self): current = self.tokens.current() rule = self.table[27][current.getId()] if current else -1 tree = ParseTree( NonTerminal(146, self.nonterminals[146])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 12: tree.astTransform = AstTransformSubstitution(0) t = self.expect(94) # lbrace tree.add(t) subtree = self.parse__gen23() tree.add( subtree ) subtree = self.parse_trailing_comma_opt() tree.add( subtree ) t = self.expect(100) # rbrace tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen11(self): current = self.tokens.current() rule = self.table[28][current.getId()] if current else -1 tree = ParseTree( NonTerminal(147, self.nonterminals[147])) tree.list = False if current != None and (current.getId() in [27, 26]): return tree if current == None: return tree if rule == 134: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declarator_initializer() tree.add( subtree ) return tree return tree def parse_type_specifier(self): current = self.tokens.current() rule = self.table[29][current.getId()] if current else -1 tree = ParseTree( NonTerminal(148, self.nonterminals[148])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 16: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_typedef_name() tree.add( subtree ) return tree elif rule == 75: tree.astTransform = AstTransformSubstitution(0) t = self.expect(41) # long tree.add(t) return tree elif rule == 96: tree.astTransform = AstTransformSubstitution(0) t = self.expect(53) # short tree.add(t) return tree elif rule == 150: tree.astTransform = AstTransformSubstitution(0) t = self.expect(48) # complex tree.add(t) return tree elif rule == 153: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_specifier() tree.add( subtree ) return tree elif rule == 198: tree.astTransform = AstTransformSubstitution(0) t = self.expect(72) # double tree.add(t) return tree elif rule == 206: tree.astTransform = AstTransformSubstitution(0) t = self.expect(79) # unsigned tree.add(t) return tree elif rule == 297: tree.astTransform = AstTransformSubstitution(0) t = self.expect(91) # imaginary tree.add(t) return tree elif rule == 301: tree.astTransform = AstTransformSubstitution(0) t = self.expect(60) # signed tree.add(t) return tree elif rule == 305: tree.astTransform = AstTransformSubstitution(0) t = self.expect(78) # bool tree.add(t) return tree elif rule == 308: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_union_specifier() tree.add( subtree ) return tree elif rule == 316: tree.astTransform = AstTransformSubstitution(0) t = self.expect(49) # int tree.add(t) return tree elif rule == 341: tree.astTransform = AstTransformSubstitution(0) t = self.expect(114) # char tree.add(t) return tree elif rule == 346: tree.astTransform = AstTransformSubstitution(0) t = self.expect(62) # float tree.add(t) return tree elif rule == 352: tree.astTransform = AstTransformSubstitution(0) t = self.expect(96) # void tree.add(t) return tree elif rule == 375: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_enum_specifier() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_struct_declaration(self): current = self.tokens.current() rule = self.table[30][current.getId()] if current else -1 tree = ParseTree( NonTerminal(149, self.nonterminals[149])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 36: tree.astTransform = AstTransformNodeCreator('StructOrUnionDeclaration', {'specifier_qualifiers': 0, 'declarators': 1}) subtree = self.parse__gen18() tree.add( subtree ) subtree = self.parse__gen19() tree.add( subtree ) t = self.expect(26) # semi tree.add(t) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformNodeCreator('StructOrUnionDeclaration', {'specifier_qualifiers': 0, 'declarators': 1}) subtree = self.parse__gen18() tree.add( subtree ) subtree = self.parse__gen19() tree.add( subtree ) tree.add( self.expect(26) ) # semi raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_block_item_list(self): current = self.tokens.current() rule = self.table[31][current.getId()] if current else -1 tree = ParseTree( NonTerminal(150, self.nonterminals[150])) tree.list = False if current == None: return tree if rule == 281: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen40() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen40() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen17(self): current = self.tokens.current() rule = self.table[32][current.getId()] if current else -1 tree = ParseTree( NonTerminal(151, self.nonterminals[151])) tree.list = 'nlist' if current != None and (current.getId() in [100]): return tree if current == None: return tree if rule == 258: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_declaration() tree.add( subtree ) subtree = self.parse__gen17() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_declaration() tree.add( subtree ) subtree = self.parse__gen17() tree.add( subtree ) return tree def parse_declaration(self): current = self.tokens.current() rule = self.table[33][current.getId()] if current else -1 tree = ParseTree( NonTerminal(152, self.nonterminals[152])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 412: tree.astTransform = AstTransformNodeCreator('Declaration', {'init_declarators': 1, 'declaration_specifiers': 0}) subtree = self.parse__gen1() tree.add( subtree ) subtree = self.parse__gen8() tree.add( subtree ) t = self.expect(26) # semi tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_type_qualifier(self): current = self.tokens.current() rule = self.table[34][current.getId()] if current else -1 tree = ParseTree( NonTerminal(153, self.nonterminals[153])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 70: tree.astTransform = AstTransformSubstitution(0) t = self.expect(83) # volatile tree.add(t) return tree elif rule == 240: tree.astTransform = AstTransformSubstitution(0) t = self.expect(47) # restrict tree.add(t) return tree elif rule == 286: tree.astTransform = AstTransformSubstitution(0) t = self.expect(50) # const tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_misc(self): current = self.tokens.current() rule = self.table[35][current.getId()] if current else -1 tree = ParseTree( NonTerminal(154, self.nonterminals[154])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 225: tree.astTransform = AstTransformSubstitution(0) t = self.expect(105) # universal_character_name tree.add(t) return tree elif rule == 315: tree.astTransform = AstTransformSubstitution(0) t = self.expect(67) # endif tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_struct_specifier(self): current = self.tokens.current() rule = self.table[36][current.getId()] if current else -1 tree = ParseTree( NonTerminal(155, self.nonterminals[155])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 421: tree.astTransform = AstTransformNodeCreator('Struct', {'definition': 1}) t = self.expect(38) # struct tree.add(t) subtree = self.parse_struct_or_union_sub() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_function_specifier(self): current = self.tokens.current() rule = self.table[37][current.getId()] if current else -1 tree = ParseTree( NonTerminal(156, self.nonterminals[156])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 275: tree.astTransform = AstTransformSubstitution(0) t = self.expect(34) # inline tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen39(self): current = self.tokens.current() rule = self.table[38][current.getId()] if current else -1 tree = ParseTree( NonTerminal(157, self.nonterminals[157])) tree.list = False if current != None and (current.getId() in [100]): return tree if current == None: return tree if rule == 10: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_block_item_list() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_block_item_list() tree.add( subtree ) return tree def parse_else_if_statement_list(self): current = self.tokens.current() rule = self.table[39][current.getId()] if current else -1 tree = ParseTree( NonTerminal(158, self.nonterminals[158])) tree.list = False if current == None: return tree if rule == 147: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen43() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_type_qualifier_list_opt(self): current = self.tokens.current() rule = self.table[40][current.getId()] if current else -1 tree = ParseTree( NonTerminal(159, self.nonterminals[159])) tree.list = False if current != None and (current.getId() in [27, 52, 90, 17, 89, 63, 25, 80]): return tree if current == None: return tree if rule == 19: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen25() tree.add( subtree ) return tree return tree def parse_specifier_qualifier(self): current = self.tokens.current() rule = self.table[41][current.getId()] if current else -1 tree = ParseTree( NonTerminal(160, self.nonterminals[160])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 273: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_specifier() tree.add( subtree ) return tree elif rule == 426: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_qualifier() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen9(self): current = self.tokens.current() rule = self.table[42][current.getId()] if current else -1 tree = ParseTree( NonTerminal(161, self.nonterminals[161])) tree.list = 'slist' if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 67: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_init_declarator() tree.add( subtree ) subtree = self.parse__gen10() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_init_declarator() tree.add( subtree ) subtree = self.parse__gen10() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen24(self): current = self.tokens.current() rule = self.table[43][current.getId()] if current else -1 tree = ParseTree( NonTerminal(162, self.nonterminals[162])) tree.list = 'slist' if current != None and (current.getId() in [104]): return tree if current == None: return tree if rule == 267: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse_enumerator() tree.add( subtree ) subtree = self.parse__gen24() tree.add( subtree ) return tree return tree def parse_translation_unit(self): current = self.tokens.current() rule = self.table[44][current.getId()] if current else -1 tree = ParseTree( NonTerminal(163, self.nonterminals[163])) tree.list = False if current == None: return tree if rule == 367: tree.astTransform = AstTransformNodeCreator('TranslationUnit', {'external_declarations': 0}) subtree = self.parse__gen0() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_else_statement(self): current = self.tokens.current() rule = self.table[45][current.getId()] if current else -1 tree = ParseTree( NonTerminal(164, self.nonterminals[164])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 419: tree.astTransform = AstTransformNodeCreator('Else', {'statement': 1}) t = self.expect(68) # else tree.add(t) subtree = self.parse_statement() tree.add( subtree ) t = self.expect(67) # endif tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen42(self): current = self.tokens.current() rule = self.table[46][current.getId()] if current else -1 tree = ParseTree( NonTerminal(165, self.nonterminals[165])) tree.list = False if current != None and (current.getId() in [70, 2, 4, 54, 99, 10, 24, 12, 38, 87, 94, 108, 19, 26, 85, 15, 22, 52, 56, 83, 92, 34, 37, 47, 61, 41, 44, 62, 48, 49, 50, 53, 80, 57, 9, 60, 97, 63, 67, 79, 73, 78, 96, 118, 117, 115, 90, 91, 16, 98, 100, 29, 72, 110, 112, 113, 114]): return tree if current == None: return tree if rule == 51: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_else_statement() tree.add( subtree ) return tree return tree def parse__gen22(self): current = self.tokens.current() rule = self.table[47][current.getId()] if current else -1 tree = ParseTree( NonTerminal(166, self.nonterminals[166])) tree.list = False if current != None and (current.getId() in [57, 41, 34, 17, 63, 54, 53, 79, 38, 50, 78, 96, 26, 83, 4, 48, 22, 27, 28, 89, 72, 90, 91, 60, 93, 37, 47, 98, 52, 25, 71, 62, 115, 49, 114, 116, 80]): return tree if current == None: return tree if rule == 242: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_enum_specifier_body() tree.add( subtree ) return tree return tree def parse_struct_declarator(self): current = self.tokens.current() rule = self.table[48][current.getId()] if current else -1 tree = ParseTree( NonTerminal(167, self.nonterminals[167])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 79: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_declarator_body() tree.add( subtree ) return tree elif rule == 223: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declarator() tree.add( subtree ) subtree = self.parse__gen21() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declarator() tree.add( subtree ) subtree = self.parse__gen21() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen19(self): current = self.tokens.current() rule = self.table[49][current.getId()] if current else -1 tree = ParseTree( NonTerminal(168, self.nonterminals[168])) tree.list = 'slist' if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 277: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_declarator() tree.add( subtree ) subtree = self.parse__gen20() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_struct_declarator() tree.add( subtree ) subtree = self.parse__gen20() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen20(self): current = self.tokens.current() rule = self.table[50][current.getId()] if current else -1 tree = ParseTree( NonTerminal(169, self.nonterminals[169])) tree.list = 'slist' if current != None and (current.getId() in [26]): return tree if current == None: return tree if rule == 107: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse_struct_declarator() tree.add( subtree ) subtree = self.parse__gen20() tree.add( subtree ) return tree return tree def parse__gen10(self): current = self.tokens.current() rule = self.table[51][current.getId()] if current else -1 tree = ParseTree( NonTerminal(170, self.nonterminals[170])) tree.list = 'slist' if current != None and (current.getId() in [26]): return tree if current == None: return tree if rule == 72: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse_init_declarator() tree.add( subtree ) subtree = self.parse__gen10() tree.add( subtree ) return tree return tree def parse_enumeration_constant(self): current = self.tokens.current() rule = self.table[52][current.getId()] if current else -1 tree = ParseTree( NonTerminal(171, self.nonterminals[171])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 90: tree.astTransform = AstTransformSubstitution(0) t = self.expect(80) # identifier tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen15(self): current = self.tokens.current() rule = self.table[53][current.getId()] if current else -1 tree = ParseTree( NonTerminal(172, self.nonterminals[172])) tree.list = 'nlist' if current != None and (current.getId() in [21]): return tree if current == None: return tree if rule == 278: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_designator() tree.add( subtree ) subtree = self.parse__gen15() tree.add( subtree ) return tree return tree def parse_punctuator(self): current = self.tokens.current() rule = self.table[54][current.getId()] if current else -1 tree = ParseTree( NonTerminal(173, self.nonterminals[173])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 1: tree.astTransform = AstTransformSubstitution(0) t = self.expect(103) # gt tree.add(t) return tree elif rule == 22: tree.astTransform = AstTransformSubstitution(0) t = self.expect(55) # neq tree.add(t) return tree elif rule == 25: tree.astTransform = AstTransformSubstitution(0) t = self.expect(59) # rshifteq tree.add(t) return tree elif rule == 28: tree.astTransform = AstTransformSubstitution(0) t = self.expect(19) # incr tree.add(t) return tree elif rule == 32: tree.astTransform = AstTransformSubstitution(0) t = self.expect(75) # bitxor tree.add(t) return tree elif rule == 40: tree.astTransform = AstTransformSubstitution(0) t = self.expect(8) # arrow tree.add(t) return tree elif rule == 47: tree.astTransform = AstTransformSubstitution(0) t = self.expect(106) # muleq tree.add(t) return tree elif rule == 53: tree.astTransform = AstTransformSubstitution(0) t = self.expect(46) # bitandeq tree.add(t) return tree elif rule == 64: tree.astTransform = AstTransformSubstitution(0) t = self.expect(69) # dot tree.add(t) return tree elif rule == 65: tree.astTransform = AstTransformSubstitution(0) t = self.expect(43) # bitor tree.add(t) return tree elif rule == 77: tree.astTransform = AstTransformSubstitution(0) t = self.expect(45) # eq tree.add(t) return tree elif rule == 114: tree.astTransform = AstTransformSubstitution(0) t = self.expect(100) # rbrace tree.add(t) return tree elif rule == 128: tree.astTransform = AstTransformSubstitution(0) t = self.expect(1) # rparen tree.add(t) return tree elif rule == 130: tree.astTransform = AstTransformSubstitution(0) t = self.expect(51) # lshifteq tree.add(t) return tree elif rule == 145: tree.astTransform = AstTransformSubstitution(0) t = self.expect(65) # rshift tree.add(t) return tree elif rule == 152: tree.astTransform = AstTransformSubstitution(0) t = self.expect(26) # semi tree.add(t) return tree elif rule == 157: tree.astTransform = AstTransformSubstitution(0) t = self.expect(111) # div tree.add(t) return tree elif rule == 162: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) return tree elif rule == 177: tree.astTransform = AstTransformSubstitution(0) t = self.expect(32) # ampersand tree.add(t) return tree elif rule == 189: tree.astTransform = AstTransformSubstitution(0) t = self.expect(14) # elipsis tree.add(t) return tree elif rule == 192: tree.astTransform = AstTransformSubstitution(0) t = self.expect(101) # lshift tree.add(t) return tree elif rule == 199: tree.astTransform = AstTransformSubstitution(0) t = self.expect(58) # or tree.add(t) return tree elif rule == 201: tree.astTransform = AstTransformSubstitution(0) t = self.expect(81) # gteq tree.add(t) return tree elif rule == 208: tree.astTransform = AstTransformSubstitution(0) t = self.expect(74) # lteq tree.add(t) return tree elif rule == 214: tree.astTransform = AstTransformSubstitution(0) t = self.expect(107) # add tree.add(t) return tree elif rule == 241: tree.astTransform = AstTransformSubstitution(0) t = self.expect(6) # pound tree.add(t) return tree elif rule == 244: tree.astTransform = AstTransformSubstitution(0) t = self.expect(84) # modeq tree.add(t) return tree elif rule == 250: tree.astTransform = AstTransformSubstitution(0) t = self.expect(35) # and tree.add(t) return tree elif rule == 251: tree.astTransform = AstTransformSubstitution(0) t = self.expect(109) # exclamation_point tree.add(t) return tree elif rule == 261: tree.astTransform = AstTransformSubstitution(0) t = self.expect(12) # decr tree.add(t) return tree elif rule == 269: tree.astTransform = AstTransformSubstitution(0) t = self.expect(11) # mod tree.add(t) return tree elif rule == 270: tree.astTransform = AstTransformSubstitution(0) t = self.expect(36) # tilde tree.add(t) return tree elif rule == 287: tree.astTransform = AstTransformSubstitution(0) t = self.expect(40) # bitxoreq tree.add(t) return tree elif rule == 288: tree.astTransform = AstTransformSubstitution(0) t = self.expect(31) # bitoreq tree.add(t) return tree elif rule == 292: tree.astTransform = AstTransformSubstitution(0) t = self.expect(66) # lsquare tree.add(t) return tree elif rule == 300: tree.astTransform = AstTransformSubstitution(0) t = self.expect(76) # addeq tree.add(t) return tree elif rule == 312: tree.astTransform = AstTransformSubstitution(0) t = self.expect(28) # colon tree.add(t) return tree elif rule == 329: tree.astTransform = AstTransformSubstitution(0) t = self.expect(88) # lt tree.add(t) return tree elif rule == 354: tree.astTransform = AstTransformSubstitution(0) t = self.expect(30) # subeq tree.add(t) return tree elif rule == 362: tree.astTransform = AstTransformSubstitution(0) t = self.expect(77) # rsquare tree.add(t) return tree elif rule == 366: tree.astTransform = AstTransformSubstitution(0) t = self.expect(39) # questionmark tree.add(t) return tree elif rule == 370: tree.astTransform = AstTransformSubstitution(0) t = self.expect(20) # poundpound tree.add(t) return tree elif rule == 374: tree.astTransform = AstTransformSubstitution(0) t = self.expect(21) # assign tree.add(t) return tree elif rule == 391: tree.astTransform = AstTransformSubstitution(0) t = self.expect(18) # sub tree.add(t) return tree elif rule == 411: tree.astTransform = AstTransformSubstitution(0) t = self.expect(94) # lbrace tree.add(t) return tree elif rule == 415: tree.astTransform = AstTransformSubstitution(0) t = self.expect(63) # lparen tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen43(self): current = self.tokens.current() rule = self.table[55][current.getId()] if current else -1 tree = ParseTree( NonTerminal(174, self.nonterminals[174])) tree.list = 'nlist' if current != None and (current.getId() in [70, 2, 4, 54, 99, 68, 24, 12, 38, 87, 94, 108, 19, 26, 85, 15, 22, 52, 56, 83, 92, 34, 37, 47, 61, 41, 44, 62, 48, 49, 50, 53, 80, 57, 9, 60, 97, 63, 67, 10, 79, 73, 78, 96, 118, 117, 115, 90, 91, 16, 98, 100, 29, 72, 110, 112, 113, 114]): return tree if current == None: return tree if rule == 142: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_else_if_statement() tree.add( subtree ) subtree = self.parse__gen43() tree.add( subtree ) return tree return tree def parse__gen27(self): current = self.tokens.current() rule = self.table[56][current.getId()] if current else -1 tree = ParseTree( NonTerminal(175, self.nonterminals[175])) tree.list = False if current != None and (current.getId() in [73, 2, 63, 52, 80, 10, 99, 44, 12, 42, 15, 97, 19, 118, 117, 24, 108]): return tree if current == None: return tree if rule == 408: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_direct_declarator_modifier_list() tree.add( subtree ) return tree return tree def parse_external_declarator(self): current = self.tokens.current() rule = self.table[57][current.getId()] if current else -1 tree = ParseTree( NonTerminal(176, self.nonterminals[176])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 382: tree.astTransform = AstTransformNodeCreator('ExternalDeclarator', {'init_declarator': 1}) t = self.expect(93) # declarator_hint tree.add(t) subtree = self.parse__gen6() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_else_if_statement(self): current = self.tokens.current() rule = self.table[58][current.getId()] if current else -1 tree = ParseTree( NonTerminal(177, self.nonterminals[177])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 165: tree.astTransform = AstTransformNodeCreator('ElseIf', {'statement': 4, 'condition': 2}) t = self.expect(23) # else_if tree.add(t) t = self.expect(63) # lparen tree.add(t) subtree = self.parse__expr() tree.add( subtree ) t = self.expect(1) # rparen tree.add(t) subtree = self.parse_statement() tree.add( subtree ) t = self.expect(67) # endif tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_init_declarator(self): current = self.tokens.current() rule = self.table[59][current.getId()] if current else -1 tree = ParseTree( NonTerminal(178, self.nonterminals[178])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 137: tree.astTransform = AstTransformNodeCreator('InitDeclarator', {'initializer': 1, 'declarator': 0}) subtree = self.parse_declarator() tree.add( subtree ) subtree = self.parse__gen11() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformNodeCreator('InitDeclarator', {'initializer': 1, 'declarator': 0}) subtree = self.parse_declarator() tree.add( subtree ) subtree = self.parse__gen11() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_parameter_type_list(self): current = self.tokens.current() rule = self.table[60][current.getId()] if current else -1 tree = ParseTree( NonTerminal(179, self.nonterminals[179])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 236: tree.astTransform = AstTransformNodeCreator('ParameterTypeList', {'parameter_declarations': 0, 'va_args': 1}) subtree = self.parse__gen29() tree.add( subtree ) subtree = self.parse__gen31() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_initializer(self): current = self.tokens.current() rule = self.table[61][current.getId()] if current else -1 tree = ParseTree( NonTerminal(180, self.nonterminals[180])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 309: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr_sans_comma() tree.add( subtree ) return tree elif rule == 317: tree.astTransform = AstTransformSubstitution(1) t = self.expect(94) # lbrace tree.add(t) subtree = self.parse__gen12() tree.add( subtree ) subtree = self.parse_trailing_comma_opt() tree.add( subtree ) t = self.expect(100) # rbrace tree.add(t) return tree elif current.getId() in [33, 63, 80, 10, 99, 44, 12, 52, 15, 97, 19, 118, 2, 24, 108, 117]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr_sans_comma() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_designation(self): current = self.tokens.current() rule = self.table[62][current.getId()] if current else -1 tree = ParseTree( NonTerminal(181, self.nonterminals[181])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 365: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen15() tree.add( subtree ) t = self.expect(21) # assign tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_initializer_list_item(self): current = self.tokens.current() rule = self.table[63][current.getId()] if current else -1 tree = ParseTree( NonTerminal(182, self.nonterminals[182])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 126: tree.astTransform = AstTransformNodeCreator('Initialization', {'designation': 0, 'initializer': 1}) subtree = self.parse__gen14() tree.add( subtree ) subtree = self.parse_initializer() tree.add( subtree ) return tree elif current.getId() in [33, 63, 80, 10, 99, 44, 12, 52, 15, 97, 19, 118, 2, 24, 108, 117]: tree.astTransform = AstTransformNodeCreator('Initialization', {'designation': 0, 'initializer': 1}) subtree = self.parse__gen14() tree.add( subtree ) subtree = self.parse_initializer() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_external_declaration_sub(self): current = self.tokens.current() rule = self.table[64][current.getId()] if current else -1 tree = ParseTree( NonTerminal(183, self.nonterminals[183])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 93: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen3() tree.add( subtree ) t = self.expect(26) # semi tree.add(t) return tree elif rule == 298: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_external_function() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_declarator_initializer(self): current = self.tokens.current() rule = self.table[65][current.getId()] if current else -1 tree = ParseTree( NonTerminal(184, self.nonterminals[184])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 158: tree.astTransform = AstTransformSubstitution(1) t = self.expect(21) # assign tree.add(t) subtree = self.parse_initializer() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_external_function(self): current = self.tokens.current() rule = self.table[67][current.getId()] if current else -1 tree = ParseTree( NonTerminal(186, self.nonterminals[186])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 377: tree.astTransform = AstTransformNodeCreator('FunctionDefinition', {'body': 3, 'declaration_list': 2, 'signature': 1}) t = self.expect(71) # function_definition_hint tree.add(t) subtree = self.parse_declarator() tree.add( subtree ) subtree = self.parse__gen5() tree.add( subtree ) subtree = self.parse_compound_statement() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_expression_opt(self): current = self.tokens.current() rule = self.table[68][current.getId()] if current else -1 tree = ParseTree( NonTerminal(187, self.nonterminals[187])) tree.list = False if current != None and (current.getId() in [1, 26]): return tree if current == None: return tree if rule == 227: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__expr() tree.add( subtree ) return tree def parse_direct_abstract_declarator_expr(self): current = self.tokens.current() rule = self.table[69][current.getId()] if current else -1 tree = ParseTree( NonTerminal(188, self.nonterminals[188])) tree.list = False if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 49: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_qualifier_list_opt() tree.add( subtree ) subtree = self.parse_static_opt() tree.add( subtree ) subtree = self.parse__expr() tree.add( subtree ) return tree elif rule == 94: tree.astTransform = AstTransformSubstitution(0) t = self.expect(42) # variable_length_array tree.add(t) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_qualifier_list_opt() tree.add( subtree ) subtree = self.parse_static_opt() tree.add( subtree ) subtree = self.parse__expr() tree.add( subtree ) return tree def parse_enumerator_assignment(self): current = self.tokens.current() rule = self.table[70][current.getId()] if current else -1 tree = ParseTree( NonTerminal(189, self.nonterminals[189])) tree.list = False if current != None and (current.getId() in [27, 104]): return tree if current == None: return tree if rule == 41: tree.astTransform = AstTransformSubstitution(0) t = self.expect(21) # assign tree.add(t) subtree = self.parse__expr() tree.add( subtree ) return tree return tree def parse__gen12(self): current = self.tokens.current() rule = self.table[71][current.getId()] if current else -1 tree = ParseTree( NonTerminal(190, self.nonterminals[190])) tree.list = 'slist' if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 332: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_initializer_list_item() tree.add( subtree ) subtree = self.parse__gen13() tree.add( subtree ) return tree elif current.getId() in [33, 63, 80, 10, 99, 44, 12, 52, 15, 97, 19, 118, 2, 24, 108, 117]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_initializer_list_item() tree.add( subtree ) subtree = self.parse__gen13() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen13(self): current = self.tokens.current() rule = self.table[72][current.getId()] if current else -1 tree = ParseTree( NonTerminal(191, self.nonterminals[191])) tree.list = 'slist' if current != None and (current.getId() in [104]): return tree if current == None: return tree if rule == 336: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse_initializer_list_item() tree.add( subtree ) subtree = self.parse__gen13() tree.add( subtree ) return tree return tree def parse_external_declaration_sub_sub(self): current = self.tokens.current() rule = self.table[73][current.getId()] if current else -1 tree = ParseTree( NonTerminal(192, self.nonterminals[192])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 202: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_external_declarator() tree.add( subtree ) return tree elif rule == 224: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_external_prototype() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_named_parameter_declaration(self): current = self.tokens.current() rule = self.table[74][current.getId()] if current else -1 tree = ParseTree( NonTerminal(193, self.nonterminals[193])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 290: tree.astTransform = AstTransformNodeCreator('NamedParameter', {'declaration_specifiers': 1, 'declarator': 2}) t = self.expect(95) # named_parameter_hint tree.add(t) subtree = self.parse__gen1() tree.add( subtree ) subtree = self.parse__gen34() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen3(self): current = self.tokens.current() rule = self.table[75][current.getId()] if current else -1 tree = ParseTree( NonTerminal(194, self.nonterminals[194])) tree.list = 'slist' if current != None and (current.getId() in [26]): return tree if current == None: return tree if rule == 260: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_external_declaration_sub_sub() tree.add( subtree ) subtree = self.parse__gen4() tree.add( subtree ) return tree return tree def parse_designator(self): current = self.tokens.current() rule = self.table[76][current.getId()] if current else -1 tree = ParseTree( NonTerminal(195, self.nonterminals[195])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 13: tree.astTransform = AstTransformNodeCreator('MemberAccess', {'name': 1}) t = self.expect(69) # dot tree.add(t) t = self.expect(80) # identifier tree.add(t) return tree elif rule == 334: tree.astTransform = AstTransformNodeCreator('ArrayAccess', {'index': 1}) t = self.expect(66) # lsquare tree.add(t) subtree = self.parse__expr() tree.add( subtree ) t = self.expect(77) # rsquare tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen4(self): current = self.tokens.current() rule = self.table[77][current.getId()] if current else -1 tree = ParseTree( NonTerminal(196, self.nonterminals[196])) tree.list = 'slist' if current != None and (current.getId() in [26]): return tree if current == None: return tree if rule == 347: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse_external_declaration_sub_sub() tree.add( subtree ) subtree = self.parse__gen4() tree.add( subtree ) return tree return tree def parse__gen14(self): current = self.tokens.current() rule = self.table[78][current.getId()] if current else -1 tree = ParseTree( NonTerminal(197, self.nonterminals[197])) tree.list = False if current != None and (current.getId() in [15, 33, 63, 80, 10, 99, 44, 12, 52, 94, 97, 19, 118, 2, 24, 108, 117]): return tree if current == None: return tree if rule == 299: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_designation() tree.add( subtree ) return tree return tree def parse_direct_declarator_parameter_list(self): current = self.tokens.current() rule = self.table[79][current.getId()] if current else -1 tree = ParseTree( NonTerminal(198, self.nonterminals[198])) tree.list = False if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 182: tree.astTransform = AstTransformNodeCreator('ParameterList', {'identifiers': 0}) subtree = self.parse__gen32() tree.add( subtree ) return tree elif rule == 379: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_parameter_type_list() tree.add( subtree ) return tree return tree def parse_abstract_parameter_declaration(self): current = self.tokens.current() rule = self.table[80][current.getId()] if current else -1 tree = ParseTree( NonTerminal(199, self.nonterminals[199])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 3: tree.astTransform = AstTransformNodeCreator('AbstractParameter', {'declaration_specifiers': 1, 'declarator': 2}) t = self.expect(64) # abstract_parameter_hint tree.add(t) subtree = self.parse__gen1() tree.add( subtree ) subtree = self.parse__gen35() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_trailing_comma_opt(self): current = self.tokens.current() rule = self.table[81][current.getId()] if current else -1 tree = ParseTree( NonTerminal(200, self.nonterminals[200])) tree.list = False if current != None and (current.getId() in [100]): return tree if current == None: return tree if rule == 9: tree.astTransform = AstTransformSubstitution(0) t = self.expect(104) # trailing_comma tree.add(t) return tree return tree def parse__gen25(self): current = self.tokens.current() rule = self.table[82][current.getId()] if current else -1 tree = ParseTree( NonTerminal(201, self.nonterminals[201])) tree.list = 'nlist' if current != None and (current.getId() in [27, 52, 90, 17, 89, 63, 25, 80]): return tree if current == None: return tree if rule == 26: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_qualifier() tree.add( subtree ) subtree = self.parse__gen25() tree.add( subtree ) return tree return tree def parse_statement(self): current = self.tokens.current() rule = self.table[83][current.getId()] if current else -1 tree = ParseTree( NonTerminal(202, self.nonterminals[202])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 89: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_compound_statement() tree.add( subtree ) return tree elif rule == 151: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_jump_statement() tree.add( subtree ) return tree elif rule == 166: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_selection_statement() tree.add( subtree ) return tree elif rule == 218: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_expression_statement() tree.add( subtree ) return tree elif rule == 264: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_iteration_statement() tree.add( subtree ) return tree elif rule == 265: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_labeled_statement() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_expression_statement() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_for_cond(self): current = self.tokens.current() rule = self.table[84][current.getId()] if current else -1 tree = ParseTree( NonTerminal(203, self.nonterminals[203])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 172: tree.astTransform = AstTransformSubstitution(1) t = self.expect(26) # semi tree.add(t) subtree = self.parse_expression_opt() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_for_incr(self): current = self.tokens.current() rule = self.table[85][current.getId()] if current else -1 tree = ParseTree( NonTerminal(204, self.nonterminals[204])) tree.list = False if current != None and (current.getId() in [1]): return tree if current == None: return tree if rule == 179: tree.astTransform = AstTransformSubstitution(1) t = self.expect(26) # semi tree.add(t) subtree = self.parse_expression_opt() tree.add( subtree ) return tree return tree def parse__gen34(self): current = self.tokens.current() rule = self.table[86][current.getId()] if current else -1 tree = ParseTree( NonTerminal(205, self.nonterminals[205])) tree.list = False if current != None and (current.getId() in [27, 17]): return tree if current == None: return tree if rule == 61: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declarator() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declarator() tree.add( subtree ) return tree def parse__gen46(self): current = self.tokens.current() rule = self.table[87][current.getId()] if current else -1 tree = ParseTree( NonTerminal(206, self.nonterminals[206])) tree.list = False if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 235: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_parameter_type_list() tree.add( subtree ) return tree return tree def parse_static_opt(self): current = self.tokens.current() rule = self.table[88][current.getId()] if current else -1 tree = ParseTree( NonTerminal(207, self.nonterminals[207])) tree.list = False if current != None and (current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]): return tree if current == None: return tree if rule == 209: tree.astTransform = AstTransformSubstitution(0) t = self.expect(90) # static tree.add(t) return tree return tree def parse__gen41(self): current = self.tokens.current() rule = self.table[89][current.getId()] if current else -1 tree = ParseTree( NonTerminal(208, self.nonterminals[208])) tree.list = False if current != None and (current.getId() in [70, 2, 4, 54, 99, 68, 24, 12, 38, 94, 108, 19, 26, 85, 15, 22, 52, 56, 83, 92, 34, 37, 47, 61, 41, 44, 62, 87, 49, 53, 80, 57, 9, 60, 97, 63, 67, 10, 115, 79, 73, 78, 96, 118, 117, 48, 90, 91, 16, 98, 100, 29, 113, 72, 110, 112, 50, 114]): return tree if current == None: return tree if rule == 234: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_else_if_statement_list() tree.add( subtree ) return tree return tree def parse_parameter_declaration(self): current = self.tokens.current() rule = self.table[90][current.getId()] if current else -1 tree = ParseTree( NonTerminal(209, self.nonterminals[209])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 141: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_abstract_parameter_declaration() tree.add( subtree ) return tree elif rule == 387: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_named_parameter_declaration() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_declaration_specifier(self): current = self.tokens.current() rule = self.table[91][current.getId()] if current else -1 tree = ParseTree( NonTerminal(210, self.nonterminals[210])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 24: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_function_specifier() tree.add( subtree ) return tree elif rule == 167: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_qualifier() tree.add( subtree ) return tree elif rule == 186: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_type_specifier() tree.add( subtree ) return tree elif rule == 350: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_storage_class_specifier() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen29(self): current = self.tokens.current() rule = self.table[92][current.getId()] if current else -1 tree = ParseTree( NonTerminal(211, self.nonterminals[211])) tree.list = 'slist' if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 109: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_parameter_declaration() tree.add( subtree ) subtree = self.parse__gen30() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen30(self): current = self.tokens.current() rule = self.table[93][current.getId()] if current else -1 tree = ParseTree( NonTerminal(212, self.nonterminals[212])) tree.list = 'slist' if current != None and (current.getId() in [17]): return tree if current == None: return tree if rule == 149: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse_parameter_declaration() tree.add( subtree ) subtree = self.parse__gen30() tree.add( subtree ) return tree return tree def parse_direct_declarator_expr(self): current = self.tokens.current() rule = self.table[94][current.getId()] if current else -1 tree = ParseTree( NonTerminal(213, self.nonterminals[213])) tree.list = False if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 99: tree.astTransform = AstTransformNodeCreator('DirectDeclaratorExpression', {'modifiers': 0, 'value': 1}) subtree = self.parse__gen27() tree.add( subtree ) subtree = self.parse_direct_declarator_size() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformNodeCreator('DirectDeclaratorExpression', {'modifiers': 0, 'value': 1}) subtree = self.parse__gen27() tree.add( subtree ) subtree = self.parse_direct_declarator_size() tree.add( subtree ) return tree def parse__gen40(self): current = self.tokens.current() rule = self.table[95][current.getId()] if current else -1 tree = ParseTree( NonTerminal(214, self.nonterminals[214])) tree.list = 'nlist' if current != None and (current.getId() in [100]): return tree if current == None: return tree if rule == 27: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_block_item() tree.add( subtree ) subtree = self.parse__gen40() tree.add( subtree ) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_block_item() tree.add( subtree ) subtree = self.parse__gen40() tree.add( subtree ) return tree def parse_labeled_statement(self): current = self.tokens.current() rule = self.table[96][current.getId()] if current else -1 tree = ParseTree( NonTerminal(215, self.nonterminals[215])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 8: tree.astTransform = AstTransformNodeCreator('DefaultCase', {'statement': 2}) t = self.expect(70) # default tree.add(t) t = self.expect(28) # colon tree.add(t) subtree = self.parse_statement() tree.add( subtree ) return tree elif rule == 369: tree.astTransform = AstTransformNodeCreator('Label', {'name': 0, 'statement': 1}) t = self.expect(29) # label_hint tree.add(t) t = self.expect(80) # identifier tree.add(t) t = self.expect(28) # colon tree.add(t) subtree = self.parse_statement() tree.add( subtree ) return tree elif rule == 383: tree.astTransform = AstTransformNodeCreator('Case', {'expr': 1, 'statement': 3}) t = self.expect(112) # case tree.add(t) subtree = self.parse__expr() tree.add( subtree ) t = self.expect(28) # colon tree.add(t) subtree = self.parse_statement() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_external_prototype(self): current = self.tokens.current() rule = self.table[97][current.getId()] if current else -1 tree = ParseTree( NonTerminal(216, self.nonterminals[216])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 335: tree.astTransform = AstTransformNodeCreator('FunctionPrototype', {'declaration_list': 2, 'declarator': 1}) t = self.expect(116) # function_prototype_hint tree.add(t) subtree = self.parse_declarator() tree.add( subtree ) subtree = self.parse__gen5() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_union_specifier(self): current = self.tokens.current() rule = self.table[98][current.getId()] if current else -1 tree = ParseTree( NonTerminal(217, self.nonterminals[217])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 424: tree.astTransform = AstTransformNodeCreator('Union', {'definition': 1}) t = self.expect(22) # union tree.add(t) subtree = self.parse_struct_or_union_sub() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_abstract_declarator(self): current = self.tokens.current() rule = self.table[99][current.getId()] if current else -1 tree = ParseTree( NonTerminal(218, self.nonterminals[218])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 173: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_pointer() tree.add( subtree ) subtree = self.parse__gen36() tree.add( subtree ) return tree elif rule == 237: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__direct_abstract_declarator() tree.add( subtree ) return tree elif current.getId() in [25, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__direct_abstract_declarator() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_pointer(self): current = self.tokens.current() rule = self.table[100][current.getId()] if current else -1 tree = ParseTree( NonTerminal(219, self.nonterminals[219])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 215: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen37() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen35(self): current = self.tokens.current() rule = self.table[101][current.getId()] if current else -1 tree = ParseTree( NonTerminal(220, self.nonterminals[220])) tree.list = False if current != None and (current.getId() in [27, 17]): return tree if current == None: return tree if rule == 171: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_abstract_declarator() tree.add( subtree ) return tree elif current.getId() in [25, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_abstract_declarator() tree.add( subtree ) return tree def parse_va_args(self): current = self.tokens.current() rule = self.table[102][current.getId()] if current else -1 tree = ParseTree( NonTerminal(221, self.nonterminals[221])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 403: tree.astTransform = AstTransformSubstitution(1) t = self.expect(17) # comma_va_args tree.add(t) t = self.expect(14) # elipsis tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_declarator(self): current = self.tokens.current() rule = self.table[103][current.getId()] if current else -1 tree = ParseTree( NonTerminal(222, self.nonterminals[222])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 122: tree.astTransform = AstTransformNodeCreator('Declarator', {'direct_declarator': 1, 'pointer': 0}) subtree = self.parse__gen26() tree.add( subtree ) subtree = self.parse__direct_declarator() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformNodeCreator('Declarator', {'direct_declarator': 1, 'pointer': 0}) subtree = self.parse__gen26() tree.add( subtree ) subtree = self.parse__direct_declarator() tree.add( subtree ) raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_expression_statement(self): current = self.tokens.current() rule = self.table[104][current.getId()] if current else -1 tree = ParseTree( NonTerminal(223, self.nonterminals[223])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 285: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_expression_opt() tree.add( subtree ) t = self.expect(26) # semi tree.add(t) return tree elif current.getId() in [73, 2, 63, 80, 10, 99, 52, 12, 44, 15, 97, 19, 118, 117, 24, 108]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_expression_opt() tree.add( subtree ) tree.add( self.expect(26) ) # semi raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_pointer_sub(self): current = self.tokens.current() rule = self.table[105][current.getId()] if current else -1 tree = ParseTree( NonTerminal(224, self.nonterminals[224])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 321: tree.astTransform = AstTransformSubstitution(0) t = self.expect(52) # asterisk tree.add(t) subtree = self.parse_type_qualifier_list_opt() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen5(self): current = self.tokens.current() rule = self.table[106][current.getId()] if current else -1 tree = ParseTree( NonTerminal(225, self.nonterminals[225])) tree.list = False if current != None and (current.getId() in [94, 26, 27]): return tree if current == None: return tree if rule == 302: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declaration_list() tree.add( subtree ) return tree return tree def parse__gen26(self): current = self.tokens.current() rule = self.table[107][current.getId()] if current else -1 tree = ParseTree( NonTerminal(226, self.nonterminals[226])) tree.list = False if current != None and (current.getId() in [63, 89, 80]): return tree if current == None: return tree if rule == 385: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_pointer() tree.add( subtree ) return tree return tree def parse_selection_statement(self): current = self.tokens.current() rule = self.table[108][current.getId()] if current else -1 tree = ParseTree( NonTerminal(227, self.nonterminals[227])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 169: tree.astTransform = AstTransformNodeCreator('Switch', {'expr': 2, 'statment': 4}) t = self.expect(113) # switch tree.add(t) t = self.expect(63) # lparen tree.add(t) subtree = self.parse__expr() tree.add( subtree ) t = self.expect(1) # rparen tree.add(t) subtree = self.parse_statement() tree.add( subtree ) return tree elif rule == 423: tree.astTransform = AstTransformNodeCreator('If', {'elseif': 6, 'statement': 4, 'condition': 2, 'else': 7}) t = self.expect(9) # if tree.add(t) t = self.expect(63) # lparen tree.add(t) subtree = self.parse__expr() tree.add( subtree ) t = self.expect(1) # rparen tree.add(t) subtree = self.parse_statement() tree.add( subtree ) t = self.expect(67) # endif tree.add(t) subtree = self.parse__gen41() tree.add( subtree ) subtree = self.parse__gen42() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_compound_statement(self): current = self.tokens.current() rule = self.table[110][current.getId()] if current else -1 tree = ParseTree( NonTerminal(229, self.nonterminals[229])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 175: tree.astTransform = AstTransformSubstitution(1) t = self.expect(94) # lbrace tree.add(t) subtree = self.parse__gen39() tree.add( subtree ) t = self.expect(100) # rbrace tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_iteration_statement(self): current = self.tokens.current() rule = self.table[111][current.getId()] if current else -1 tree = ParseTree( NonTerminal(230, self.nonterminals[230])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 256: tree.astTransform = AstTransformNodeCreator('For', {'init': 2, 'cond': 3, 'incr': 4, 'statement': 6}) t = self.expect(61) # for tree.add(t) t = self.expect(63) # lparen tree.add(t) subtree = self.parse_for_init() tree.add( subtree ) subtree = self.parse_for_cond() tree.add( subtree ) subtree = self.parse_for_incr() tree.add( subtree ) t = self.expect(1) # rparen tree.add(t) subtree = self.parse_statement() tree.add( subtree ) return tree elif rule == 283: tree.astTransform = AstTransformNodeCreator('While', {'expr': 2, 'statement': 4}) t = self.expect(85) # while tree.add(t) t = self.expect(63) # lparen tree.add(t) subtree = self.parse__expr() tree.add( subtree ) t = self.expect(1) # rparen tree.add(t) subtree = self.parse_statement() tree.add( subtree ) return tree elif rule == 388: tree.astTransform = AstTransformNodeCreator('DoWhile', {'expr': 4, 'statement': 1}) t = self.expect(92) # do tree.add(t) subtree = self.parse_statement() tree.add( subtree ) t = self.expect(85) # while tree.add(t) t = self.expect(63) # lparen tree.add(t) subtree = self.parse__expr() tree.add( subtree ) t = self.expect(1) # rparen tree.add(t) t = self.expect(26) # semi tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen31(self): current = self.tokens.current() rule = self.table[112][current.getId()] if current else -1 tree = ParseTree( NonTerminal(231, self.nonterminals[231])) tree.list = False if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 159: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_va_args() tree.add( subtree ) return tree return tree def parse__gen36(self): current = self.tokens.current() rule = self.table[113][current.getId()] if current else -1 tree = ParseTree( NonTerminal(232, self.nonterminals[232])) tree.list = False if current != None and (current.getId() in [27, 17]): return tree if current == None: return tree if rule == 404: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__direct_abstract_declarator() tree.add( subtree ) return tree elif current.getId() in [25, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__direct_abstract_declarator() tree.add( subtree ) return tree def parse_direct_declarator_modifier_list(self): current = self.tokens.current() rule = self.table[114][current.getId()] if current else -1 tree = ParseTree( NonTerminal(233, self.nonterminals[233])) tree.list = False if current != None and (current.getId() in [73, 2, 63, 80, 99, 10, 52, 12, 42, 15, 97, 19, 118, 117, 24, 108, 44]): return tree if current == None: return tree if rule == 272: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen28() tree.add( subtree ) return tree return tree def parse_jump_statement(self): current = self.tokens.current() rule = self.table[115][current.getId()] if current else -1 tree = ParseTree( NonTerminal(234, self.nonterminals[234])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 118: tree.astTransform = AstTransformSubstitution(0) t = self.expect(16) # continue tree.add(t) return tree elif rule == 156: tree.astTransform = AstTransformNodeCreator('Return', {'expr': 1}) t = self.expect(110) # return tree.add(t) subtree = self.parse_expression_opt() tree.add( subtree ) t = self.expect(26) # semi tree.add(t) return tree elif rule == 254: tree.astTransform = AstTransformNodeCreator('Goto', {'name': 1}) t = self.expect(87) # goto tree.add(t) t = self.expect(80) # identifier tree.add(t) t = self.expect(26) # semi tree.add(t) return tree elif rule == 311: tree.astTransform = AstTransformSubstitution(0) t = self.expect(56) # break tree.add(t) t = self.expect(26) # semi tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_token(self): current = self.tokens.current() rule = self.table[116][current.getId()] if current else -1 tree = ParseTree( NonTerminal(235, self.nonterminals[235])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 0: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_keyword() tree.add( subtree ) return tree elif rule == 100: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_constant() tree.add( subtree ) return tree elif rule == 102: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_punctuator() tree.add( subtree ) return tree elif rule == 131: tree.astTransform = AstTransformSubstitution(0) t = self.expect(13) # pp_number tree.add(t) return tree elif rule == 345: tree.astTransform = AstTransformSubstitution(0) t = self.expect(80) # identifier tree.add(t) return tree elif rule == 392: tree.astTransform = AstTransformSubstitution(0) t = self.expect(44) # string_literal tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen38(self): current = self.tokens.current() rule = self.table[117][current.getId()] if current else -1 tree = ParseTree( NonTerminal(236, self.nonterminals[236])) tree.list = 'mlist' if current != None and (current.getId() in [27, 17, 89, 63, 25, 80]): return tree if current == None: return tree if rule == 104: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_pointer_sub() tree.add( subtree ) subtree = self.parse__gen38() tree.add( subtree ) return tree return tree def parse__gen32(self): current = self.tokens.current() rule = self.table[118][current.getId()] if current else -1 tree = ParseTree( NonTerminal(237, self.nonterminals[237])) tree.list = 'slist' if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 349: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_identifier() tree.add( subtree ) subtree = self.parse__gen33() tree.add( subtree ) return tree return tree def parse_declaration_list(self): current = self.tokens.current() rule = self.table[119][current.getId()] if current else -1 tree = ParseTree( NonTerminal(238, self.nonterminals[238])) tree.list = False if current == None: return tree if rule == 280: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse__gen7() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen33(self): current = self.tokens.current() rule = self.table[120][current.getId()] if current else -1 tree = ParseTree( NonTerminal(239, self.nonterminals[239])) tree.list = 'slist' if current != None and (current.getId() in []): return tree if current == None: return tree if rule == 184: tree.astTransform = AstTransformSubstitution(0) t = self.expect(27) # comma tree.add(t) tree.listSeparator = t subtree = self.parse_identifier() tree.add( subtree ) subtree = self.parse__gen33() tree.add( subtree ) return tree return tree def parse_enumerator(self): current = self.tokens.current() rule = self.table[121][current.getId()] if current else -1 tree = ParseTree( NonTerminal(240, self.nonterminals[240])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 111: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_enumeration_constant() tree.add( subtree ) subtree = self.parse_enumerator_assignment() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_pp(self): current = self.tokens.current() rule = self.table[122][current.getId()] if current else -1 tree = ParseTree( NonTerminal(241, self.nonterminals[241])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 247: tree.astTransform = AstTransformSubstitution(0) t = self.expect(13) # pp_number tree.add(t) return tree elif rule == 364: tree.astTransform = AstTransformSubstitution(0) t = self.expect(7) # defined_separator tree.add(t) return tree elif rule == 386: tree.astTransform = AstTransformSubstitution(0) t = self.expect(86) # defined tree.add(t) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen1(self): current = self.tokens.current() rule = self.table[123][current.getId()] if current else -1 tree = ParseTree( NonTerminal(242, self.nonterminals[242])) tree.list = 'mlist' if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 140: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declaration_specifier() tree.add( subtree ) subtree = self.parse__gen2() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen2(self): current = self.tokens.current() rule = self.table[124][current.getId()] if current else -1 tree = ParseTree( NonTerminal(243, self.nonterminals[243])) tree.list = 'mlist' if current != None and (current.getId() in [27, 52, 89, 25, 116, 63, 17, 93, 26, 71, 80]): return tree if current == None: return tree if rule == 303: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_declaration_specifier() tree.add( subtree ) subtree = self.parse__gen2() tree.add( subtree ) return tree return tree def parse__gen6(self): current = self.tokens.current() rule = self.table[125][current.getId()] if current else -1 tree = ParseTree( NonTerminal(244, self.nonterminals[244])) tree.list = False if current != None and (current.getId() in [27, 26]): return tree if current == None: return tree if rule == 337: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_init_declarator() tree.add( subtree ) return tree elif current.getId() in [80, 89, 63]: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_init_declarator() tree.add( subtree ) return tree def parse__gen37(self): current = self.tokens.current() rule = self.table[126][current.getId()] if current else -1 tree = ParseTree( NonTerminal(245, self.nonterminals[245])) tree.list = 'mlist' if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 205: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_pointer_sub() tree.add( subtree ) subtree = self.parse__gen38() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__gen23(self): current = self.tokens.current() rule = self.table[127][current.getId()] if current else -1 tree = ParseTree( NonTerminal(246, self.nonterminals[246])) tree.list = 'slist' if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 420: tree.astTransform = AstTransformSubstitution(0) subtree = self.parse_enumerator() tree.add( subtree ) subtree = self.parse__gen24() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse_enum_specifier(self): current = self.tokens.current() rule = self.table[129][current.getId()] if current else -1 tree = ParseTree( NonTerminal(248, self.nonterminals[248])) tree.list = False if current == None: raise SyntaxError('Error: unexpected end of file') if rule == 20: tree.astTransform = AstTransformSubstitution(0) t = self.expect(37) # enum tree.add(t) subtree = self.parse_enum_specifier_sub() tree.add( subtree ) return tree raise SyntaxError('Error: Unexpected symbol (%s) when parsing %s' % (current, whoami())) def parse__expr( self, rbp = 0): name = '_expr' if name not in self.expressionParsers: self.expressionParsers[name] = c_ExpressionParser__expr(self) return self.expressionParsers[name].parse(rbp) def parse__expr_sans_comma( self, rbp = 0): name = '_expr_sans_comma' if name not in self.expressionParsers: self.expressionParsers[name] = c_ExpressionParser__expr_sans_comma(self) return self.expressionParsers[name].parse(rbp) def parse__direct_declarator( self, rbp = 0): name = '_direct_declarator' if name not in self.expressionParsers: self.expressionParsers[name] = c_ExpressionParser__direct_declarator(self) return self.expressionParsers[name].parse(rbp) def parse__direct_abstract_declarator( self, rbp = 0): name = '_direct_abstract_declarator' if name not in self.expressionParsers: self.expressionParsers[name] = c_ExpressionParser__direct_abstract_declarator(self) return self.expressionParsers[name].parse(rbp)

47.643737

540

0.533752

34,905

224,402

3.380891

0.022518

0.21649

0.303381

0.384239

0.85286

0.846632

0.840971

0.779171

0.730709

0.640081

0

0.151402

0.244178

224,402

4,709

541

47.653854

0.544379

0.011381

0

0.638547

0

0.063154

0.007881

0

1

0.036124

false

0

0.000425

0.00255

0.182108

0

null

1

0

null

0

9

2f1e4fa9ebbdfc6ee40d4a1ac111bd1b8e723543

3,095

py

Python

dataloader.py

chengyupku/ml-zoomer

8c90163f074ec2821f16dba6d3556d5ed8b0ade8

[ "MIT" ]

null

dataloader.py

chengyupku/ml-zoomer

8c90163f074ec2821f16dba6d3556d5ed8b0ade8

[ "MIT" ]

null

dataloader.py

chengyupku/ml-zoomer

8c90163f074ec2821f16dba6d3556d5ed8b0ade8

[ "MIT" ]

null

import numpy as np import random import torch from torch.utils.data import Dataset class GRDataset(Dataset): def __init__(self, data, m_query_list, m_user_list, q_movie_list, u_movie_list, movie_genre_list): self.data = data self.m_query_list = m_query_list self.m_user_list = m_user_list self.q_movie_list = q_movie_list self.u_movie_list = u_movie_list self.movie_genre_list = movie_genre_list def __getitem__(self, index): # print(self.data[1][0]) uid = self.data[index][0] # print(uid) mid = self.data[index][1] # print(mid) qid = self.data[index][2] label = self.data[index][3] m_query = self.m_query_list[mid] m_user = self.m_user_list[mid] q_movie = self.q_movie_list[qid] u_movie = self.u_movie_list[uid] mg = self.movie_genre_list[mid] # u_mgenre = [] # for um in u_movie: # u_mgenre.append(self.movie_genre_list[um[0]]) # q_mgenre = [] # for qm in q_movie: # q_mgenre.append(self.movie_genre_list[qm[0]]) # u_items = self.u_items_list[uid] # u_users = self.u_users_list[uid] # u_users_items = self.u_users_items_list[uid] # i_users = self.i_users_list[iid] return (uid, mid, qid, label), m_query, m_user, q_movie, u_movie, mg # return (uid, mid, qid, label), m_query, m_user, q_movie, u_movie, mg, u_mgenre, q_mgenre # return (uid, iid, label), u_items, u_users, u_users_items, i_users def __len__(self): return len(self.data) class GRDataset(Dataset): def __init__(self, data, m_query_list, m_user_list, q_movie_list, u_movie_list, movie_genre_list): self.data = data self.m_query_list = m_query_list self.m_user_list = m_user_list self.q_movie_list = q_movie_list self.u_movie_list = u_movie_list self.movie_genre_list = movie_genre_list def __getitem__(self, index): # print(self.data[1][0]) uid = self.data[index][0] # print(uid) mid = self.data[index][1] # print(mid) qid = self.data[index][2] label = self.data[index][3] m_query = self.m_query_list[mid] m_user = self.m_user_list[mid] q_movie = self.q_movie_list[qid] u_movie = self.u_movie_list[uid] mg = self.movie_genre_list[mid] u_mgenre = [] for um in u_movie: u_mgenre.append(self.movie_genre_list[um[0]]) q_mgenre = [] for qm in q_movie: q_mgenre.append(self.movie_genre_list[qm[0]]) # u_items = self.u_items_list[uid] # u_users = self.u_users_list[uid] # u_users_items = self.u_users_items_list[uid] # i_users = self.i_users_list[iid] return (uid, mid, qid, label), m_query, m_user, q_movie, u_movie, mg, u_mgenre, q_mgenre # return (uid, iid, label), u_items, u_users, u_users_items, i_users def __len__(self): return len(self.data)

35.574713

102

0.615186

482

3,095

3.564315

0.09751

0.074505

0.097788

0.083818

0.959837

0

0.007152

0.277221

3,095

87

103

35.574713

0.76084

0.247496

0

0.769231

0

1

0.115385

false

0

0.076923

0.038462

0.307692

0

null

0

1

0

1

0

null

0

7

85db15892a8b141a9483bc5bc9237ea962b0967b

510,036

py

Python

sdk/network/azure-mgmt-network/azure/mgmt/network/v2015_06_15/operations/_operations.py

vincenttran-msft/azure-sdk-for-python

348b56f9f03eeb3f7b502eed51daf494ffff874d

[ "MIT" ]

1

2022-02-01T18:50:12.000Z

sdk/network/azure-mgmt-network/azure/mgmt/network/v2015_06_15/operations/_operations.py

vincenttran-msft/azure-sdk-for-python

348b56f9f03eeb3f7b502eed51daf494ffff874d

[ "MIT" ]

null

sdk/network/azure-mgmt-network/azure/mgmt/network/v2015_06_15/operations/_operations.py

vincenttran-msft/azure-sdk-for-python

348b56f9f03eeb3f7b502eed51daf494ffff874d

[ "MIT" ]

null

# pylint: disable=too-many-lines # coding=utf-8 # -------------------------------------------------------------------------- # Copyright (c) Microsoft Corporation. All rights reserved. # Licensed under the MIT License. See License.txt in the project root for license information. # Code generated by Microsoft (R) AutoRest Code Generator. # Changes may cause incorrect behavior and will be lost if the code is regenerated. # -------------------------------------------------------------------------- from typing import Any, Callable, Dict, Iterable, Optional, TypeVar, Union from msrest import Serializer from azure.core.exceptions import ClientAuthenticationError, HttpResponseError, ResourceExistsError, ResourceNotFoundError, map_error from azure.core.paging import ItemPaged from azure.core.pipeline import PipelineResponse from azure.core.pipeline.transport import HttpResponse from azure.core.polling import LROPoller, NoPolling, PollingMethod from azure.core.rest import HttpRequest from azure.core.tracing.decorator import distributed_trace from azure.mgmt.core.exceptions import ARMErrorFormat from azure.mgmt.core.polling.arm_polling import ARMPolling from .. import models as _models from .._vendor import _convert_request, _format_url_section T = TypeVar('T') JSONType = Any ClsType = Optional[Callable[[PipelineResponse[HttpRequest, HttpResponse], T, Dict[str, Any]], Any]] _SERIALIZER = Serializer() _SERIALIZER.client_side_validation = False def build_application_gateways_delete_request_initial( resource_group_name: str, application_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "applicationGatewayName": _SERIALIZER.url("application_gateway_name", application_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_application_gateways_get_request( resource_group_name: str, application_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "applicationGatewayName": _SERIALIZER.url("application_gateway_name", application_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_application_gateways_create_or_update_request_initial( resource_group_name: str, application_gateway_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "applicationGatewayName": _SERIALIZER.url("application_gateway_name", application_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_application_gateways_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_application_gateways_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/applicationGateways") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_application_gateways_start_request_initial( resource_group_name: str, application_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}/start") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "applicationGatewayName": _SERIALIZER.url("application_gateway_name", application_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="POST", url=_url, params=_query_parameters, **kwargs ) def build_application_gateways_stop_request_initial( resource_group_name: str, application_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}/stop") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "applicationGatewayName": _SERIALIZER.url("application_gateway_name", application_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="POST", url=_url, params=_query_parameters, **kwargs ) def build_check_dns_name_availability_request( location: str, subscription_id: str, *, domain_name_label: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/locations/{location}/CheckDnsNameAvailability") # pylint: disable=line-too-long path_format_arguments = { "location": _SERIALIZER.url("location", location, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] if domain_name_label is not None: _query_parameters['domainNameLabel'] = _SERIALIZER.query("domain_name_label", domain_name_label, 'str') _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuit_authorizations_delete_request_initial( resource_group_name: str, circuit_name: str, authorization_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "authorizationName": _SERIALIZER.url("authorization_name", authorization_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_express_route_circuit_authorizations_get_request( resource_group_name: str, circuit_name: str, authorization_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "authorizationName": _SERIALIZER.url("authorization_name", authorization_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuit_authorizations_create_or_update_request_initial( resource_group_name: str, circuit_name: str, authorization_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "authorizationName": _SERIALIZER.url("authorization_name", authorization_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_express_route_circuit_authorizations_list_request( resource_group_name: str, circuit_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuit_peerings_delete_request_initial( resource_group_name: str, circuit_name: str, peering_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "peeringName": _SERIALIZER.url("peering_name", peering_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_express_route_circuit_peerings_get_request( resource_group_name: str, circuit_name: str, peering_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "peeringName": _SERIALIZER.url("peering_name", peering_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuit_peerings_create_or_update_request_initial( resource_group_name: str, circuit_name: str, peering_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "peeringName": _SERIALIZER.url("peering_name", peering_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_express_route_circuit_peerings_list_request( resource_group_name: str, circuit_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuits_delete_request_initial( resource_group_name: str, circuit_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_express_route_circuits_get_request( resource_group_name: str, circuit_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuits_create_or_update_request_initial( resource_group_name: str, circuit_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_express_route_circuits_list_arp_table_request( resource_group_name: str, circuit_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/arpTable") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuits_list_routes_table_request( resource_group_name: str, circuit_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/routesTable") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuits_list_stats_request( resource_group_name: str, circuit_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/stats") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "circuitName": _SERIALIZER.url("circuit_name", circuit_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuits_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_circuits_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/expressRouteCircuits") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_express_route_service_providers_list_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/expressRouteServiceProviders") # pylint: disable=line-too-long path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_load_balancers_delete_request_initial( resource_group_name: str, load_balancer_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "loadBalancerName": _SERIALIZER.url("load_balancer_name", load_balancer_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_load_balancers_get_request( resource_group_name: str, load_balancer_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "loadBalancerName": _SERIALIZER.url("load_balancer_name", load_balancer_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_load_balancers_create_or_update_request_initial( resource_group_name: str, load_balancer_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "loadBalancerName": _SERIALIZER.url("load_balancer_name", load_balancer_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_load_balancers_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/loadBalancers") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_load_balancers_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_interfaces_delete_request_initial( resource_group_name: str, network_interface_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkInterfaceName": _SERIALIZER.url("network_interface_name", network_interface_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_network_interfaces_get_request( resource_group_name: str, network_interface_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkInterfaceName": _SERIALIZER.url("network_interface_name", network_interface_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_interfaces_create_or_update_request_initial( resource_group_name: str, network_interface_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkInterfaceName": _SERIALIZER.url("network_interface_name", network_interface_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_network_interfaces_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/networkInterfaces") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_interfaces_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_interfaces_list_virtual_machine_scale_set_vm_network_interfaces_request( resource_group_name: str, virtual_machine_scale_set_name: str, virtualmachine_index: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/microsoft.Compute/virtualMachineScaleSets/{virtualMachineScaleSetName}/virtualMachines/{virtualmachineIndex}/networkInterfaces") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualMachineScaleSetName": _SERIALIZER.url("virtual_machine_scale_set_name", virtual_machine_scale_set_name, 'str'), "virtualmachineIndex": _SERIALIZER.url("virtualmachine_index", virtualmachine_index, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_interfaces_list_virtual_machine_scale_set_network_interfaces_request( resource_group_name: str, virtual_machine_scale_set_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/microsoft.Compute/virtualMachineScaleSets/{virtualMachineScaleSetName}/networkInterfaces") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualMachineScaleSetName": _SERIALIZER.url("virtual_machine_scale_set_name", virtual_machine_scale_set_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_interfaces_get_virtual_machine_scale_set_network_interface_request( resource_group_name: str, virtual_machine_scale_set_name: str, virtualmachine_index: str, network_interface_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/microsoft.Compute/virtualMachineScaleSets/{virtualMachineScaleSetName}/virtualMachines/{virtualmachineIndex}/networkInterfaces/{networkInterfaceName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualMachineScaleSetName": _SERIALIZER.url("virtual_machine_scale_set_name", virtual_machine_scale_set_name, 'str'), "virtualmachineIndex": _SERIALIZER.url("virtualmachine_index", virtualmachine_index, 'str'), "networkInterfaceName": _SERIALIZER.url("network_interface_name", network_interface_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_security_groups_delete_request_initial( resource_group_name: str, network_security_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkSecurityGroupName": _SERIALIZER.url("network_security_group_name", network_security_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_network_security_groups_get_request( resource_group_name: str, network_security_group_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkSecurityGroupName": _SERIALIZER.url("network_security_group_name", network_security_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_security_groups_create_or_update_request_initial( resource_group_name: str, network_security_group_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkSecurityGroupName": _SERIALIZER.url("network_security_group_name", network_security_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_network_security_groups_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/networkSecurityGroups") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_network_security_groups_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_security_rules_delete_request_initial( resource_group_name: str, network_security_group_name: str, security_rule_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkSecurityGroupName": _SERIALIZER.url("network_security_group_name", network_security_group_name, 'str'), "securityRuleName": _SERIALIZER.url("security_rule_name", security_rule_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_security_rules_get_request( resource_group_name: str, network_security_group_name: str, security_rule_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkSecurityGroupName": _SERIALIZER.url("network_security_group_name", network_security_group_name, 'str'), "securityRuleName": _SERIALIZER.url("security_rule_name", security_rule_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_security_rules_create_or_update_request_initial( resource_group_name: str, network_security_group_name: str, security_rule_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkSecurityGroupName": _SERIALIZER.url("network_security_group_name", network_security_group_name, 'str'), "securityRuleName": _SERIALIZER.url("security_rule_name", security_rule_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_security_rules_list_request( resource_group_name: str, network_security_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "networkSecurityGroupName": _SERIALIZER.url("network_security_group_name", network_security_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_public_ip_addresses_delete_request_initial( resource_group_name: str, public_ip_address_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "publicIpAddressName": _SERIALIZER.url("public_ip_address_name", public_ip_address_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_public_ip_addresses_get_request( resource_group_name: str, public_ip_address_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "publicIpAddressName": _SERIALIZER.url("public_ip_address_name", public_ip_address_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_public_ip_addresses_create_or_update_request_initial( resource_group_name: str, public_ip_address_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "publicIpAddressName": _SERIALIZER.url("public_ip_address_name", public_ip_address_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_public_ip_addresses_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/publicIPAddresses") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_public_ip_addresses_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_route_tables_delete_request_initial( resource_group_name: str, route_table_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "routeTableName": _SERIALIZER.url("route_table_name", route_table_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_route_tables_get_request( resource_group_name: str, route_table_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "routeTableName": _SERIALIZER.url("route_table_name", route_table_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_route_tables_create_or_update_request_initial( resource_group_name: str, route_table_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "routeTableName": _SERIALIZER.url("route_table_name", route_table_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_route_tables_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_route_tables_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/routeTables") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_routes_delete_request_initial( resource_group_name: str, route_table_name: str, route_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "routeTableName": _SERIALIZER.url("route_table_name", route_table_name, 'str'), "routeName": _SERIALIZER.url("route_name", route_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_routes_get_request( resource_group_name: str, route_table_name: str, route_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "routeTableName": _SERIALIZER.url("route_table_name", route_table_name, 'str'), "routeName": _SERIALIZER.url("route_name", route_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_routes_create_or_update_request_initial( resource_group_name: str, route_table_name: str, route_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "routeTableName": _SERIALIZER.url("route_table_name", route_table_name, 'str'), "routeName": _SERIALIZER.url("route_name", route_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_routes_list_request( resource_group_name: str, route_table_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "routeTableName": _SERIALIZER.url("route_table_name", route_table_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_usages_list_request( location: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/locations/{location}/usages") # pylint: disable=line-too-long path_format_arguments = { "location": _SERIALIZER.url("location", location, 'str', pattern=r'^[-\w\._]+$'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_networks_delete_request_initial( resource_group_name: str, virtual_network_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkName": _SERIALIZER.url("virtual_network_name", virtual_network_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_virtual_networks_get_request( resource_group_name: str, virtual_network_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkName": _SERIALIZER.url("virtual_network_name", virtual_network_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_networks_create_or_update_request_initial( resource_group_name: str, virtual_network_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkName": _SERIALIZER.url("virtual_network_name", virtual_network_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_virtual_networks_list_all_request( subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/providers/Microsoft.Network/virtualnetworks") path_format_arguments = { "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_networks_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_subnets_delete_request_initial( resource_group_name: str, virtual_network_name: str, subnet_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkName": _SERIALIZER.url("virtual_network_name", virtual_network_name, 'str'), "subnetName": _SERIALIZER.url("subnet_name", subnet_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_subnets_get_request( resource_group_name: str, virtual_network_name: str, subnet_name: str, subscription_id: str, *, expand: Optional[str] = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkName": _SERIALIZER.url("virtual_network_name", virtual_network_name, 'str'), "subnetName": _SERIALIZER.url("subnet_name", subnet_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') if expand is not None: _query_parameters['$expand'] = _SERIALIZER.query("expand", expand, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_subnets_create_or_update_request_initial( resource_group_name: str, virtual_network_name: str, subnet_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkName": _SERIALIZER.url("virtual_network_name", virtual_network_name, 'str'), "subnetName": _SERIALIZER.url("subnet_name", subnet_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_subnets_list_request( resource_group_name: str, virtual_network_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkName": _SERIALIZER.url("virtual_network_name", virtual_network_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_network_gateways_create_or_update_request_initial( resource_group_name: str, virtual_network_gateway_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayName": _SERIALIZER.url("virtual_network_gateway_name", virtual_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_virtual_network_gateways_get_request( resource_group_name: str, virtual_network_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayName": _SERIALIZER.url("virtual_network_gateway_name", virtual_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_network_gateways_delete_request_initial( resource_group_name: str, virtual_network_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayName": _SERIALIZER.url("virtual_network_gateway_name", virtual_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_virtual_network_gateways_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_network_gateways_reset_request_initial( resource_group_name: str, virtual_network_gateway_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}/reset") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayName": _SERIALIZER.url("virtual_network_gateway_name", virtual_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="POST", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_virtual_network_gateways_generatevpnclientpackage_request_initial( resource_group_name: str, virtual_network_gateway_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}/generatevpnclientpackage") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayName": _SERIALIZER.url("virtual_network_gateway_name", virtual_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="POST", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_virtual_network_gateway_connections_create_or_update_request_initial( resource_group_name: str, virtual_network_gateway_connection_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayConnectionName": _SERIALIZER.url("virtual_network_gateway_connection_name", virtual_network_gateway_connection_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_virtual_network_gateway_connections_get_request( resource_group_name: str, virtual_network_gateway_connection_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayConnectionName": _SERIALIZER.url("virtual_network_gateway_connection_name", virtual_network_gateway_connection_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_network_gateway_connections_delete_request_initial( resource_group_name: str, virtual_network_gateway_connection_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayConnectionName": _SERIALIZER.url("virtual_network_gateway_connection_name", virtual_network_gateway_connection_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_virtual_network_gateway_connections_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_virtual_network_gateway_connections_reset_shared_key_request_initial( resource_group_name: str, virtual_network_gateway_connection_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey/reset") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayConnectionName": _SERIALIZER.url("virtual_network_gateway_connection_name", virtual_network_gateway_connection_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="POST", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_virtual_network_gateway_connections_set_shared_key_request_initial( resource_group_name: str, virtual_network_gateway_connection_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayConnectionName": _SERIALIZER.url("virtual_network_gateway_connection_name", virtual_network_gateway_connection_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_virtual_network_gateway_connections_get_shared_key_request( resource_group_name: str, virtual_network_gateway_connection_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "virtualNetworkGatewayConnectionName": _SERIALIZER.url("virtual_network_gateway_connection_name", virtual_network_gateway_connection_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_local_network_gateways_create_or_update_request_initial( resource_group_name: str, local_network_gateway_name: str, subscription_id: str, *, json: JSONType = None, content: Any = None, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str content_type = kwargs.pop('content_type', None) # type: Optional[str] accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "localNetworkGatewayName": _SERIALIZER.url("local_network_gateway_name", local_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] if content_type is not None: _header_parameters['Content-Type'] = _SERIALIZER.header("content_type", content_type, 'str') _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="PUT", url=_url, params=_query_parameters, headers=_header_parameters, json=json, content=content, **kwargs ) def build_local_network_gateways_get_request( resource_group_name: str, local_network_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "localNetworkGatewayName": _SERIALIZER.url("local_network_gateway_name", local_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) def build_local_network_gateways_delete_request_initial( resource_group_name: str, local_network_gateway_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "localNetworkGatewayName": _SERIALIZER.url("local_network_gateway_name", local_network_gateway_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') return HttpRequest( method="DELETE", url=_url, params=_query_parameters, **kwargs ) def build_local_network_gateways_list_request( resource_group_name: str, subscription_id: str, **kwargs: Any ) -> HttpRequest: api_version = kwargs.pop('api_version', "2015-06-15") # type: str accept = "application/json, text/json" # Construct URL _url = kwargs.pop("template_url", "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways") # pylint: disable=line-too-long path_format_arguments = { "resourceGroupName": _SERIALIZER.url("resource_group_name", resource_group_name, 'str'), "subscriptionId": _SERIALIZER.url("subscription_id", subscription_id, 'str'), } _url = _format_url_section(_url, **path_format_arguments) # Construct parameters _query_parameters = kwargs.pop("params", {}) # type: Dict[str, Any] _query_parameters['api-version'] = _SERIALIZER.query("api_version", api_version, 'str') # Construct headers _header_parameters = kwargs.pop("headers", {}) # type: Dict[str, Any] _header_parameters['Accept'] = _SERIALIZER.header("accept", accept, 'str') return HttpRequest( method="GET", url=_url, params=_query_parameters, headers=_header_parameters, **kwargs ) class ApplicationGatewaysOperations(object): """ApplicationGatewaysOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, application_gateway_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_application_gateways_delete_request_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, application_gateway_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified application gateway. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param application_gateway_name: The name of the application gateway. :type application_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, application_gateway_name: str, **kwargs: Any ) -> "_models.ApplicationGateway": """Gets the specified application gateway. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param application_gateway_name: The name of the application gateway. :type application_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: ApplicationGateway, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.ApplicationGateway :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.ApplicationGateway"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_application_gateways_get_request( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('ApplicationGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, application_gateway_name: str, parameters: "_models.ApplicationGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.ApplicationGateway": cls = kwargs.pop('cls', None) # type: ClsType["_models.ApplicationGateway"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'ApplicationGateway') request = build_application_gateways_create_or_update_request_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('ApplicationGateway', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('ApplicationGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, application_gateway_name: str, parameters: "_models.ApplicationGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.ApplicationGateway"]: """Creates or updates the specified application gateway. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param application_gateway_name: The name of the application gateway. :type application_gateway_name: str :param parameters: Parameters supplied to the create or update application gateway operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.ApplicationGateway :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either ApplicationGateway or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.ApplicationGateway] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.ApplicationGateway"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('ApplicationGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.ApplicationGatewayListResult"]: """Lists all application gateways in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ApplicationGatewayListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ApplicationGatewayListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ApplicationGatewayListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_application_gateways_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_application_gateways_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ApplicationGatewayListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.ApplicationGatewayListResult"]: """Gets all the application gateways in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ApplicationGatewayListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ApplicationGatewayListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ApplicationGatewayListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_application_gateways_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_application_gateways_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ApplicationGatewayListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/applicationGateways"} # type: ignore def _start_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, application_gateway_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_application_gateways_start_request_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._start_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _start_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}/start"} # type: ignore @distributed_trace def begin_start( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, application_gateway_name: str, **kwargs: Any ) -> LROPoller[None]: """Starts the specified application gateway. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param application_gateway_name: The name of the application gateway. :type application_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._start_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_start.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}/start"} # type: ignore def _stop_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, application_gateway_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_application_gateways_stop_request_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._stop_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _stop_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}/stop"} # type: ignore @distributed_trace def begin_stop( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, application_gateway_name: str, **kwargs: Any ) -> LROPoller[None]: """Stops the specified application gateway in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param application_gateway_name: The name of the application gateway. :type application_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._stop_initial( resource_group_name=resource_group_name, application_gateway_name=application_gateway_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_stop.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/applicationGateways/{applicationGatewayName}/stop"} # type: ignore class NetworkManagementClientOperationsMixin(object): @distributed_trace def check_dns_name_availability( self, location: str, domain_name_label: Optional[str] = None, **kwargs: Any ) -> "_models.DnsNameAvailabilityResult": """Checks whether a domain name in the cloudapp.net zone is available for use. :param location: The location of the domain name. :type location: str :param domain_name_label: The domain name to be verified. It must conform to the following regular expression: ^[a-z][a-z0-9-]{1,61}[a-z0-9]$. Default value is None. :type domain_name_label: str :keyword callable cls: A custom type or function that will be passed the direct response :return: DnsNameAvailabilityResult, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.DnsNameAvailabilityResult :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.DnsNameAvailabilityResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_check_dns_name_availability_request( location=location, subscription_id=self._config.subscription_id, api_version=api_version, domain_name_label=domain_name_label, template_url=self.check_dns_name_availability.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('DnsNameAvailabilityResult', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized check_dns_name_availability.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/locations/{location}/CheckDnsNameAvailability"} # type: ignore class ExpressRouteCircuitAuthorizationsOperations(object): """ExpressRouteCircuitAuthorizationsOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, circuit_name: str, authorization_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_express_route_circuit_authorizations_delete_request_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, authorization_name=authorization_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, circuit_name: str, authorization_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified authorization from the specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :param authorization_name: The name of the authorization. :type authorization_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, authorization_name=authorization_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, circuit_name: str, authorization_name: str, **kwargs: Any ) -> "_models.ExpressRouteCircuitAuthorization": """Gets the specified authorization from the specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :param authorization_name: The name of the authorization. :type authorization_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: ExpressRouteCircuitAuthorization, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitAuthorization :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitAuthorization"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_express_route_circuit_authorizations_get_request( resource_group_name=resource_group_name, circuit_name=circuit_name, authorization_name=authorization_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('ExpressRouteCircuitAuthorization', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, circuit_name: str, authorization_name: str, authorization_parameters: "_models.ExpressRouteCircuitAuthorization", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.ExpressRouteCircuitAuthorization": cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitAuthorization"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(authorization_parameters, 'ExpressRouteCircuitAuthorization') request = build_express_route_circuit_authorizations_create_or_update_request_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, authorization_name=authorization_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('ExpressRouteCircuitAuthorization', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('ExpressRouteCircuitAuthorization', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, circuit_name: str, authorization_name: str, authorization_parameters: "_models.ExpressRouteCircuitAuthorization", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.ExpressRouteCircuitAuthorization"]: """Creates or updates an authorization in the specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :param authorization_name: The name of the authorization. :type authorization_name: str :param authorization_parameters: Parameters supplied to the create or update express route circuit authorization operation. :type authorization_parameters: ~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitAuthorization :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either ExpressRouteCircuitAuthorization or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitAuthorization] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitAuthorization"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, authorization_name=authorization_name, authorization_parameters=authorization_parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('ExpressRouteCircuitAuthorization', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations/{authorizationName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> Iterable["_models.AuthorizationListResult"]: """Gets all authorizations in an express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the circuit. :type circuit_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either AuthorizationListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.AuthorizationListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.AuthorizationListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_circuit_authorizations_list_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_circuit_authorizations_list_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("AuthorizationListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/authorizations"} # type: ignore class ExpressRouteCircuitPeeringsOperations(object): """ExpressRouteCircuitPeeringsOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, circuit_name: str, peering_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_express_route_circuit_peerings_delete_request_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, peering_name=peering_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, circuit_name: str, peering_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified peering from the specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :param peering_name: The name of the peering. :type peering_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, peering_name=peering_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, circuit_name: str, peering_name: str, **kwargs: Any ) -> "_models.ExpressRouteCircuitPeering": """Gets the specified authorization from the specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :param peering_name: The name of the peering. :type peering_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: ExpressRouteCircuitPeering, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitPeering :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitPeering"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_express_route_circuit_peerings_get_request( resource_group_name=resource_group_name, circuit_name=circuit_name, peering_name=peering_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('ExpressRouteCircuitPeering', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, circuit_name: str, peering_name: str, peering_parameters: "_models.ExpressRouteCircuitPeering", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.ExpressRouteCircuitPeering": cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitPeering"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(peering_parameters, 'ExpressRouteCircuitPeering') request = build_express_route_circuit_peerings_create_or_update_request_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, peering_name=peering_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('ExpressRouteCircuitPeering', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('ExpressRouteCircuitPeering', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, circuit_name: str, peering_name: str, peering_parameters: "_models.ExpressRouteCircuitPeering", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.ExpressRouteCircuitPeering"]: """Creates or updates a peering in the specified express route circuits. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :param peering_name: The name of the peering. :type peering_name: str :param peering_parameters: Parameters supplied to the create or update express route circuit peering operation. :type peering_parameters: ~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitPeering :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either ExpressRouteCircuitPeering or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitPeering] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitPeering"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, peering_name=peering_name, peering_parameters=peering_parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('ExpressRouteCircuitPeering', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings/{peeringName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> Iterable["_models.ExpressRouteCircuitPeeringListResult"]: """Gets all peerings in a specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ExpressRouteCircuitPeeringListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitPeeringListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitPeeringListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_circuit_peerings_list_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_circuit_peerings_list_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ExpressRouteCircuitPeeringListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/peerings"} # type: ignore class ExpressRouteCircuitsOperations(object): """ExpressRouteCircuitsOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_express_route_circuits_delete_request_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the express route circuit. :type circuit_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> "_models.ExpressRouteCircuit": """Gets information about the specified express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of express route circuit. :type circuit_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: ExpressRouteCircuit, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuit :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuit"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_express_route_circuits_get_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('ExpressRouteCircuit', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, circuit_name: str, parameters: "_models.ExpressRouteCircuit", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.ExpressRouteCircuit": cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuit"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'ExpressRouteCircuit') request = build_express_route_circuits_create_or_update_request_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('ExpressRouteCircuit', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('ExpressRouteCircuit', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, circuit_name: str, parameters: "_models.ExpressRouteCircuit", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.ExpressRouteCircuit"]: """Creates or updates an express route circuit. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the circuit. :type circuit_name: str :param parameters: Parameters supplied to the create or update express route circuit operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuit :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either ExpressRouteCircuit or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuit] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuit"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, circuit_name=circuit_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('ExpressRouteCircuit', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}"} # type: ignore @distributed_trace def list_arp_table( self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> Iterable["_models.ExpressRouteCircuitsArpTableListResult"]: """The ListArpTable from ExpressRouteCircuit operation retrieves the currently advertised arp table associated with the ExpressRouteCircuits in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the circuit. :type circuit_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ExpressRouteCircuitsArpTableListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitsArpTableListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitsArpTableListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_circuits_list_arp_table_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_arp_table.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_circuits_list_arp_table_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ExpressRouteCircuitsArpTableListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_arp_table.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/arpTable"} # type: ignore @distributed_trace def list_routes_table( self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> Iterable["_models.ExpressRouteCircuitsRoutesTableListResult"]: """The ListRoutesTable from ExpressRouteCircuit operation retrieves the currently advertised routes table associated with the ExpressRouteCircuits in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the circuit. :type circuit_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ExpressRouteCircuitsRoutesTableListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitsRoutesTableListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitsRoutesTableListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_circuits_list_routes_table_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_routes_table.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_circuits_list_routes_table_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ExpressRouteCircuitsRoutesTableListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_routes_table.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/routesTable"} # type: ignore @distributed_trace def list_stats( self, resource_group_name: str, circuit_name: str, **kwargs: Any ) -> Iterable["_models.ExpressRouteCircuitsStatsListResult"]: """The ListStats ExpressRouteCircuit operation retrieves all the stats from a ExpressRouteCircuits in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param circuit_name: The name of the loadBalancer. :type circuit_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ExpressRouteCircuitsStatsListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitsStatsListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitsStatsListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_circuits_list_stats_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_stats.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_circuits_list_stats_request( resource_group_name=resource_group_name, circuit_name=circuit_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ExpressRouteCircuitsStatsListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_stats.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits/{circuitName}/stats"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.ExpressRouteCircuitListResult"]: """Gets all the express route circuits in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ExpressRouteCircuitListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_circuits_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_circuits_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ExpressRouteCircuitListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/expressRouteCircuits"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.ExpressRouteCircuitListResult"]: """Gets all the express route circuits in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ExpressRouteCircuitListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ExpressRouteCircuitListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteCircuitListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_circuits_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_circuits_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ExpressRouteCircuitListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/expressRouteCircuits"} # type: ignore class ExpressRouteServiceProvidersOperations(object): """ExpressRouteServiceProvidersOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config @distributed_trace def list( self, **kwargs: Any ) -> Iterable["_models.ExpressRouteServiceProviderListResult"]: """Gets all the available express route service providers. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either ExpressRouteServiceProviderListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.ExpressRouteServiceProviderListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.ExpressRouteServiceProviderListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_express_route_service_providers_list_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_express_route_service_providers_list_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("ExpressRouteServiceProviderListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/expressRouteServiceProviders"} # type: ignore class LoadBalancersOperations(object): """LoadBalancersOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, load_balancer_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_load_balancers_delete_request_initial( resource_group_name=resource_group_name, load_balancer_name=load_balancer_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, load_balancer_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified load balancer. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param load_balancer_name: The name of the load balancer. :type load_balancer_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, load_balancer_name=load_balancer_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, load_balancer_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.LoadBalancer": """Gets the specified load balancer. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param load_balancer_name: The name of the load balancer. :type load_balancer_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: LoadBalancer, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.LoadBalancer :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.LoadBalancer"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_load_balancers_get_request( resource_group_name=resource_group_name, load_balancer_name=load_balancer_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('LoadBalancer', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, load_balancer_name: str, parameters: "_models.LoadBalancer", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.LoadBalancer": cls = kwargs.pop('cls', None) # type: ClsType["_models.LoadBalancer"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'LoadBalancer') request = build_load_balancers_create_or_update_request_initial( resource_group_name=resource_group_name, load_balancer_name=load_balancer_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('LoadBalancer', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('LoadBalancer', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, load_balancer_name: str, parameters: "_models.LoadBalancer", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.LoadBalancer"]: """Creates or updates a load balancer. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param load_balancer_name: The name of the load balancer. :type load_balancer_name: str :param parameters: Parameters supplied to the create or update load balancer operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.LoadBalancer :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either LoadBalancer or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.LoadBalancer] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.LoadBalancer"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, load_balancer_name=load_balancer_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('LoadBalancer', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers/{loadBalancerName}"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.LoadBalancerListResult"]: """Gets all the load balancers in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either LoadBalancerListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.LoadBalancerListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.LoadBalancerListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_load_balancers_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_load_balancers_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("LoadBalancerListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/loadBalancers"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.LoadBalancerListResult"]: """Gets all the load balancers in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either LoadBalancerListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.LoadBalancerListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.LoadBalancerListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_load_balancers_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_load_balancers_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("LoadBalancerListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/loadBalancers"} # type: ignore class NetworkInterfacesOperations(object): """NetworkInterfacesOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, network_interface_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_network_interfaces_delete_request_initial( resource_group_name=resource_group_name, network_interface_name=network_interface_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, network_interface_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified network interface. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_interface_name: The name of the network interface. :type network_interface_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, network_interface_name=network_interface_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, network_interface_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.NetworkInterface": """Gets information about the specified network interface. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_interface_name: The name of the network interface. :type network_interface_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: NetworkInterface, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.NetworkInterface :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterface"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_network_interfaces_get_request( resource_group_name=resource_group_name, network_interface_name=network_interface_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('NetworkInterface', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, network_interface_name: str, parameters: "_models.NetworkInterface", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.NetworkInterface": cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterface"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'NetworkInterface') request = build_network_interfaces_create_or_update_request_initial( resource_group_name=resource_group_name, network_interface_name=network_interface_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('NetworkInterface', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('NetworkInterface', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, network_interface_name: str, parameters: "_models.NetworkInterface", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.NetworkInterface"]: """Creates or updates a network interface. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_interface_name: The name of the network interface. :type network_interface_name: str :param parameters: Parameters supplied to the create or update network interface operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.NetworkInterface :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either NetworkInterface or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.NetworkInterface] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterface"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, network_interface_name=network_interface_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('NetworkInterface', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces/{networkInterfaceName}"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.NetworkInterfaceListResult"]: """Gets all network interfaces in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either NetworkInterfaceListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.NetworkInterfaceListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterfaceListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_network_interfaces_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_network_interfaces_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("NetworkInterfaceListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/networkInterfaces"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.NetworkInterfaceListResult"]: """Gets all network interfaces in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either NetworkInterfaceListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.NetworkInterfaceListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterfaceListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_network_interfaces_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_network_interfaces_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("NetworkInterfaceListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkInterfaces"} # type: ignore @distributed_trace def list_virtual_machine_scale_set_vm_network_interfaces( self, resource_group_name: str, virtual_machine_scale_set_name: str, virtualmachine_index: str, **kwargs: Any ) -> Iterable["_models.NetworkInterfaceListResult"]: """Gets information about all network interfaces in a virtual machine in a virtual machine scale set. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_machine_scale_set_name: The name of the virtual machine scale set. :type virtual_machine_scale_set_name: str :param virtualmachine_index: The virtual machine index. :type virtualmachine_index: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either NetworkInterfaceListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.NetworkInterfaceListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterfaceListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_network_interfaces_list_virtual_machine_scale_set_vm_network_interfaces_request( resource_group_name=resource_group_name, virtual_machine_scale_set_name=virtual_machine_scale_set_name, virtualmachine_index=virtualmachine_index, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_virtual_machine_scale_set_vm_network_interfaces.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_network_interfaces_list_virtual_machine_scale_set_vm_network_interfaces_request( resource_group_name=resource_group_name, virtual_machine_scale_set_name=virtual_machine_scale_set_name, virtualmachine_index=virtualmachine_index, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("NetworkInterfaceListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_virtual_machine_scale_set_vm_network_interfaces.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/microsoft.Compute/virtualMachineScaleSets/{virtualMachineScaleSetName}/virtualMachines/{virtualmachineIndex}/networkInterfaces"} # type: ignore @distributed_trace def list_virtual_machine_scale_set_network_interfaces( self, resource_group_name: str, virtual_machine_scale_set_name: str, **kwargs: Any ) -> Iterable["_models.NetworkInterfaceListResult"]: """Gets all network interfaces in a virtual machine scale set. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_machine_scale_set_name: The name of the virtual machine scale set. :type virtual_machine_scale_set_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either NetworkInterfaceListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.NetworkInterfaceListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterfaceListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_network_interfaces_list_virtual_machine_scale_set_network_interfaces_request( resource_group_name=resource_group_name, virtual_machine_scale_set_name=virtual_machine_scale_set_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_virtual_machine_scale_set_network_interfaces.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_network_interfaces_list_virtual_machine_scale_set_network_interfaces_request( resource_group_name=resource_group_name, virtual_machine_scale_set_name=virtual_machine_scale_set_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("NetworkInterfaceListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_virtual_machine_scale_set_network_interfaces.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/microsoft.Compute/virtualMachineScaleSets/{virtualMachineScaleSetName}/networkInterfaces"} # type: ignore @distributed_trace def get_virtual_machine_scale_set_network_interface( self, resource_group_name: str, virtual_machine_scale_set_name: str, virtualmachine_index: str, network_interface_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.NetworkInterface": """Get the specified network interface in a virtual machine scale set. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_machine_scale_set_name: The name of the virtual machine scale set. :type virtual_machine_scale_set_name: str :param virtualmachine_index: The virtual machine index. :type virtualmachine_index: str :param network_interface_name: The name of the network interface. :type network_interface_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: NetworkInterface, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.NetworkInterface :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkInterface"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_network_interfaces_get_virtual_machine_scale_set_network_interface_request( resource_group_name=resource_group_name, virtual_machine_scale_set_name=virtual_machine_scale_set_name, virtualmachine_index=virtualmachine_index, network_interface_name=network_interface_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get_virtual_machine_scale_set_network_interface.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('NetworkInterface', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get_virtual_machine_scale_set_network_interface.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/microsoft.Compute/virtualMachineScaleSets/{virtualMachineScaleSetName}/virtualMachines/{virtualmachineIndex}/networkInterfaces/{networkInterfaceName}"} # type: ignore class NetworkSecurityGroupsOperations(object): """NetworkSecurityGroupsOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, network_security_group_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_network_security_groups_delete_request_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, network_security_group_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified network security group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_security_group_name: The name of the network security group. :type network_security_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, network_security_group_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.NetworkSecurityGroup": """Gets the specified network security group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_security_group_name: The name of the network security group. :type network_security_group_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: NetworkSecurityGroup, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.NetworkSecurityGroup :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkSecurityGroup"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_network_security_groups_get_request( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('NetworkSecurityGroup', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, network_security_group_name: str, parameters: "_models.NetworkSecurityGroup", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.NetworkSecurityGroup": cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkSecurityGroup"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'NetworkSecurityGroup') request = build_network_security_groups_create_or_update_request_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('NetworkSecurityGroup', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('NetworkSecurityGroup', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, network_security_group_name: str, parameters: "_models.NetworkSecurityGroup", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.NetworkSecurityGroup"]: """Creates or updates a network security group in the specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_security_group_name: The name of the network security group. :type network_security_group_name: str :param parameters: Parameters supplied to the create or update network security group operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.NetworkSecurityGroup :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either NetworkSecurityGroup or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.NetworkSecurityGroup] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkSecurityGroup"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('NetworkSecurityGroup', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.NetworkSecurityGroupListResult"]: """Gets all network security groups in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either NetworkSecurityGroupListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.NetworkSecurityGroupListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkSecurityGroupListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_network_security_groups_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_network_security_groups_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("NetworkSecurityGroupListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/networkSecurityGroups"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.NetworkSecurityGroupListResult"]: """Gets all network security groups in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either NetworkSecurityGroupListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.NetworkSecurityGroupListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.NetworkSecurityGroupListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_network_security_groups_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_network_security_groups_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("NetworkSecurityGroupListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups"} # type: ignore class SecurityRulesOperations(object): """SecurityRulesOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, network_security_group_name: str, security_rule_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_security_rules_delete_request_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, security_rule_name=security_rule_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, network_security_group_name: str, security_rule_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified network security rule. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_security_group_name: The name of the network security group. :type network_security_group_name: str :param security_rule_name: The name of the security rule. :type security_rule_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, security_rule_name=security_rule_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, network_security_group_name: str, security_rule_name: str, **kwargs: Any ) -> "_models.SecurityRule": """Get the specified network security rule. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_security_group_name: The name of the network security group. :type network_security_group_name: str :param security_rule_name: The name of the security rule. :type security_rule_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: SecurityRule, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.SecurityRule :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.SecurityRule"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_security_rules_get_request( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, security_rule_name=security_rule_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('SecurityRule', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, network_security_group_name: str, security_rule_name: str, security_rule_parameters: "_models.SecurityRule", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.SecurityRule": cls = kwargs.pop('cls', None) # type: ClsType["_models.SecurityRule"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(security_rule_parameters, 'SecurityRule') request = build_security_rules_create_or_update_request_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, security_rule_name=security_rule_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('SecurityRule', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('SecurityRule', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, network_security_group_name: str, security_rule_name: str, security_rule_parameters: "_models.SecurityRule", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.SecurityRule"]: """Creates or updates a security rule in the specified network security group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_security_group_name: The name of the network security group. :type network_security_group_name: str :param security_rule_name: The name of the security rule. :type security_rule_name: str :param security_rule_parameters: Parameters supplied to the create or update network security rule operation. :type security_rule_parameters: ~azure.mgmt.network.v2015_06_15.models.SecurityRule :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either SecurityRule or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.SecurityRule] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.SecurityRule"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, security_rule_name=security_rule_name, security_rule_parameters=security_rule_parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('SecurityRule', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules/{securityRuleName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, network_security_group_name: str, **kwargs: Any ) -> Iterable["_models.SecurityRuleListResult"]: """Gets all security rules in a network security group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param network_security_group_name: The name of the network security group. :type network_security_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either SecurityRuleListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.SecurityRuleListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.SecurityRuleListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_security_rules_list_request( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_security_rules_list_request( resource_group_name=resource_group_name, network_security_group_name=network_security_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("SecurityRuleListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/networkSecurityGroups/{networkSecurityGroupName}/securityRules"} # type: ignore class PublicIPAddressesOperations(object): """PublicIPAddressesOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, public_ip_address_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_public_ip_addresses_delete_request_initial( resource_group_name=resource_group_name, public_ip_address_name=public_ip_address_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, public_ip_address_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified public IP address. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param public_ip_address_name: The name of the subnet. :type public_ip_address_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, public_ip_address_name=public_ip_address_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, public_ip_address_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.PublicIPAddress": """Gets the specified public IP address in a specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param public_ip_address_name: The name of the subnet. :type public_ip_address_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: PublicIPAddress, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.PublicIPAddress :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.PublicIPAddress"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_public_ip_addresses_get_request( resource_group_name=resource_group_name, public_ip_address_name=public_ip_address_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('PublicIPAddress', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, public_ip_address_name: str, parameters: "_models.PublicIPAddress", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.PublicIPAddress": cls = kwargs.pop('cls', None) # type: ClsType["_models.PublicIPAddress"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'PublicIPAddress') request = build_public_ip_addresses_create_or_update_request_initial( resource_group_name=resource_group_name, public_ip_address_name=public_ip_address_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('PublicIPAddress', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('PublicIPAddress', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, public_ip_address_name: str, parameters: "_models.PublicIPAddress", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.PublicIPAddress"]: """Creates or updates a static or dynamic public IP address. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param public_ip_address_name: The name of the public IP address. :type public_ip_address_name: str :param parameters: Parameters supplied to the create or update public IP address operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.PublicIPAddress :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either PublicIPAddress or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.PublicIPAddress] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.PublicIPAddress"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, public_ip_address_name=public_ip_address_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('PublicIPAddress', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses/{publicIpAddressName}"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.PublicIPAddressListResult"]: """Gets all the public IP addresses in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either PublicIPAddressListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.PublicIPAddressListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.PublicIPAddressListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_public_ip_addresses_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_public_ip_addresses_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("PublicIPAddressListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/publicIPAddresses"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.PublicIPAddressListResult"]: """Gets all public IP addresses in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either PublicIPAddressListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.PublicIPAddressListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.PublicIPAddressListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_public_ip_addresses_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_public_ip_addresses_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("PublicIPAddressListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/publicIPAddresses"} # type: ignore class RouteTablesOperations(object): """RouteTablesOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, route_table_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_route_tables_delete_request_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, route_table_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified route table. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param route_table_name: The name of the route table. :type route_table_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, route_table_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.RouteTable": """Gets the specified route table. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param route_table_name: The name of the route table. :type route_table_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: RouteTable, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.RouteTable :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.RouteTable"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_route_tables_get_request( resource_group_name=resource_group_name, route_table_name=route_table_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('RouteTable', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, route_table_name: str, parameters: "_models.RouteTable", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.RouteTable": cls = kwargs.pop('cls', None) # type: ClsType["_models.RouteTable"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'RouteTable') request = build_route_tables_create_or_update_request_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('RouteTable', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('RouteTable', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, route_table_name: str, parameters: "_models.RouteTable", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.RouteTable"]: """Create or updates a route table in a specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param route_table_name: The name of the route table. :type route_table_name: str :param parameters: Parameters supplied to the create or update route table operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.RouteTable :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either RouteTable or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.RouteTable] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.RouteTable"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('RouteTable', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.RouteTableListResult"]: """Gets all route tables in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either RouteTableListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.RouteTableListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.RouteTableListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_route_tables_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_route_tables_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("RouteTableListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.RouteTableListResult"]: """Gets all route tables in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either RouteTableListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.RouteTableListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.RouteTableListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_route_tables_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_route_tables_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("RouteTableListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/routeTables"} # type: ignore class RoutesOperations(object): """RoutesOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, route_table_name: str, route_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_routes_delete_request_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, route_name=route_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, route_table_name: str, route_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified route from a route table. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param route_table_name: The name of the route table. :type route_table_name: str :param route_name: The name of the route. :type route_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, route_name=route_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, route_table_name: str, route_name: str, **kwargs: Any ) -> "_models.Route": """Gets the specified route from a route table. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param route_table_name: The name of the route table. :type route_table_name: str :param route_name: The name of the route. :type route_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: Route, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.Route :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.Route"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_routes_get_request( resource_group_name=resource_group_name, route_table_name=route_table_name, route_name=route_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('Route', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, route_table_name: str, route_name: str, route_parameters: "_models.Route", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.Route": cls = kwargs.pop('cls', None) # type: ClsType["_models.Route"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(route_parameters, 'Route') request = build_routes_create_or_update_request_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, route_name=route_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('Route', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('Route', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, route_table_name: str, route_name: str, route_parameters: "_models.Route", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.Route"]: """Creates or updates a route in the specified route table. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param route_table_name: The name of the route table. :type route_table_name: str :param route_name: The name of the route. :type route_name: str :param route_parameters: Parameters supplied to the create or update route operation. :type route_parameters: ~azure.mgmt.network.v2015_06_15.models.Route :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either Route or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.Route] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.Route"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, route_table_name=route_table_name, route_name=route_name, route_parameters=route_parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('Route', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes/{routeName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, route_table_name: str, **kwargs: Any ) -> Iterable["_models.RouteListResult"]: """Gets all routes in a route table. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param route_table_name: The name of the route table. :type route_table_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either RouteListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.RouteListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.RouteListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_routes_list_request( resource_group_name=resource_group_name, route_table_name=route_table_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_routes_list_request( resource_group_name=resource_group_name, route_table_name=route_table_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("RouteListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/routeTables/{routeTableName}/routes"} # type: ignore class UsagesOperations(object): """UsagesOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config @distributed_trace def list( self, location: str, **kwargs: Any ) -> Iterable["_models.UsagesListResult"]: """Lists compute usages for a subscription. :param location: The location where resource usage is queried. :type location: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either UsagesListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.UsagesListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.UsagesListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_usages_list_request( location=location, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_usages_list_request( location=location, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("UsagesListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/locations/{location}/usages"} # type: ignore class VirtualNetworksOperations(object): """VirtualNetworksOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_virtual_networks_delete_request_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified virtual network. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_name: The name of the virtual network. :type virtual_network_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, virtual_network_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.VirtualNetwork": """Gets the specified virtual network by resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_name: The name of the virtual network. :type virtual_network_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: VirtualNetwork, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.VirtualNetwork :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetwork"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_virtual_networks_get_request( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('VirtualNetwork', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, virtual_network_name: str, parameters: "_models.VirtualNetwork", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.VirtualNetwork": cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetwork"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'VirtualNetwork') request = build_virtual_networks_create_or_update_request_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('VirtualNetwork', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('VirtualNetwork', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, virtual_network_name: str, parameters: "_models.VirtualNetwork", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.VirtualNetwork"]: """Creates or updates a virtual network in the specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_name: The name of the virtual network. :type virtual_network_name: str :param parameters: Parameters supplied to the create or update virtual network operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.VirtualNetwork :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either VirtualNetwork or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.VirtualNetwork] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetwork"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('VirtualNetwork', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworks/{virtualNetworkName}"} # type: ignore @distributed_trace def list_all( self, **kwargs: Any ) -> Iterable["_models.VirtualNetworkListResult"]: """Gets all virtual networks in a subscription. :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either VirtualNetworkListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.VirtualNetworkListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_virtual_networks_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list_all.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_virtual_networks_list_all_request( subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("VirtualNetworkListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list_all.metadata = {'url': "/subscriptions/{subscriptionId}/providers/Microsoft.Network/virtualnetworks"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.VirtualNetworkListResult"]: """Gets all virtual networks in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either VirtualNetworkListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.VirtualNetworkListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_virtual_networks_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_virtual_networks_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("VirtualNetworkListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks"} # type: ignore class SubnetsOperations(object): """SubnetsOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_name: str, subnet_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_subnets_delete_request_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subnet_name=subnet_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_name: str, subnet_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified subnet. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_name: The name of the virtual network. :type virtual_network_name: str :param subnet_name: The name of the subnet. :type subnet_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subnet_name=subnet_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, virtual_network_name: str, subnet_name: str, expand: Optional[str] = None, **kwargs: Any ) -> "_models.Subnet": """Gets the specified subnet by virtual network and resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_name: The name of the virtual network. :type virtual_network_name: str :param subnet_name: The name of the subnet. :type subnet_name: str :param expand: Expands referenced resources. Default value is None. :type expand: str :keyword callable cls: A custom type or function that will be passed the direct response :return: Subnet, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.Subnet :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.Subnet"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_subnets_get_request( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subnet_name=subnet_name, subscription_id=self._config.subscription_id, api_version=api_version, expand=expand, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('Subnet', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}"} # type: ignore def _create_or_update_initial( self, resource_group_name: str, virtual_network_name: str, subnet_name: str, subnet_parameters: "_models.Subnet", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.Subnet": cls = kwargs.pop('cls', None) # type: ClsType["_models.Subnet"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(subnet_parameters, 'Subnet') request = build_subnets_create_or_update_request_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subnet_name=subnet_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('Subnet', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('Subnet', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, virtual_network_name: str, subnet_name: str, subnet_parameters: "_models.Subnet", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.Subnet"]: """Creates or updates a subnet in the specified virtual network. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_name: The name of the virtual network. :type virtual_network_name: str :param subnet_name: The name of the subnet. :type subnet_name: str :param subnet_parameters: Parameters supplied to the create or update subnet operation. :type subnet_parameters: ~azure.mgmt.network.v2015_06_15.models.Subnet :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either Subnet or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.Subnet] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.Subnet"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subnet_name=subnet_name, subnet_parameters=subnet_parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('Subnet', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets/{subnetName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, virtual_network_name: str, **kwargs: Any ) -> Iterable["_models.SubnetListResult"]: """Gets all subnets in a virtual network. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_name: The name of the virtual network. :type virtual_network_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either SubnetListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.SubnetListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.SubnetListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_subnets_list_request( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_subnets_list_request( resource_group_name=resource_group_name, virtual_network_name=virtual_network_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("SubnetListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualnetworks/{virtualNetworkName}/subnets"} # type: ignore class VirtualNetworkGatewaysOperations(object): """VirtualNetworkGatewaysOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _create_or_update_initial( self, resource_group_name: str, virtual_network_gateway_name: str, parameters: "_models.VirtualNetworkGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.VirtualNetworkGateway": cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGateway"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'VirtualNetworkGateway') request = build_virtual_network_gateways_create_or_update_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('VirtualNetworkGateway', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('VirtualNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, virtual_network_gateway_name: str, parameters: "_models.VirtualNetworkGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.VirtualNetworkGateway"]: """Creates or updates a virtual network gateway in the specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_name: The name of the virtual network gateway. :type virtual_network_gateway_name: str :param parameters: Parameters supplied to create or update virtual network gateway operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGateway :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either VirtualNetworkGateway or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGateway] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGateway"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('VirtualNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, virtual_network_gateway_name: str, **kwargs: Any ) -> "_models.VirtualNetworkGateway": """Gets the specified virtual network gateway by resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_name: The name of the virtual network gateway. :type virtual_network_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: VirtualNetworkGateway, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGateway :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGateway"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_virtual_network_gateways_get_request( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('VirtualNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}"} # type: ignore def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_gateway_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_virtual_network_gateways_delete_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_gateway_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified virtual network gateway. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_name: The name of the virtual network gateway. :type virtual_network_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, lro_options={'final-state-via': 'location'}, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.VirtualNetworkGatewayListResult"]: """Gets all virtual network gateways by resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either VirtualNetworkGatewayListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGatewayListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGatewayListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_virtual_network_gateways_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_virtual_network_gateways_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("VirtualNetworkGatewayListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways"} # type: ignore def _reset_initial( self, resource_group_name: str, virtual_network_gateway_name: str, parameters: "_models.VirtualNetworkGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> Optional["_models.VirtualNetworkGateway"]: cls = kwargs.pop('cls', None) # type: ClsType[Optional["_models.VirtualNetworkGateway"]] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'VirtualNetworkGateway') request = build_virtual_network_gateways_reset_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._reset_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = None if response.status_code == 200: deserialized = self._deserialize('VirtualNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _reset_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}/reset"} # type: ignore @distributed_trace def begin_reset( self, resource_group_name: str, virtual_network_gateway_name: str, parameters: "_models.VirtualNetworkGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.VirtualNetworkGateway"]: """Resets the primary of the virtual network gateway in the specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_name: The name of the virtual network gateway. :type virtual_network_gateway_name: str :param parameters: Virtual network gateway vip address supplied to the begin reset of the active-active feature enabled gateway. :type parameters: ~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGateway :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either VirtualNetworkGateway or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGateway] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGateway"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._reset_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('VirtualNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, lro_options={'final-state-via': 'location'}, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_reset.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}/reset"} # type: ignore def _generatevpnclientpackage_initial( self, resource_group_name: str, virtual_network_gateway_name: str, parameters: "_models.VpnClientParameters", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> str: cls = kwargs.pop('cls', None) # type: ClsType[str] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'VpnClientParameters') request = build_virtual_network_gateways_generatevpnclientpackage_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._generatevpnclientpackage_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [202]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('str', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _generatevpnclientpackage_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}/generatevpnclientpackage"} # type: ignore @distributed_trace def begin_generatevpnclientpackage( self, resource_group_name: str, virtual_network_gateway_name: str, parameters: "_models.VpnClientParameters", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller[str]: """Generates VPN client package for P2S client of the virtual network gateway in the specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_name: The name of the virtual network gateway. :type virtual_network_gateway_name: str :param parameters: Parameters supplied to the generate virtual network gateway VPN client package operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.VpnClientParameters :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either str or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[str] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[str] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._generatevpnclientpackage_initial( resource_group_name=resource_group_name, virtual_network_gateway_name=virtual_network_gateway_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('str', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, lro_options={'final-state-via': 'location'}, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_generatevpnclientpackage.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/virtualNetworkGateways/{virtualNetworkGatewayName}/generatevpnclientpackage"} # type: ignore class VirtualNetworkGatewayConnectionsOperations(object): """VirtualNetworkGatewayConnectionsOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _create_or_update_initial( self, resource_group_name: str, virtual_network_gateway_connection_name: str, parameters: "_models.VirtualNetworkGatewayConnection", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.VirtualNetworkGatewayConnection": cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGatewayConnection"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'VirtualNetworkGatewayConnection') request = build_virtual_network_gateway_connections_create_or_update_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('VirtualNetworkGatewayConnection', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('VirtualNetworkGatewayConnection', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, virtual_network_gateway_connection_name: str, parameters: "_models.VirtualNetworkGatewayConnection", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.VirtualNetworkGatewayConnection"]: """Creates or updates a virtual network gateway connection in the specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_connection_name: The name of the virtual network gateway connection. :type virtual_network_gateway_connection_name: str :param parameters: Parameters supplied to the create or update virtual network gateway connection operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGatewayConnection :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either VirtualNetworkGatewayConnection or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGatewayConnection] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGatewayConnection"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('VirtualNetworkGatewayConnection', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, virtual_network_gateway_connection_name: str, **kwargs: Any ) -> "_models.VirtualNetworkGatewayConnection": """Gets the specified virtual network gateway connection by resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_connection_name: The name of the virtual network gateway connection. :type virtual_network_gateway_connection_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: VirtualNetworkGatewayConnection, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGatewayConnection :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGatewayConnection"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_virtual_network_gateway_connections_get_request( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('VirtualNetworkGatewayConnection', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}"} # type: ignore def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_gateway_connection_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_virtual_network_gateway_connections_delete_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, virtual_network_gateway_connection_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified virtual network Gateway connection. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_connection_name: The name of the virtual network gateway connection. :type virtual_network_gateway_connection_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, lro_options={'final-state-via': 'location'}, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.VirtualNetworkGatewayConnectionListResult"]: """The List VirtualNetworkGatewayConnections operation retrieves all the virtual network gateways connections created. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either VirtualNetworkGatewayConnectionListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.VirtualNetworkGatewayConnectionListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.VirtualNetworkGatewayConnectionListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_virtual_network_gateway_connections_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_virtual_network_gateway_connections_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("VirtualNetworkGatewayConnectionListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections"} # type: ignore def _reset_shared_key_initial( self, resource_group_name: str, virtual_network_gateway_connection_name: str, parameters: "_models.ConnectionResetSharedKey", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> Optional["_models.ConnectionResetSharedKey"]: cls = kwargs.pop('cls', None) # type: ClsType[Optional["_models.ConnectionResetSharedKey"]] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'ConnectionResetSharedKey') request = build_virtual_network_gateway_connections_reset_shared_key_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._reset_shared_key_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = None if response.status_code == 200: deserialized = self._deserialize('ConnectionResetSharedKey', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _reset_shared_key_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey/reset"} # type: ignore @distributed_trace def begin_reset_shared_key( self, resource_group_name: str, virtual_network_gateway_connection_name: str, parameters: "_models.ConnectionResetSharedKey", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.ConnectionResetSharedKey"]: """The VirtualNetworkGatewayConnectionResetSharedKey operation resets the virtual network gateway connection shared key for passed virtual network gateway connection in the specified resource group through Network resource provider. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_connection_name: The virtual network gateway connection reset shared key Name. :type virtual_network_gateway_connection_name: str :param parameters: Parameters supplied to the begin reset virtual network gateway connection shared key operation through network resource provider. :type parameters: ~azure.mgmt.network.v2015_06_15.models.ConnectionResetSharedKey :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either ConnectionResetSharedKey or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.ConnectionResetSharedKey] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.ConnectionResetSharedKey"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._reset_shared_key_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('ConnectionResetSharedKey', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, lro_options={'final-state-via': 'location'}, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_reset_shared_key.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey/reset"} # type: ignore def _set_shared_key_initial( self, resource_group_name: str, virtual_network_gateway_connection_name: str, parameters: "_models.ConnectionSharedKey", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.ConnectionSharedKey": cls = kwargs.pop('cls', None) # type: ClsType["_models.ConnectionSharedKey"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'ConnectionSharedKey') request = build_virtual_network_gateway_connections_set_shared_key_request_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._set_shared_key_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('ConnectionSharedKey', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('ConnectionSharedKey', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _set_shared_key_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey"} # type: ignore @distributed_trace def begin_set_shared_key( self, resource_group_name: str, virtual_network_gateway_connection_name: str, parameters: "_models.ConnectionSharedKey", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.ConnectionSharedKey"]: """The Put VirtualNetworkGatewayConnectionSharedKey operation sets the virtual network gateway connection shared key for passed virtual network gateway connection in the specified resource group through Network resource provider. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_connection_name: The virtual network gateway connection name. :type virtual_network_gateway_connection_name: str :param parameters: Parameters supplied to the Begin Set Virtual Network Gateway connection Shared key operation throughNetwork resource provider. :type parameters: ~azure.mgmt.network.v2015_06_15.models.ConnectionSharedKey :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either ConnectionSharedKey or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.ConnectionSharedKey] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.ConnectionSharedKey"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._set_shared_key_initial( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('ConnectionSharedKey', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_set_shared_key.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey"} # type: ignore @distributed_trace def get_shared_key( self, resource_group_name: str, virtual_network_gateway_connection_name: str, **kwargs: Any ) -> "_models.ConnectionSharedKeyResult": """The Get VirtualNetworkGatewayConnectionSharedKey operation retrieves information about the specified virtual network gateway connection shared key through Network resource provider. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param virtual_network_gateway_connection_name: The virtual network gateway connection shared key name. :type virtual_network_gateway_connection_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: ConnectionSharedKeyResult, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.ConnectionSharedKeyResult :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.ConnectionSharedKeyResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_virtual_network_gateway_connections_get_shared_key_request( resource_group_name=resource_group_name, virtual_network_gateway_connection_name=virtual_network_gateway_connection_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get_shared_key.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('ConnectionSharedKeyResult', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get_shared_key.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/connections/{virtualNetworkGatewayConnectionName}/sharedkey"} # type: ignore class LocalNetworkGatewaysOperations(object): """LocalNetworkGatewaysOperations operations. You should not instantiate this class directly. Instead, you should create a Client instance that instantiates it for you and attaches it as an attribute. :ivar models: Alias to model classes used in this operation group. :type models: ~azure.mgmt.network.v2015_06_15.models :param client: Client for service requests. :param config: Configuration of service client. :param serializer: An object model serializer. :param deserializer: An object model deserializer. """ models = _models def __init__(self, client, config, serializer, deserializer): self._client = client self._serialize = serializer self._deserialize = deserializer self._config = config def _create_or_update_initial( self, resource_group_name: str, local_network_gateway_name: str, parameters: "_models.LocalNetworkGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> "_models.LocalNetworkGateway": cls = kwargs.pop('cls', None) # type: ClsType["_models.LocalNetworkGateway"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str _json = self._serialize.body(parameters, 'LocalNetworkGateway') request = build_local_network_gateways_create_or_update_request_initial( resource_group_name=resource_group_name, local_network_gateway_name=local_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, content_type=content_type, json=_json, template_url=self._create_or_update_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 201]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if response.status_code == 200: deserialized = self._deserialize('LocalNetworkGateway', pipeline_response) if response.status_code == 201: deserialized = self._deserialize('LocalNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized _create_or_update_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}"} # type: ignore @distributed_trace def begin_create_or_update( self, resource_group_name: str, local_network_gateway_name: str, parameters: "_models.LocalNetworkGateway", *, content_type: Optional[str] = "application/json", **kwargs: Any ) -> LROPoller["_models.LocalNetworkGateway"]: """Creates or updates a local network gateway in the specified resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param local_network_gateway_name: The name of the local network gateway. :type local_network_gateway_name: str :param parameters: Parameters supplied to the create or update local network gateway operation. :type parameters: ~azure.mgmt.network.v2015_06_15.models.LocalNetworkGateway :keyword content_type: Media type of the body sent to the API. Possible values are: "application/json" or "text/json". Default value is "application/json". :paramtype content_type: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either LocalNetworkGateway or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[~azure.mgmt.network.v2015_06_15.models.LocalNetworkGateway] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType["_models.LocalNetworkGateway"] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._create_or_update_initial( resource_group_name=resource_group_name, local_network_gateway_name=local_network_gateway_name, parameters=parameters, content_type=content_type, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): response = pipeline_response.http_response deserialized = self._deserialize('LocalNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized if polling is True: polling_method = ARMPolling(lro_delay, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_create_or_update.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}"} # type: ignore @distributed_trace def get( self, resource_group_name: str, local_network_gateway_name: str, **kwargs: Any ) -> "_models.LocalNetworkGateway": """Gets the specified local network gateway in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param local_network_gateway_name: The name of the local network gateway. :type local_network_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: LocalNetworkGateway, or the result of cls(response) :rtype: ~azure.mgmt.network.v2015_06_15.models.LocalNetworkGateway :raises: ~azure.core.exceptions.HttpResponseError """ cls = kwargs.pop('cls', None) # type: ClsType["_models.LocalNetworkGateway"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_local_network_gateways_get_request( resource_group_name=resource_group_name, local_network_gateway_name=local_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.get.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) deserialized = self._deserialize('LocalNetworkGateway', pipeline_response) if cls: return cls(pipeline_response, deserialized, {}) return deserialized get.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}"} # type: ignore def _delete_initial( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, local_network_gateway_name: str, **kwargs: Any ) -> None: cls = kwargs.pop('cls', None) # type: ClsType[None] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) api_version = kwargs.pop('api_version', "2015-06-15") # type: str request = build_local_network_gateways_delete_request_initial( resource_group_name=resource_group_name, local_network_gateway_name=local_network_gateway_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self._delete_initial.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200, 202, 204]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) if cls: return cls(pipeline_response, None, {}) _delete_initial.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}"} # type: ignore @distributed_trace def begin_delete( # pylint: disable=inconsistent-return-statements self, resource_group_name: str, local_network_gateway_name: str, **kwargs: Any ) -> LROPoller[None]: """Deletes the specified local network gateway. :param resource_group_name: The name of the resource group. :type resource_group_name: str :param local_network_gateway_name: The name of the local network gateway. :type local_network_gateway_name: str :keyword callable cls: A custom type or function that will be passed the direct response :keyword str continuation_token: A continuation token to restart a poller from a saved state. :keyword polling: By default, your polling method will be ARMPolling. Pass in False for this operation to not poll, or pass in your own initialized polling object for a personal polling strategy. :paramtype polling: bool or ~azure.core.polling.PollingMethod :keyword int polling_interval: Default waiting time between two polls for LRO operations if no Retry-After header is present. :return: An instance of LROPoller that returns either None or the result of cls(response) :rtype: ~azure.core.polling.LROPoller[None] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str polling = kwargs.pop('polling', True) # type: Union[bool, PollingMethod] cls = kwargs.pop('cls', None) # type: ClsType[None] lro_delay = kwargs.pop( 'polling_interval', self._config.polling_interval ) cont_token = kwargs.pop('continuation_token', None) # type: Optional[str] if cont_token is None: raw_result = self._delete_initial( resource_group_name=resource_group_name, local_network_gateway_name=local_network_gateway_name, api_version=api_version, cls=lambda x,y,z: x, **kwargs ) kwargs.pop('error_map', None) def get_long_running_output(pipeline_response): if cls: return cls(pipeline_response, None, {}) if polling is True: polling_method = ARMPolling(lro_delay, lro_options={'final-state-via': 'location'}, **kwargs) elif polling is False: polling_method = NoPolling() else: polling_method = polling if cont_token: return LROPoller.from_continuation_token( polling_method=polling_method, continuation_token=cont_token, client=self._client, deserialization_callback=get_long_running_output ) return LROPoller(self._client, raw_result, get_long_running_output, polling_method) begin_delete.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways/{localNetworkGatewayName}"} # type: ignore @distributed_trace def list( self, resource_group_name: str, **kwargs: Any ) -> Iterable["_models.LocalNetworkGatewayListResult"]: """Gets all the local network gateways in a resource group. :param resource_group_name: The name of the resource group. :type resource_group_name: str :keyword callable cls: A custom type or function that will be passed the direct response :return: An iterator like instance of either LocalNetworkGatewayListResult or the result of cls(response) :rtype: ~azure.core.paging.ItemPaged[~azure.mgmt.network.v2015_06_15.models.LocalNetworkGatewayListResult] :raises: ~azure.core.exceptions.HttpResponseError """ api_version = kwargs.pop('api_version', "2015-06-15") # type: str cls = kwargs.pop('cls', None) # type: ClsType["_models.LocalNetworkGatewayListResult"] error_map = { 401: ClientAuthenticationError, 404: ResourceNotFoundError, 409: ResourceExistsError } error_map.update(kwargs.pop('error_map', {})) def prepare_request(next_link=None): if not next_link: request = build_local_network_gateways_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=self.list.metadata['url'], ) request = _convert_request(request) request.url = self._client.format_url(request.url) else: request = build_local_network_gateways_list_request( resource_group_name=resource_group_name, subscription_id=self._config.subscription_id, api_version=api_version, template_url=next_link, ) request = _convert_request(request) request.url = self._client.format_url(request.url) request.method = "GET" return request def extract_data(pipeline_response): deserialized = self._deserialize("LocalNetworkGatewayListResult", pipeline_response) list_of_elem = deserialized.value if cls: list_of_elem = cls(list_of_elem) return deserialized.next_link or None, iter(list_of_elem) def get_next(next_link=None): request = prepare_request(next_link) pipeline_response = self._client._pipeline.run( # pylint: disable=protected-access request, stream=False, **kwargs ) response = pipeline_response.http_response if response.status_code not in [200]: map_error(status_code=response.status_code, response=response, error_map=error_map) raise HttpResponseError(response=response, error_format=ARMErrorFormat) return pipeline_response return ItemPaged( get_next, extract_data ) list.metadata = {'url': "/subscriptions/{subscriptionId}/resourceGroups/{resourceGroupName}/providers/Microsoft.Network/localNetworkGateways"} # type: ignore

43.142954

316

0.667796

54,185

510,036

6.014487

0.009191

0.030869

0.040271

0.021234

0.973992

0.972359

0.970251

0.966649

0.963945

0.957526

0

0.010076

0.241107

510,036

11,821

317

43.146604

0.831893

0.216812

0

0.866412

0

0.005797

0.160372

0.091514

0

1

0.044776

false

0

0.001604

0

0.105464

0

null

0

1

0

1

0

null

0

7

c8015eddc27b72082b09a215d9bcb3522b92b0c9

270

py

Python

src/ite/algs/__init__.py

bcebere/ite-api

f01ea235a92bd70e16c776b4ce2ce920ca91fbc0

[ "Apache-2.0" ]

1

2022-02-15T09:13:45.000Z

src/ite/algs/__init__.py

bcebere/ite-api

f01ea235a92bd70e16c776b4ce2ce920ca91fbc0

[ "Apache-2.0" ]

null

src/ite/algs/__init__.py

bcebere/ite-api

f01ea235a92bd70e16c776b4ce2ce920ca91fbc0

[ "Apache-2.0" ]

1

2021-11-27T12:55:51.000Z

# ite absolute import ite.algs.causal_multitask_gaussian_processes # noqa: F401,E402 import ite.algs.ganite # noqa: F401,E402 import ite.algs.ganite_torch # noqa: F401,E402 import ite.algs.hyperparam_tuning # noqa: F401,E402 import ite.algs.model # noqa: F401,E402

38.571429

70

0.781481

42

270

4.904762

0.380952

0.218447

0.315534

0.349515

0.543689

0.300971

0

0.126582

0.122222

270

6

71

45

0.742616

0.340741

0

1

0

true

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

c855e59e3beb387ead12ed11087e5f17130c65a2

295

py

Python

CodonSubstitution/build/biopython/Tests/test_IsoelectricPoint.py

JackCurragh/DARNED

13963d129bd8f69fb1106ad1f47394b3211a939c

[ "MIT" ]

3

2017-10-23T21:53:57.000Z

2019-09-23T05:14:12.000Z

CodonSubstitution/build/biopython/Tests/test_IsoelectricPoint.py

JackCurragh/DARNED

13963d129bd8f69fb1106ad1f47394b3211a939c

[ "MIT" ]

null

CodonSubstitution/build/biopython/Tests/test_IsoelectricPoint.py

JackCurragh/DARNED

13963d129bd8f69fb1106ad1f47394b3211a939c

[ "MIT" ]

6

2020-02-26T16:34:20.000Z

2020-03-04T15:34:00.000Z

from Bio.SeqUtils import ProtParam X = ProtParam.ProteinAnalysis("MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV") print "isoelectric point for this protein: %.3f" % X.isoelectric_point()

59

185

0.888136

19

295

13.736842

0.789474

0.122605

0

0.003597

0.057627

295

4

186

73.75

0.935252

0

0.650847

0.515254

0

1

0

null

0

0.333333

null

0.333333

1

0

1

null

0

1

0

1

null

1

0

1

0

1

0

8

c0c904fd541e0d487da85a649cd84853672e0c16

25

py

Python

bugtests/test088p/foobase.py

doom38/jython_v2.2.1

0803a0c953c294e6d14f9fc7d08edf6a3e630a15

[ "CNRI-Jython" ]

null

bugtests/test088p/foobase.py

doom38/jython_v2.2.1

0803a0c953c294e6d14f9fc7d08edf6a3e630a15

[ "CNRI-Jython" ]

null

bugtests/test088p/foobase.py

doom38/jython_v2.2.1

0803a0c953c294e6d14f9fc7d08edf6a3e630a15

[ "CNRI-Jython" ]

null

def doit(): return "Done"

25

0.68

4

25

4.25

1

0

0.12

25

1

25

0.772727

0

0.153846

0

1

true

0

1

0

1

0

null

0

1

0

null

0

1

0

1

0

7

23e4b229354fb027a98f3371b035e4738247eb2c

39

py

Python

cms/test_utils/project/brokenpluginapp/cms_plugins.py

samirasnoun/django_cms_gallery_image

7792aa06a60877d86c022e73b60d0d669e79cb74

[ "BSD-3-Clause" ]

5,659

2015-01-01T02:42:30.000Z

2020-10-07T02:38:29.000Z

cms/test_utils/project/brokenpluginapp/cms_plugins.py

thisisalamin/django-cms

eeb1e4712b3866e243daf800c142e2199e4be9df

[ "BSD-3-Clause" ]

3,264

2015-01-02T10:11:48.000Z

2020-10-08T13:15:07.000Z

cms/test_utils/project/brokenpluginapp/cms_plugins.py

thisisalamin/django-cms

eeb1e4712b3866e243daf800c142e2199e4be9df

[ "BSD-3-Clause" ]

2,132

2015-01-01T11:28:21.000Z

2020-10-06T09:09:11.000Z

import nonexistingmodule # nopyflakes

19.5

38

0.846154

3

39

11

1

0

0.128205

39

1

39

0.970588

0.25641

0

1

0

true

0

1

0

1

0

1

null

0

1

0

null

0

1

0

1

0

1

0

7

9b1e0ae1a2019d3e1758a8b6dbde9c9472873a1a

111,457

py

Python

spinnaker_swagger_client/api/managed_controller_api.py

coveooss/spinnaker_python_client

6f5ae436798cb4985ada65cd8169fcc9494d048f

[ "Apache-2.0" ]

null

spinnaker_swagger_client/api/managed_controller_api.py

coveooss/spinnaker_python_client

6f5ae436798cb4985ada65cd8169fcc9494d048f

[ "Apache-2.0" ]

null

spinnaker_swagger_client/api/managed_controller_api.py

coveooss/spinnaker_python_client

6f5ae436798cb4985ada65cd8169fcc9494d048f

[ "Apache-2.0" ]

2

2019-10-17T07:49:21.000Z

2021-08-10T23:12:41.000Z

# coding: utf-8 """ Spinnaker API No description provided (generated by Swagger Codegen https://github.com/swagger-api/swagger-codegen) # noqa: E501 OpenAPI spec version: 1.0.0 Generated by: https://github.com/swagger-api/swagger-codegen.git """ from __future__ import absolute_import import re # noqa: F401 # python 2 and python 3 compatibility library import six from spinnaker_swagger_client.api_client import ApiClient class ManagedControllerApi(object): """NOTE: This class is auto generated by the swagger code generator program. Do not edit the class manually. Ref: https://github.com/swagger-api/swagger-codegen """ def __init__(self, api_client=None): if api_client is None: api_client = ApiClient() self.api_client = api_client def create_pin_using_post(self, application, pin, **kwargs): # noqa: E501 """Create a pin for an artifact in an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.create_pin_using_post(application, pin, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param EnvironmentArtifactPin pin: pin (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.create_pin_using_post_with_http_info(application, pin, **kwargs) # noqa: E501 else: (data) = self.create_pin_using_post_with_http_info(application, pin, **kwargs) # noqa: E501 return data def create_pin_using_post_with_http_info(self, application, pin, **kwargs): # noqa: E501 """Create a pin for an artifact in an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.create_pin_using_post_with_http_info(application, pin, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param EnvironmentArtifactPin pin: pin (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['application', 'pin'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method create_pin_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `create_pin_using_post`") # noqa: E501 # verify the required parameter 'pin' is set if ('pin' not in params or params['pin'] is None): raise ValueError("Missing the required parameter `pin` when calling `create_pin_using_post`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None if 'pin' in params: body_params = params['pin'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/pin', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def delete_manifest_by_app_using_delete(self, application, **kwargs): # noqa: E501 """Delete a delivery config manifest for an application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_manifest_by_app_using_delete(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.delete_manifest_by_app_using_delete_with_http_info(application, **kwargs) # noqa: E501 else: (data) = self.delete_manifest_by_app_using_delete_with_http_info(application, **kwargs) # noqa: E501 return data def delete_manifest_by_app_using_delete_with_http_info(self, application, **kwargs): # noqa: E501 """Delete a delivery config manifest for an application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_manifest_by_app_using_delete_with_http_info(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ all_params = ['application'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method delete_manifest_by_app_using_delete" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `delete_manifest_by_app_using_delete`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/config', 'DELETE', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='DeliveryConfig', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def delete_manifest_using_delete(self, name, **kwargs): # noqa: E501 """Delete a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_manifest_using_delete(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.delete_manifest_using_delete_with_http_info(name, **kwargs) # noqa: E501 else: (data) = self.delete_manifest_using_delete_with_http_info(name, **kwargs) # noqa: E501 return data def delete_manifest_using_delete_with_http_info(self, name, **kwargs): # noqa: E501 """Delete a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_manifest_using_delete_with_http_info(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ all_params = ['name'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method delete_manifest_using_delete" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'name' is set if ('name' not in params or params['name'] is None): raise ValueError("Missing the required parameter `name` when calling `delete_manifest_using_delete`") # noqa: E501 collection_formats = {} path_params = {} if 'name' in params: path_params['name'] = params['name'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs/{name}', 'DELETE', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='DeliveryConfig', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def delete_pin_using_delete(self, application, target_environment, **kwargs): # noqa: E501 """Unpin one or more artifact(s) in an environment. If the `reference` parameter is specified, only the corresponding artifact will be unpinned. If it's omitted, all pinned artifacts in the environment will be unpinned. # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_pin_using_delete(application, target_environment, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str target_environment: targetEnvironment (required) :param str reference: reference :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.delete_pin_using_delete_with_http_info(application, target_environment, **kwargs) # noqa: E501 else: (data) = self.delete_pin_using_delete_with_http_info(application, target_environment, **kwargs) # noqa: E501 return data def delete_pin_using_delete_with_http_info(self, application, target_environment, **kwargs): # noqa: E501 """Unpin one or more artifact(s) in an environment. If the `reference` parameter is specified, only the corresponding artifact will be unpinned. If it's omitted, all pinned artifacts in the environment will be unpinned. # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_pin_using_delete_with_http_info(application, target_environment, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str target_environment: targetEnvironment (required) :param str reference: reference :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['application', 'target_environment', 'reference'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method delete_pin_using_delete" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `delete_pin_using_delete`") # noqa: E501 # verify the required parameter 'target_environment' is set if ('target_environment' not in params or params['target_environment'] is None): raise ValueError("Missing the required parameter `target_environment` when calling `delete_pin_using_delete`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 if 'target_environment' in params: path_params['targetEnvironment'] = params['target_environment'] # noqa: E501 query_params = [] if 'reference' in params: query_params.append(('reference', params['reference'])) # noqa: E501 header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/pin/{targetEnvironment}', 'DELETE', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def delete_veto_using_delete(self, application, reference, target_environment, version, **kwargs): # noqa: E501 """Remove veto of an artifact version in an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_veto_using_delete(application, reference, target_environment, version, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str reference: reference (required) :param str target_environment: targetEnvironment (required) :param str version: version (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.delete_veto_using_delete_with_http_info(application, reference, target_environment, version, **kwargs) # noqa: E501 else: (data) = self.delete_veto_using_delete_with_http_info(application, reference, target_environment, version, **kwargs) # noqa: E501 return data def delete_veto_using_delete_with_http_info(self, application, reference, target_environment, version, **kwargs): # noqa: E501 """Remove veto of an artifact version in an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.delete_veto_using_delete_with_http_info(application, reference, target_environment, version, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str reference: reference (required) :param str target_environment: targetEnvironment (required) :param str version: version (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['application', 'reference', 'target_environment', 'version'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method delete_veto_using_delete" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `delete_veto_using_delete`") # noqa: E501 # verify the required parameter 'reference' is set if ('reference' not in params or params['reference'] is None): raise ValueError("Missing the required parameter `reference` when calling `delete_veto_using_delete`") # noqa: E501 # verify the required parameter 'target_environment' is set if ('target_environment' not in params or params['target_environment'] is None): raise ValueError("Missing the required parameter `target_environment` when calling `delete_veto_using_delete`") # noqa: E501 # verify the required parameter 'version' is set if ('version' not in params or params['version'] is None): raise ValueError("Missing the required parameter `version` when calling `delete_veto_using_delete`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 if 'reference' in params: path_params['reference'] = params['reference'] # noqa: E501 if 'target_environment' in params: path_params['targetEnvironment'] = params['target_environment'] # noqa: E501 if 'version' in params: path_params['version'] = params['version'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/veto/{targetEnvironment}/{reference}/{version}', 'DELETE', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def diff_manifest_using_post(self, manifest, **kwargs): # noqa: E501 """Ad-hoc validate and diff a config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.diff_manifest_using_post(manifest, async_req=True) >>> result = thread.get() :param async_req bool :param DeliveryConfig manifest: manifest (required) :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.diff_manifest_using_post_with_http_info(manifest, **kwargs) # noqa: E501 else: (data) = self.diff_manifest_using_post_with_http_info(manifest, **kwargs) # noqa: E501 return data def diff_manifest_using_post_with_http_info(self, manifest, **kwargs): # noqa: E501 """Ad-hoc validate and diff a config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.diff_manifest_using_post_with_http_info(manifest, async_req=True) >>> result = thread.get() :param async_req bool :param DeliveryConfig manifest: manifest (required) :return: object If the method is called asynchronously, returns the request thread. """ all_params = ['manifest'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method diff_manifest_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'manifest' is set if ('manifest' not in params or params['manifest'] is None): raise ValueError("Missing the required parameter `manifest` when calling `diff_manifest_using_post`") # noqa: E501 collection_formats = {} path_params = {} query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None if 'manifest' in params: body_params = params['manifest'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json', 'application/x-yaml']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs/diff', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def diff_resource_using_post(self, resource, **kwargs): # noqa: E501 """Ad-hoc validate and diff a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.diff_resource_using_post(resource, async_req=True) >>> result = thread.get() :param async_req bool :param Resource resource: resource (required) :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.diff_resource_using_post_with_http_info(resource, **kwargs) # noqa: E501 else: (data) = self.diff_resource_using_post_with_http_info(resource, **kwargs) # noqa: E501 return data def diff_resource_using_post_with_http_info(self, resource, **kwargs): # noqa: E501 """Ad-hoc validate and diff a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.diff_resource_using_post_with_http_info(resource, async_req=True) >>> result = thread.get() :param async_req bool :param Resource resource: resource (required) :return: object If the method is called asynchronously, returns the request thread. """ all_params = ['resource'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method diff_resource_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'resource' is set if ('resource' not in params or params['resource'] is None): raise ValueError("Missing the required parameter `resource` when calling `diff_resource_using_post`") # noqa: E501 collection_formats = {} path_params = {} query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None if 'resource' in params: body_params = params['resource'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json', 'application/x-yaml']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/diff', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def export_resource_using_get(self, account, cloud_provider, cluster_name, **kwargs): # noqa: E501 """Generates an artifact definition based on the artifact used in a running cluster # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.export_resource_using_get(account, cloud_provider, cluster_name, async_req=True) >>> result = thread.get() :param async_req bool :param str account: account (required) :param str cloud_provider: cloudProvider (required) :param str cluster_name: clusterName (required) :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.export_resource_using_get_with_http_info(account, cloud_provider, cluster_name, **kwargs) # noqa: E501 else: (data) = self.export_resource_using_get_with_http_info(account, cloud_provider, cluster_name, **kwargs) # noqa: E501 return data def export_resource_using_get_with_http_info(self, account, cloud_provider, cluster_name, **kwargs): # noqa: E501 """Generates an artifact definition based on the artifact used in a running cluster # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.export_resource_using_get_with_http_info(account, cloud_provider, cluster_name, async_req=True) >>> result = thread.get() :param async_req bool :param str account: account (required) :param str cloud_provider: cloudProvider (required) :param str cluster_name: clusterName (required) :return: object If the method is called asynchronously, returns the request thread. """ all_params = ['account', 'cloud_provider', 'cluster_name'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method export_resource_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'account' is set if ('account' not in params or params['account'] is None): raise ValueError("Missing the required parameter `account` when calling `export_resource_using_get`") # noqa: E501 # verify the required parameter 'cloud_provider' is set if ('cloud_provider' not in params or params['cloud_provider'] is None): raise ValueError("Missing the required parameter `cloud_provider` when calling `export_resource_using_get`") # noqa: E501 # verify the required parameter 'cluster_name' is set if ('cluster_name' not in params or params['cluster_name'] is None): raise ValueError("Missing the required parameter `cluster_name` when calling `export_resource_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'account' in params: path_params['account'] = params['account'] # noqa: E501 if 'cloud_provider' in params: path_params['cloudProvider'] = params['cloud_provider'] # noqa: E501 if 'cluster_name' in params: path_params['clusterName'] = params['cluster_name'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/export/artifact/{cloudProvider}/{account}/{clusterName}', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def export_resource_using_get1(self, account, cloud_provider, name, service_account, type, **kwargs): # noqa: E501 """Generate a keel resource definition for a deployed cloud resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.export_resource_using_get1(account, cloud_provider, name, service_account, type, async_req=True) >>> result = thread.get() :param async_req bool :param str account: account (required) :param str cloud_provider: cloudProvider (required) :param str name: name (required) :param str service_account: serviceAccount (required) :param str type: type (required) :return: Resource If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.export_resource_using_get1_with_http_info(account, cloud_provider, name, service_account, type, **kwargs) # noqa: E501 else: (data) = self.export_resource_using_get1_with_http_info(account, cloud_provider, name, service_account, type, **kwargs) # noqa: E501 return data def export_resource_using_get1_with_http_info(self, account, cloud_provider, name, service_account, type, **kwargs): # noqa: E501 """Generate a keel resource definition for a deployed cloud resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.export_resource_using_get1_with_http_info(account, cloud_provider, name, service_account, type, async_req=True) >>> result = thread.get() :param async_req bool :param str account: account (required) :param str cloud_provider: cloudProvider (required) :param str name: name (required) :param str service_account: serviceAccount (required) :param str type: type (required) :return: Resource If the method is called asynchronously, returns the request thread. """ all_params = ['account', 'cloud_provider', 'name', 'service_account', 'type'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method export_resource_using_get1" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'account' is set if ('account' not in params or params['account'] is None): raise ValueError("Missing the required parameter `account` when calling `export_resource_using_get1`") # noqa: E501 # verify the required parameter 'cloud_provider' is set if ('cloud_provider' not in params or params['cloud_provider'] is None): raise ValueError("Missing the required parameter `cloud_provider` when calling `export_resource_using_get1`") # noqa: E501 # verify the required parameter 'name' is set if ('name' not in params or params['name'] is None): raise ValueError("Missing the required parameter `name` when calling `export_resource_using_get1`") # noqa: E501 # verify the required parameter 'service_account' is set if ('service_account' not in params or params['service_account'] is None): raise ValueError("Missing the required parameter `service_account` when calling `export_resource_using_get1`") # noqa: E501 # verify the required parameter 'type' is set if ('type' not in params or params['type'] is None): raise ValueError("Missing the required parameter `type` when calling `export_resource_using_get1`") # noqa: E501 collection_formats = {} path_params = {} if 'account' in params: path_params['account'] = params['account'] # noqa: E501 if 'cloud_provider' in params: path_params['cloudProvider'] = params['cloud_provider'] # noqa: E501 if 'name' in params: path_params['name'] = params['name'] # noqa: E501 if 'type' in params: path_params['type'] = params['type'] # noqa: E501 query_params = [] if 'service_account' in params: query_params.append(('serviceAccount', params['service_account'])) # noqa: E501 header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/export/{cloudProvider}/{account}/{type}/{name}', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='Resource', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_application_details_using_get(self, application, **kwargs): # noqa: E501 """Get managed details about an application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_application_details_using_get(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param list[str] entities: entities :param bool include_details: includeDetails :param int max_artifact_versions: maxArtifactVersions :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_application_details_using_get_with_http_info(application, **kwargs) # noqa: E501 else: (data) = self.get_application_details_using_get_with_http_info(application, **kwargs) # noqa: E501 return data def get_application_details_using_get_with_http_info(self, application, **kwargs): # noqa: E501 """Get managed details about an application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_application_details_using_get_with_http_info(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param list[str] entities: entities :param bool include_details: includeDetails :param int max_artifact_versions: maxArtifactVersions :return: object If the method is called asynchronously, returns the request thread. """ all_params = ['application', 'entities', 'include_details', 'max_artifact_versions'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_application_details_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `get_application_details_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 query_params = [] if 'entities' in params: query_params.append(('entities', params['entities'])) # noqa: E501 collection_formats['entities'] = 'multi' # noqa: E501 if 'include_details' in params: query_params.append(('includeDetails', params['include_details'])) # noqa: E501 if 'max_artifact_versions' in params: query_params.append(('maxArtifactVersions', params['max_artifact_versions'])) # noqa: E501 header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_config_by_using_get(self, application, **kwargs): # noqa: E501 """Get the delivery config associated with an application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_config_by_using_get(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_config_by_using_get_with_http_info(application, **kwargs) # noqa: E501 else: (data) = self.get_config_by_using_get_with_http_info(application, **kwargs) # noqa: E501 return data def get_config_by_using_get_with_http_info(self, application, **kwargs): # noqa: E501 """Get the delivery config associated with an application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_config_by_using_get_with_http_info(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ all_params = ['application'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_config_by_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `get_config_by_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/config', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='DeliveryConfig', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_constraint_state_using_get(self, application, environment, **kwargs): # noqa: E501 """List up-to {limit} current constraint states for an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_constraint_state_using_get(application, environment, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str environment: environment (required) :param str limit: limit :return: ConstraintState If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_constraint_state_using_get_with_http_info(application, environment, **kwargs) # noqa: E501 else: (data) = self.get_constraint_state_using_get_with_http_info(application, environment, **kwargs) # noqa: E501 return data def get_constraint_state_using_get_with_http_info(self, application, environment, **kwargs): # noqa: E501 """List up-to {limit} current constraint states for an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_constraint_state_using_get_with_http_info(application, environment, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str environment: environment (required) :param str limit: limit :return: ConstraintState If the method is called asynchronously, returns the request thread. """ all_params = ['application', 'environment', 'limit'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_constraint_state_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `get_constraint_state_using_get`") # noqa: E501 # verify the required parameter 'environment' is set if ('environment' not in params or params['environment'] is None): raise ValueError("Missing the required parameter `environment` when calling `get_constraint_state_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 if 'environment' in params: path_params['environment'] = params['environment'] # noqa: E501 query_params = [] if 'limit' in params: query_params.append(('limit', params['limit'])) # noqa: E501 header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/environment/{environment}/constraints', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='ConstraintState', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_manifest_artifacts_using_get(self, name, **kwargs): # noqa: E501 """Get the status of each version of each artifact in each environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_manifest_artifacts_using_get(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: list[object] If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_manifest_artifacts_using_get_with_http_info(name, **kwargs) # noqa: E501 else: (data) = self.get_manifest_artifacts_using_get_with_http_info(name, **kwargs) # noqa: E501 return data def get_manifest_artifacts_using_get_with_http_info(self, name, **kwargs): # noqa: E501 """Get the status of each version of each artifact in each environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_manifest_artifacts_using_get_with_http_info(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: list[object] If the method is called asynchronously, returns the request thread. """ all_params = ['name'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_manifest_artifacts_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'name' is set if ('name' not in params or params['name'] is None): raise ValueError("Missing the required parameter `name` when calling `get_manifest_artifacts_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'name' in params: path_params['name'] = params['name'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs/{name}/artifacts', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='list[object]', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_manifest_using_get(self, name, **kwargs): # noqa: E501 """Get a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_manifest_using_get(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_manifest_using_get_with_http_info(name, **kwargs) # noqa: E501 else: (data) = self.get_manifest_using_get_with_http_info(name, **kwargs) # noqa: E501 return data def get_manifest_using_get_with_http_info(self, name, **kwargs): # noqa: E501 """Get a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_manifest_using_get_with_http_info(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ all_params = ['name'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_manifest_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'name' is set if ('name' not in params or params['name'] is None): raise ValueError("Missing the required parameter `name` when calling `get_manifest_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'name' in params: path_params['name'] = params['name'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs/{name}', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='DeliveryConfig', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_manifest_yaml_using_get(self, name, **kwargs): # noqa: E501 """Get a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_manifest_yaml_using_get(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_manifest_yaml_using_get_with_http_info(name, **kwargs) # noqa: E501 else: (data) = self.get_manifest_yaml_using_get_with_http_info(name, **kwargs) # noqa: E501 return data def get_manifest_yaml_using_get_with_http_info(self, name, **kwargs): # noqa: E501 """Get a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_manifest_yaml_using_get_with_http_info(name, async_req=True) >>> result = thread.get() :param async_req bool :param str name: name (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ all_params = ['name'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_manifest_yaml_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'name' is set if ('name' not in params or params['name'] is None): raise ValueError("Missing the required parameter `name` when calling `get_manifest_yaml_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'name' in params: path_params['name'] = params['name'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/x-yaml']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs/{name}.yml', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='DeliveryConfig', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_resource_status_using_get(self, resource_id, **kwargs): # noqa: E501 """Get status of a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_status_using_get(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_resource_status_using_get_with_http_info(resource_id, **kwargs) # noqa: E501 else: (data) = self.get_resource_status_using_get_with_http_info(resource_id, **kwargs) # noqa: E501 return data def get_resource_status_using_get_with_http_info(self, resource_id, **kwargs): # noqa: E501 """Get status of a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_status_using_get_with_http_info(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: object If the method is called asynchronously, returns the request thread. """ all_params = ['resource_id'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_resource_status_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'resource_id' is set if ('resource_id' not in params or params['resource_id'] is None): raise ValueError("Missing the required parameter `resource_id` when calling `get_resource_status_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'resource_id' in params: path_params['resourceId'] = params['resource_id'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/{resourceId}/status', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_resource_using_get(self, resource_id, **kwargs): # noqa: E501 """Get a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_using_get(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: Resource If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_resource_using_get_with_http_info(resource_id, **kwargs) # noqa: E501 else: (data) = self.get_resource_using_get_with_http_info(resource_id, **kwargs) # noqa: E501 return data def get_resource_using_get_with_http_info(self, resource_id, **kwargs): # noqa: E501 """Get a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_using_get_with_http_info(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: Resource If the method is called asynchronously, returns the request thread. """ all_params = ['resource_id'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_resource_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'resource_id' is set if ('resource_id' not in params or params['resource_id'] is None): raise ValueError("Missing the required parameter `resource_id` when calling `get_resource_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'resource_id' in params: path_params['resourceId'] = params['resource_id'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/{resourceId}', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='Resource', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def get_resource_yaml_using_get(self, resource_id, **kwargs): # noqa: E501 """Get a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_yaml_using_get(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: Resource If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.get_resource_yaml_using_get_with_http_info(resource_id, **kwargs) # noqa: E501 else: (data) = self.get_resource_yaml_using_get_with_http_info(resource_id, **kwargs) # noqa: E501 return data def get_resource_yaml_using_get_with_http_info(self, resource_id, **kwargs): # noqa: E501 """Get a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.get_resource_yaml_using_get_with_http_info(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: Resource If the method is called asynchronously, returns the request thread. """ all_params = ['resource_id'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method get_resource_yaml_using_get" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'resource_id' is set if ('resource_id' not in params or params['resource_id'] is None): raise ValueError("Missing the required parameter `resource_id` when calling `get_resource_yaml_using_get`") # noqa: E501 collection_formats = {} path_params = {} if 'resource_id' in params: path_params['resourceId'] = params['resource_id'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/x-yaml']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/{resourceId}.yml', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='Resource', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def pause_application_using_post(self, application, **kwargs): # noqa: E501 """Pause management of an entire application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.pause_application_using_post(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.pause_application_using_post_with_http_info(application, **kwargs) # noqa: E501 else: (data) = self.pause_application_using_post_with_http_info(application, **kwargs) # noqa: E501 return data def pause_application_using_post_with_http_info(self, application, **kwargs): # noqa: E501 """Pause management of an entire application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.pause_application_using_post_with_http_info(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['application'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method pause_application_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `pause_application_using_post`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/pause', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def pause_resource_using_post(self, resource_id, **kwargs): # noqa: E501 """Pause management of a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.pause_resource_using_post(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.pause_resource_using_post_with_http_info(resource_id, **kwargs) # noqa: E501 else: (data) = self.pause_resource_using_post_with_http_info(resource_id, **kwargs) # noqa: E501 return data def pause_resource_using_post_with_http_info(self, resource_id, **kwargs): # noqa: E501 """Pause management of a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.pause_resource_using_post_with_http_info(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['resource_id'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method pause_resource_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'resource_id' is set if ('resource_id' not in params or params['resource_id'] is None): raise ValueError("Missing the required parameter `resource_id` when calling `pause_resource_using_post`") # noqa: E501 collection_formats = {} path_params = {} if 'resource_id' in params: path_params['resourceId'] = params['resource_id'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/{resourceId}/pause', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def resume_application_using_delete(self, application, **kwargs): # noqa: E501 """Resume management of an entire application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.resume_application_using_delete(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.resume_application_using_delete_with_http_info(application, **kwargs) # noqa: E501 else: (data) = self.resume_application_using_delete_with_http_info(application, **kwargs) # noqa: E501 return data def resume_application_using_delete_with_http_info(self, application, **kwargs): # noqa: E501 """Resume management of an entire application # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.resume_application_using_delete_with_http_info(application, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['application'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method resume_application_using_delete" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `resume_application_using_delete`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/pause', 'DELETE', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def resume_resource_using_delete(self, resource_id, **kwargs): # noqa: E501 """Resume management of a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.resume_resource_using_delete(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.resume_resource_using_delete_with_http_info(resource_id, **kwargs) # noqa: E501 else: (data) = self.resume_resource_using_delete_with_http_info(resource_id, **kwargs) # noqa: E501 return data def resume_resource_using_delete_with_http_info(self, resource_id, **kwargs): # noqa: E501 """Resume management of a resource # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.resume_resource_using_delete_with_http_info(resource_id, async_req=True) >>> result = thread.get() :param async_req bool :param str resource_id: resourceId (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['resource_id'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method resume_resource_using_delete" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'resource_id' is set if ('resource_id' not in params or params['resource_id'] is None): raise ValueError("Missing the required parameter `resource_id` when calling `resume_resource_using_delete`") # noqa: E501 collection_formats = {} path_params = {} if 'resource_id' in params: path_params['resourceId'] = params['resource_id'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/resources/{resourceId}/pause', 'DELETE', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def schema_using_get(self, **kwargs): # noqa: E501 """Ad-hoc validate and diff a config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.schema_using_get(async_req=True) >>> result = thread.get() :param async_req bool :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.schema_using_get_with_http_info(**kwargs) # noqa: E501 else: (data) = self.schema_using_get_with_http_info(**kwargs) # noqa: E501 return data def schema_using_get_with_http_info(self, **kwargs): # noqa: E501 """Ad-hoc validate and diff a config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.schema_using_get_with_http_info(async_req=True) >>> result = thread.get() :param async_req bool :return: object If the method is called asynchronously, returns the request thread. """ all_params = [] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method schema_using_get" % key ) params[key] = val del params['kwargs'] collection_formats = {} path_params = {} query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json', 'application/x-yaml']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs/schema', 'GET', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def update_constraint_status_using_post(self, application, environment, status, **kwargs): # noqa: E501 """Update the status of an environment constraint # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.update_constraint_status_using_post(application, environment, status, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str environment: environment (required) :param ConstraintStatus status: status (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.update_constraint_status_using_post_with_http_info(application, environment, status, **kwargs) # noqa: E501 else: (data) = self.update_constraint_status_using_post_with_http_info(application, environment, status, **kwargs) # noqa: E501 return data def update_constraint_status_using_post_with_http_info(self, application, environment, status, **kwargs): # noqa: E501 """Update the status of an environment constraint # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.update_constraint_status_using_post_with_http_info(application, environment, status, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param str environment: environment (required) :param ConstraintStatus status: status (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['application', 'environment', 'status'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method update_constraint_status_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `update_constraint_status_using_post`") # noqa: E501 # verify the required parameter 'environment' is set if ('environment' not in params or params['environment'] is None): raise ValueError("Missing the required parameter `environment` when calling `update_constraint_status_using_post`") # noqa: E501 # verify the required parameter 'status' is set if ('status' not in params or params['status'] is None): raise ValueError("Missing the required parameter `status` when calling `update_constraint_status_using_post`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 if 'environment' in params: path_params['environment'] = params['environment'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None if 'status' in params: body_params = params['status'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/environment/{environment}/constraint', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def upsert_manifest_using_post(self, manifest, **kwargs): # noqa: E501 """Create or update a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.upsert_manifest_using_post(manifest, async_req=True) >>> result = thread.get() :param async_req bool :param DeliveryConfig manifest: manifest (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.upsert_manifest_using_post_with_http_info(manifest, **kwargs) # noqa: E501 else: (data) = self.upsert_manifest_using_post_with_http_info(manifest, **kwargs) # noqa: E501 return data def upsert_manifest_using_post_with_http_info(self, manifest, **kwargs): # noqa: E501 """Create or update a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.upsert_manifest_using_post_with_http_info(manifest, async_req=True) >>> result = thread.get() :param async_req bool :param DeliveryConfig manifest: manifest (required) :return: DeliveryConfig If the method is called asynchronously, returns the request thread. """ all_params = ['manifest'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method upsert_manifest_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'manifest' is set if ('manifest' not in params or params['manifest'] is None): raise ValueError("Missing the required parameter `manifest` when calling `upsert_manifest_using_post`") # noqa: E501 collection_formats = {} path_params = {} query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None if 'manifest' in params: body_params = params['manifest'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json', 'application/x-yaml']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='DeliveryConfig', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def validate_manifest_using_post(self, manifest, **kwargs): # noqa: E501 """Validate a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.validate_manifest_using_post(manifest, async_req=True) >>> result = thread.get() :param async_req bool :param DeliveryConfig manifest: manifest (required) :return: object If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.validate_manifest_using_post_with_http_info(manifest, **kwargs) # noqa: E501 else: (data) = self.validate_manifest_using_post_with_http_info(manifest, **kwargs) # noqa: E501 return data def validate_manifest_using_post_with_http_info(self, manifest, **kwargs): # noqa: E501 """Validate a delivery config manifest # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.validate_manifest_using_post_with_http_info(manifest, async_req=True) >>> result = thread.get() :param async_req bool :param DeliveryConfig manifest: manifest (required) :return: object If the method is called asynchronously, returns the request thread. """ all_params = ['manifest'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method validate_manifest_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'manifest' is set if ('manifest' not in params or params['manifest'] is None): raise ValueError("Missing the required parameter `manifest` when calling `validate_manifest_using_post`") # noqa: E501 collection_formats = {} path_params = {} query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None if 'manifest' in params: body_params = params['manifest'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['application/json', 'application/x-yaml']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json', 'application/x-yaml']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/delivery-configs/validate', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type='object', # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats) def veto_using_post(self, application, veto, **kwargs): # noqa: E501 """Veto an artifact version in an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.veto_using_post(application, veto, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param EnvironmentArtifactVeto veto: veto (required) :return: None If the method is called asynchronously, returns the request thread. """ kwargs['_return_http_data_only'] = True if kwargs.get('async_req'): return self.veto_using_post_with_http_info(application, veto, **kwargs) # noqa: E501 else: (data) = self.veto_using_post_with_http_info(application, veto, **kwargs) # noqa: E501 return data def veto_using_post_with_http_info(self, application, veto, **kwargs): # noqa: E501 """Veto an artifact version in an environment # noqa: E501 This method makes a synchronous HTTP request by default. To make an asynchronous HTTP request, please pass async_req=True >>> thread = api.veto_using_post_with_http_info(application, veto, async_req=True) >>> result = thread.get() :param async_req bool :param str application: application (required) :param EnvironmentArtifactVeto veto: veto (required) :return: None If the method is called asynchronously, returns the request thread. """ all_params = ['application', 'veto'] # noqa: E501 all_params.append('async_req') all_params.append('_return_http_data_only') all_params.append('_preload_content') all_params.append('_request_timeout') params = locals() for key, val in six.iteritems(params['kwargs']): if key not in all_params: raise TypeError( "Got an unexpected keyword argument '%s'" " to method veto_using_post" % key ) params[key] = val del params['kwargs'] # verify the required parameter 'application' is set if ('application' not in params or params['application'] is None): raise ValueError("Missing the required parameter `application` when calling `veto_using_post`") # noqa: E501 # verify the required parameter 'veto' is set if ('veto' not in params or params['veto'] is None): raise ValueError("Missing the required parameter `veto` when calling `veto_using_post`") # noqa: E501 collection_formats = {} path_params = {} if 'application' in params: path_params['application'] = params['application'] # noqa: E501 query_params = [] header_params = {} form_params = [] local_var_files = {} body_params = None if 'veto' in params: body_params = params['veto'] # HTTP header `Accept` header_params['Accept'] = self.api_client.select_header_accept( ['*/*']) # noqa: E501 # HTTP header `Content-Type` header_params['Content-Type'] = self.api_client.select_header_content_type( # noqa: E501 ['application/json']) # noqa: E501 # Authentication setting auth_settings = [] # noqa: E501 return self.api_client.call_api( '/managed/application/{application}/veto', 'POST', path_params, query_params, header_params, body=body_params, post_params=form_params, files=local_var_files, response_type=None, # noqa: E501 auth_settings=auth_settings, async_req=params.get('async_req'), _return_http_data_only=params.get('_return_http_data_only'), _preload_content=params.get('_preload_content', True), _request_timeout=params.get('_request_timeout'), collection_formats=collection_formats)

41.052302

241

0.618705

12,520

111,457

5.243211

0.01885

0.045091

0.023033

0.029614

0.976007

0.962983

0.957773

0.949882

0.937787

0.930703

0

0.014343

0.292498

111,457

2,714

242

41.067428

0.818124

0.308989

0

0.803571

1

0

0.205969

0.067078

0

1

0.036376

false

0

0.002646

0

0.093254

0

null

0

1

0

1

0

null

0

8

f1df8053418b6841f30010f930acd0355c35ed52

793

py

Python

tests/test_regex.py

eBay/wextracto

9c789b1c98d95a1e87dbedfd1541a8688d128f5c

[ "BSD-3-Clause" ]

19

2015-01-07T01:13:18.000Z

2020-07-31T04:51:39.000Z

tests/test_regex.py

afcarl/wextracto

9c789b1c98d95a1e87dbedfd1541a8688d128f5c

[ "BSD-3-Clause" ]

2

2017-02-02T17:14:14.000Z

2018-05-02T23:19:36.000Z

tests/test_regex.py

gilessbrown/wextracto

7215b90a7c022c50cbef9a1e7a67e2fb48432b47

[ "BSD-3-Clause" ]

13

2015-07-21T20:29:19.000Z

2021-01-15T10:36:26.000Z

from wex import regex as r def test_regroup(): f = r.re_group('(\d+)') | list assert f('a1 b23') == ['1', '23'] def test_regroup_iterable(): f = r.re_group('(\d+)') | list assert f(['a1 b23']) == ['1', '23'] def test_regroup_nested_iterable(): f = r.re_group('(\d+)') | list assert f([['a1 b23'], 'c3']) == ['1', '23', '3'] def test_re_groupdict(): f = r.re_groupdict('(?P<num>\d+)') | list assert f('a1 b23') == [{'num': '1'}, {'num': '23'}] def test_re_groupdict_iterable(): f = r.re_groupdict('(?P<num>\d+)') | list assert f(['a1 b23']) == [{'num': '1'}, {'num': '23'}] def test_re_groupdict_nested_iterable(): f = r.re_groupdict('(?P<num>\d+)') | list assert f([['a1 b23'], 'c3']) == [{'num': '1'}, {'num': '23'}, {'num': '3'}]

24.030303

79

0.513241

122

793

3.163934

0.213115

0.108808

0.062176

0.186529

0.818653

0.787565

0.777202

0

0.062794

0.196721

793

32

80

24.78125

0.543171

0

0.315789

0

0.166667

0

0.315789

1

0.315789

false

0

0.052632

0

0.368421

0

null

0

1

0

null

0

1

0

8

f1e3d423ac41fc4db5503d01f312d6bead824233

4,510

py

Python

pyqt_style_setter/styleSetter.py

yjg30737/pyqt_style_setter

2d3db7fd7ed71dd4b2644c868029f9913841b648

[ "MIT" ]

null

pyqt_style_setter/styleSetter.py

yjg30737/pyqt_style_setter

2d3db7fd7ed71dd4b2644c868029f9913841b648

[ "MIT" ]

null

pyqt_style_setter/styleSetter.py

yjg30737/pyqt_style_setter

2d3db7fd7ed71dd4b2644c868029f9913841b648

[ "MIT" ]

null

from PyQt5.QtWidgets import QWidget, QAbstractButton, QMainWindow, QDialog from pyqt_dark_gray_theme import darkGrayTheme # from pyqt_light_gray_theme import lightGrayTheme from pyqt_svg_button import SvgButton class StyleSetter: @staticmethod def setWindowStyle(main_window: QWidget, theme: str = 'dark', exclude_type_lst: list = []): if theme == 'dark': theme_style = darkGrayTheme.getThemeStyle() if isinstance(main_window, QMainWindow) or isinstance(main_window, QDialog): main_window.setStyleSheet(theme_style) else: main_window.setObjectName('mainWidget') main_window.setStyleSheet(theme_style + darkGrayTheme.getMainWidgetStyle()) # button def setButtonStyle(main_window): btns = main_window.findChildren(QAbstractButton) for btn in btns: # check if text exists if btn.text().strip() == '': # if button type is SvgButton, let it maintain its own style if isinstance(btn, SvgButton): pass else: btn.setStyleSheet(darkGrayTheme.getIconButtonStyle()) # no text - icon button style else: # if button type is SvgButton, let it maintain its own style if isinstance(btn, SvgButton): pass else: btn.setStyleSheet(darkGrayTheme.getIconTextButtonStyle()) # text - icon-text button style # check exclusion of QAbstractButton if QAbstractButton in exclude_type_lst: pass else: setButtonStyle(main_window) # todo check exclusion of other types if len(exclude_type_lst) > 0: for _type in exclude_type_lst: widgets = main_window.findChildren(_type) if isinstance(_type, QAbstractButton): print(_type) if isinstance(main_window, QMainWindow): menu_bar = main_window.menuBar() # menu bar menu_bar_style = darkGrayTheme.getMenuBarStyle(menu_bar) menu_bar.setStyleSheet(menu_bar_style) # i will be working on this light_code = ''' elif theme == 'light': theme_style = lightGrayTheme.getThemeStyle() if isinstance(main_window, QMainWindow) or isinstance(main_window, QDialog): main_window.setStyleSheet(theme_style) else: main_window.setObjectName('mainWidget') main_window.setStyleSheet(theme_style + lightGrayTheme.getMainWidgetStyle()) # button def setButtonStyle(main_window): btns = main_window.findChildren(QAbstractButton) for btn in btns: # check if text exists if btn.text().strip() == '': # if button type is SvgButton, let it maintain its own style if isinstance(btn, SvgButton): pass else: btn.setStyleSheet(lightGrayTheme.getIconButtonStyle()) # no text - icon button style else: # if button type is SvgButton, let it maintain its own style if isinstance(btn, SvgButton): pass else: btn.setStyleSheet(lightGrayTheme.getIconTextButtonStyle()) # text - icon-text button style # check exclusion of QAbstractButton if QAbstractButton in exclude_type_lst: pass else: setButtonStyle(main_window) # todo check exclusion of other types if len(exclude_type_lst) > 0: for _type in exclude_type_lst: widgets = main_window.findChildren(_type) if isinstance(_type, QAbstractButton): print(_type) if isinstance(main_window, QMainWindow): menu_bar = main_window.menuBar() # menu bar menu_bar_style = lightGrayTheme.getMenuBarStyle(menu_bar) menu_bar.setStyleSheet(menu_bar_style) '''

45.1

119

0.549667

407

4,510

5.909091

0.201474

0.095634

0.040748

0.03659

0.823285

0.778378

0

0.00109

0.3898

4,510

99

120

45.555556

0.87282

0.079379

0

0.675

0

0.50157

0.146895

0

0.010101

0

1

0.025

false

0.075

0.0375

0

0.075

0.025

0

null

0

1

0

null

0

1

0

1

0

8

7b0c1116beb8727670c7fdc2ea16e32c8d70e520

183

py

Python

crowdstrikeclient/_CrowdstrikeIoC.py

pyperanger/crowdstrike-client

43e2067c2573834eae9baa35f5b4b78b4cda97be

[ "MIT" ]

null

crowdstrikeclient/_CrowdstrikeIoC.py

pyperanger/crowdstrike-client

43e2067c2573834eae9baa35f5b4b78b4cda97be

[ "MIT" ]

null

crowdstrikeclient/_CrowdstrikeIoC.py

pyperanger/crowdstrike-client

43e2067c2573834eae9baa35f5b4b78b4cda97be

[ "MIT" ]

null

import json # Ioc def IndicatorsQueriesDevices(self, payload): '''/indicators/queries/devices/v1''' return json.loads(self.GetAPI("indicators/queries/devices/v1?"+payload))

22.875

76

0.737705

21

183

6.428571

0.666667

0.251852

0.355556

0.385185

0

0.01227

0.10929

183

7

77

26.142857

0.815951

0.191257

0

0.212766

0

1

0.333333

false

0

0.333333

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

8

7b1be11b404e94fa96891a66167e79680bc2536d

10,269

py

Python

tests/unit_tests/olio/test_olio_write_data.py

poc11/resqpy

5dfbfb924f8ee9b2712fb8e38bff96ee8ee9d8e2

[ "MIT" ]

35

2021-05-24T17:43:55.000Z

2022-03-15T15:47:59.000Z

tests/unit_tests/olio/test_olio_write_data.py

poc11/resqpy

5dfbfb924f8ee9b2712fb8e38bff96ee8ee9d8e2

[ "MIT" ]

355

2021-05-24T16:28:16.000Z

2022-03-14T14:43:40.000Z

tests/unit_tests/olio/test_olio_write_data.py

poc11/resqpy

5dfbfb924f8ee9b2712fb8e38bff96ee8ee9d8e2

[ "MIT" ]

12

2021-06-02T09:50:46.000Z

2022-03-02T20:29:56.000Z

import numpy as np import pytest import resqpy.olio.write_data as wd from pytest_mock import MockerFixture def test_write_pure_binary_data(mocker: MockerFixture, caplog): # Arrange test_array = np.array([[[0, 0], [0, 0]], [[0, 0], [0, 0]]]) open_mock = mocker.mock_open() fileno_mock = mocker.Mock(return_value = 1, name = 'fileno_mock') open_mock.return_value.fileno = fileno_mock mocker.patch("builtins.open", open_mock) expected_calls = [mocker.call('test', 'wb'), mocker.call().__enter__()] # Act wd.write_pure_binary_data('test', test_array) # Assert open_mock.assert_has_calls(expected_calls) assert 'Binary data file test created' in caplog.text def test_write_array_to_ascii_file_decimals_equal_0(mocker: MockerFixture): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[0, 0], [0, 0]], [[0, 0], [0, 0]]]) open_mock = mocker.mock_open() mocker.patch("builtins.open", open_mock) expected_calls = [ mocker.call('test', 'w'), mocker.call().__enter__(), mocker.call().write('! Data written by write_array_to_ascii_file() python function\n'), mocker.call().write('! Extent of array is: [2, 2, 2]\n'), mocker.call().write('! Maximum 20 data items per line\n'), mocker.call().write('\n'), mocker.call().write('0'), mocker.call().write('\t'), mocker.call().write('0'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0'), mocker.call().write('\t'), mocker.call().write('0'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0'), mocker.call().write('\t'), mocker.call().write('0'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0'), mocker.call().write('\t'), mocker.call().write('0'), mocker.call().write('\n'), mocker.call().__exit__(None, None, None) ] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, decimals = 0) # Assert open_mock.assert_has_calls(expected_calls) def test_write_array_to_ascii_file_binary(mocker: MockerFixture, caplog): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[0, 0], [0, 0]], [[0, 0], [0, 0]]]) open_mock = mocker.mock_open() fileno_mock = mocker.Mock(return_value = 1, name = 'fileno_mock') open_mock.return_value.fileno = fileno_mock mocker.patch("builtins.open", open_mock) expected_calls = [mocker.call('test.db', 'wb'), mocker.call().__enter__()] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, use_binary = True, binary_only = True) # Assert open_mock.assert_has_calls(expected_calls) assert 'Failed to write data to binary file test' not in caplog.text def test_write_array_to_ascii_file_no_headers(mocker: MockerFixture): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[0, 0], [0, 0]], [[0, 0], [0, 0]]]) open_mock = mocker.mock_open() mocker.patch("builtins.open", open_mock) unexpected_calls = [ mocker.call().write('! Data written by write_array_to_ascii_file() python function\n'), mocker.call().write('! Extent of array is: [2, 2, 2]\n'), mocker.call().write('! Maximum 20 data items per line\n') ] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, headers = False) # Assert assert unexpected_calls not in open_mock.mock_calls def test_write_array_to_ascii_file_bool(mocker: MockerFixture): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[0, 1], [0, 0]], [[1, 0], [1, 0]]]) open_mock = mocker.mock_open() mocker.patch("builtins.open", open_mock) expected_calls = [ mocker.call('test', 'w'), mocker.call().__enter__(), mocker.call().write('! Data written by write_array_to_ascii_file() python function\n'), mocker.call().write('! Extent of array is: [2, 2, 2]\n'), mocker.call().write('! Maximum 20 data items per line\n'), mocker.call().write('\n'), mocker.call().write('0'), mocker.call().write('\t'), mocker.call().write('1'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0'), mocker.call().write('\t'), mocker.call().write('0'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('1'), mocker.call().write('\t'), mocker.call().write('0'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('1'), mocker.call().write('\t'), mocker.call().write('0'), mocker.call().write('\n'), mocker.call().__exit__(None, None, None) ] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, data_type = 'bool') # Assert open_mock.assert_has_calls(expected_calls) def test_write_array_to_ascii_file_append(mocker: MockerFixture): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[0, 0], [0, 0]], [[0, 0], [0, 0]]]) open_mock = mocker.mock_open() mocker.patch("builtins.open", open_mock) expected_calls = [mocker.call('test', 'a')] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, append = True) # Assert open_mock.assert_has_calls(expected_calls) def test_write_array_to_ascii_file_space_separated(mocker: MockerFixture): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[0, 0], [0, 0]], [[0, 0], [0, 0]]]) open_mock = mocker.mock_open() mocker.patch("builtins.open", open_mock) expected_calls = [ mocker.call('test', 'w'), mocker.call().__enter__(), mocker.call().write('! Data written by write_array_to_ascii_file() python function\n'), mocker.call().write('! Extent of array is: [2, 2, 2]\n'), mocker.call().write('! Maximum 20 data items per line\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write(' '), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write(' '), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write(' '), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write(' '), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().__exit__(None, None, None) ] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, space_separated = True) # Assert open_mock.assert_has_calls(expected_calls) def test_write_array_to_ascii_file_nan_substitute(mocker: MockerFixture): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[1, np.nan], [3, 2]], [[1, 5], [np.nan, np.nan]]]) open_mock = mocker.mock_open() mocker.patch("builtins.open", open_mock) expected_calls = [ mocker.call('test', 'w'), mocker.call().__enter__(), mocker.call().write('! Data written by write_array_to_ascii_file() python function\n'), mocker.call().write('! Extent of array is: [2, 2, 2]\n'), mocker.call().write('! Maximum 20 data items per line\n'), mocker.call().write('\n'), mocker.call().write('1.000'), mocker.call().write('\t'), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('3.000'), mocker.call().write('\t'), mocker.call().write('2.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('1.000'), mocker.call().write('\t'), mocker.call().write('5.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write('\t'), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().__exit__(None, None, None) ] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, nan_substitute_value = 0) # Assert open_mock.assert_has_calls(expected_calls) def test_write_array_to_ascii_file_blank_line_after_j_block(mocker: MockerFixture): # Arrange test_extent = np.array([2, 2, 2]) test_array = np.array([[[0, 0], [0, 0]], [[0, 0], [0, 0]]]) open_mock = mocker.mock_open() mocker.patch("builtins.open", open_mock) expected_calls = [ mocker.call('test', 'w'), mocker.call().__enter__(), mocker.call().write('! Data written by write_array_to_ascii_file() python function\n'), mocker.call().write('! Extent of array is: [2, 2, 2]\n'), mocker.call().write('! Maximum 20 data items per line\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write('\t'), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write('\t'), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write('\t'), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().write('0.000'), mocker.call().write('\t'), mocker.call().write('0.000'), mocker.call().write('\n'), mocker.call().write('\n'), mocker.call().__exit__(None, None, None) ] # Act wd.write_array_to_ascii_file('test', test_extent, test_array, blank_line_after_j_block = True) # Assert open_mock.assert_has_calls(expected_calls)

35.65625

104

0.588275

1,395

10,269

4.117563

0.063799

0.243733

0.31337

0.150418

0.921135

0.904248

0.896414

0.884749

0.859854

0

0.029773

0.215016

10,269

287

105

35.780488

0.682794

0.016555

0

0.815315

0

0.131963

0.016086

0

0.04955

1

0.040541

false

0

0.018018

0

0.058559

0

null

1

0

1

0

1

0

null

0

9

7b58517e89a86a814d343814becc6536570ba0b7

10,563

py

Python

cifar10/utils_data.py

phymhan/essl

23a4bfb1ef1e298cea7a2a392097a1097863d8ac

[ "MIT" ]

null

cifar10/utils_data.py

phymhan/essl

23a4bfb1ef1e298cea7a2a392097a1097863d8ac

[ "MIT" ]

null

cifar10/utils_data.py

phymhan/essl

23a4bfb1ef1e298cea7a2a392097a1097863d8ac

[ "MIT" ]

null

import os import pickle import numpy as np import torch import torchvision import torchvision.transforms as T import torchvision.transforms.functional as TF # from torch.utils.data.dataset import Subset # from torchvision.transforms import (CenterCrop, Compose, RandomHorizontalFlip, Resize, ToTensor) import pdb st = pdb.set_trace class MultiViewDataset(torch.utils.data.Dataset): def __init__( self, data_path='data.pkl', latent_path='latent.pkl', view_paths=['view.pkl'], transform0=None, transform1=None, transform2=None, transform3=None, n_views=1, train=True, subset_index=None, sample_from_mixed=False, sample_original=False, n_cache=8, uint8=False, ): """ images: [x0, x1, x2, x3, ...] x0, x1 are two expert views x2 are rotation views reserved for essl x3 and after are for (cached) GAN generated views returns: (images, latents, labels) """ # self.data_transform = lambda x: (x + 1) / 2 # NOTE: to [0, 1] self.transform0 = transform0 self.transform1 = transform1 self.transform2 = transform2 self.transform3 = transform3 self.uint8 = uint8 # load data assert os.path.exists(data_path), f'data_path {data_path} does not exist' with open(data_path, 'rb') as f: data = pickle.load(f) # load latent assert os.path.exists(latent_path), f'latent_path {latent_path} does not exist' with open(latent_path, 'rb') as f: latents = pickle.load(f) if subset_index is None: if 'index' in data: subset_index = data['index']['train'] if train else data['index']['test'] else: subset_index = np.arange(len(data['images'])) self.data = { 'images': data['images'][subset_index], 'labels': torch.tensor(data['labels'])[subset_index], 'latents': latents['latents'][subset_index], } # load views if isinstance(view_paths, str): view_paths = [view_paths] views = [] for view_path in view_paths: assert os.path.exists(view_path), f'view_path {view_path} does not exist' with open(view_path, 'rb') as f: view = pickle.load(f) views.append(view['views'][:n_cache, subset_index]) # NOTE: original data is view_0 (this is convenient if we want to sample from mixed pool) self.views = torch.cat([self.data['images'].unsqueeze(0)] + views, dim=0) self.total_views = self.views.shape[0] # NOTE: including original data view_0 self.n_views = n_views # NOTE: number of generated views to sample self.n_cache = n_cache assert sample_original or self.n_views <= self.total_views - int(not sample_from_mixed) self.sample_from_mixed = sample_from_mixed self.sample_original = sample_original self.dataset_len = len(subset_index) # def data_transform(self, image_tensor): # image_tensor = (image_tensor + 1) / 2 # return image_tensor def data_transform(self, image_tensor): if self.uint8: image_tensor = TF.to_tensor(image_tensor) else: image_tensor = (image_tensor + 1) / 2 return image_tensor def __getitem__(self, index): # view_0 img0 = self.data_transform(self.data['images'][index]) if self.transform0 is not None: img0 = self.transform0(img0) # view_1 img1 = self.data_transform(self.data['images'][index]) if self.transform1 is not None: img1 = self.transform1(img1) # view_2 img2 = self.data_transform(self.data['images'][index]) if self.transform2 is not None: img2 = self.transform2(img2) # view_3 and ... views = [] if self.sample_original: inds = [0] * self.n_views else: if self.sample_from_mixed: inds = list(np.random.choice(np.arange(0, self.total_views), size=self.n_views, replace=False)) else: inds = list(np.random.choice(np.arange(1, self.total_views), size=self.n_views, replace=False)) for i in inds: img = self.data_transform(self.views[i, index]) if self.transform3 is not None: img = self.transform3(img) views.append(img) # latent latents = self.data['latents'][index] # label labels = self.data['labels'][index] images = [img0, img1, img2] + views return images, latents, labels def __len__(self): return self.dataset_len class PosNegViewDataset(torch.utils.data.Dataset): def __init__( self, data_path='data.pkl', latent_path='latent.pkl', pos_view_paths=['view_pos.pkl'], neg_view_paths=['view_neg.pkl'], transform0=None, transform1=None, transform2=None, transform3=None, n_views=1, train=True, subset_index=None, sample_from_mixed=False, sample_original=False, ): """ images: [x0, x1, x2, x3, ...] x0, x1 are two expert views x2 are rotation views reserved for essl x3 and after are for (cached) GAN generated views returns: (images, latents, labels) """ # self.data_transform = lambda x: (x + 1) / 2 # NOTE: to [0, 1] self.transform0 = transform0 self.transform1 = transform1 self.transform2 = transform2 self.transform3 = transform3 # load data assert os.path.exists(data_path), f'data_path {data_path} does not exist' with open(data_path, 'rb') as f: data = pickle.load(f) # load latent assert os.path.exists(latent_path), f'latent_path {latent_path} does not exist' with open(latent_path, 'rb') as f: latents = pickle.load(f) if subset_index is None: if 'index' in data: subset_index = data['index']['train'] if train else data['index']['test'] else: subset_index = np.arange(len(data['images'])) self.data = { 'images': data['images'][subset_index], 'labels': torch.tensor(data['labels'])[subset_index], 'latents': latents['latents'][subset_index], } # load views if isinstance(pos_view_paths, str): pos_view_paths = [pos_view_paths] views = [] for view_path in pos_view_paths: assert os.path.exists(view_path), f'pos_view_path {view_path} does not exist' with open(view_path, 'rb') as f: view = pickle.load(f) views.append(view['views'][:, subset_index]) # NOTE: original data is view_0 (this is convenient if we want to sample from mixed pool) self.views_pos = torch.cat([self.data['images'].unsqueeze(0)] + views, dim=0) self.total_views_pos = self.views_pos.shape[0] # NOTE: including original data view_0 if isinstance(neg_view_paths, str): neg_view_paths = [neg_view_paths] views = [] for view_path in neg_view_paths: assert os.path.exists(view_path), f'neg_view_path {view_path} does not exist' with open(view_path, 'rb') as f: view = pickle.load(f) views.append(view['views'][:, subset_index]) # NOTE: original data is view_0 (this is convenient if we want to sample from mixed pool) self.views_neg = torch.cat([self.data['images'].unsqueeze(0)] + views, dim=0) self.total_views_neg = self.views_neg.shape[0] # NOTE: including original data view_0 # NOTE: n_views is number of views for both pos and neg assert n_views % 2 == 0, f'n_views should be even, but got {n_views}' n_views = n_views // 2 self.n_views = n_views # NOTE: number of generated views to sample assert sample_original or self.n_views <= self.total_views_pos - int(not sample_from_mixed) assert sample_original or self.n_views <= self.total_views_neg - int(not sample_from_mixed) self.sample_from_mixed = sample_from_mixed self.sample_original = sample_original self.dataset_len = len(subset_index) def data_transform(self, image_tensor): image_tensor = (image_tensor + 1) / 2 return image_tensor def __getitem__(self, index): # view_0 img0 = self.data_transform(self.data['images'][index]) if self.transform0 is not None: img0 = self.transform0(img0) # view_1 img1 = self.data_transform(self.data['images'][index]) if self.transform1 is not None: img1 = self.transform1(img1) # view_2 img2 = self.data_transform(self.data['images'][index]) if self.transform2 is not None: img2 = self.transform2(img2) # view_3 and ... views = [] if self.sample_original: inds_pos = [0] * self.n_views inds_neg = [0] * self.n_views else: if self.sample_from_mixed: inds_pos = list(np.random.choice(np.arange(0, self.total_views_pos), size=self.n_views, replace=False)) inds_neg = list(np.random.choice(np.arange(0, self.total_views_neg), size=self.n_views, replace=False)) else: inds_pos = list(np.random.choice(np.arange(1, self.total_views_pos), size=self.n_views, replace=False)) inds_neg = list(np.random.choice(np.arange(1, self.total_views_neg), size=self.n_views, replace=False)) for i in inds_pos: img = self.data_transform(self.views_pos[i, index]) if self.transform3 is not None: img = self.transform3(img) views.append(img) for i in inds_neg: img = self.data_transform(self.views_neg[i, index]) if self.transform3 is not None: img = self.transform3(img) views.append(img) # latent latents = self.data['latents'][index] # label labels = self.data['labels'][index] images = [img0, img1, img2] + views return images, latents, labels def __len__(self): return self.dataset_len

40.163498

119

0.597084

1,370

10,563

4.421168

0.10365

0.036982

0.034671

0.031204

0.87469

0.870233

0.851246

0.837874

0.816411

0.794288

0

0.018596

0.297453

10,563

262

120

40.316794

0.797601

0.136136

0

0.70098

0

0.069273

0

0.053922

1

0.039216

false

0

0.039216

0.009804

0.117647

0

null

0

1

0

1

0

null

0

7

7b9a2875d56576231293d87066f55b598adf109c

146

py

Python

theverse/version.py

jesearl/theverse

ae201d8040358dd76cf82cea0fd3d879d4bd0faa

[ "BSD-3-Clause" ]

1

2020-07-07T13:42:21.000Z

theverse/version.py

jesearl/theverse

ae201d8040358dd76cf82cea0fd3d879d4bd0faa

[ "BSD-3-Clause" ]

null

theverse/version.py

jesearl/theverse

ae201d8040358dd76cf82cea0fd3d879d4bd0faa

[ "BSD-3-Clause" ]

1

2020-07-06T19:49:53.000Z

# -*- coding: utf-8 -*- from .fmtversion import get_version_plus_info __version__, __version_info__ = get_version_plus_info(0, 1, 1, 'final', 0)

29.2

74

0.739726

22

146

4.227273

0.590909

0.215054

0.301075

0.387097

0

0.039063

0.123288

146

4

75

36.5

0.6875

0.143836

0

0.04065

0

1

0

true

0

0.5

0

0.5

0

1

0

null

1

0

1

0

null

0

1

0

1

0

7

7bc091c5b99a3a318e12eacdb800452fcb7b5ac7

183

py

Python

event_handler.py

behenate/Blackboard

f3407e8506033f87784b1a762998e03728b11f67

[ "MIT" ]

null

event_handler.py

behenate/Blackboard

f3407e8506033f87784b1a762998e03728b11f67

[ "MIT" ]

null

event_handler.py

behenate/Blackboard

f3407e8506033f87784b1a762998e03728b11f67

[ "MIT" ]

null

# Function for handling events class EventHandler: def __init__(self): self.mouse_down = False def on_mouse_down(self): self.mouse_down = not self.mouse_down

22.875

45

0.693989

25

183

4.72

0.56

0.305085

0.330508

0.288136

0

0.234973

183

8

45

22.875

0.842857

0.153005

0

1

0.4

false

0

0.6

0

1

0

null

1

0

1

0

null

0

1

0

1

0

7

cdc5205959dbddb5ca5c9cfbb1ba129c5ff9f08c

135

py

Python

boa3_test/test_sc/native_test/gas/Decimals.py

OnBlockIO/neo3-boa

cb317292a67532a52ed26f2b0f0f7d0b10ac5f5f

[ "Apache-2.0" ]

25

2020-07-22T19:37:43.000Z

2022-03-08T03:23:55.000Z

boa3_test/test_sc/native_test/gas/Decimals.py

OnBlockIO/neo3-boa

cb317292a67532a52ed26f2b0f0f7d0b10ac5f5f

[ "Apache-2.0" ]

419

2020-04-23T17:48:14.000Z

2022-03-31T13:17:45.000Z

boa3_test/test_sc/native_test/gas/Decimals.py

OnBlockIO/neo3-boa

cb317292a67532a52ed26f2b0f0f7d0b10ac5f5f

[ "Apache-2.0" ]

15

2020-05-21T21:54:24.000Z

2021-11-18T06:17:24.000Z

from boa3.builtin import public from boa3.builtin.nativecontract.gas import GAS @public def main() -> int: return GAS.decimals()

16.875

47

0.748148

19

135

5.315789

0.631579

0.158416

0.29703

0

0.017544

0.155556

135

7

48

19.285714

0.868421

0

1

0.2

true

0

0.4

0.2

0.8

0

1

0

null

0

1

0

1

0

null

0

1

0

1

0

7

cdd06f7ea9bca064a544dda9b0e0c211af4e0efa

402

py

Python

other/api/__init__.py

hrmorley34/AdventofCode

74590422717fb5c6b80ef3fca226359d354c4aec

[ "MIT" ]

null

other/api/__init__.py

hrmorley34/AdventofCode

74590422717fb5c6b80ef3fca226359d354c4aec

[ "MIT" ]

null

other/api/__init__.py

hrmorley34/AdventofCode

74590422717fb5c6b80ef3fca226359d354c4aec

[ "MIT" ]

null

__all__ = [ "LeaderboardYear", "LeaderboardYearMember", "MemberDays", "is_day_unlocked", "get_cookiejar", "get_leaderboard_json", "UserId", "Event", "Day", "Part", ] from .api import ( LeaderboardYear, LeaderboardYearMember, MemberDays, is_day_unlocked, get_cookiejar, get_leaderboard_json, ) from .types import UserId, Event, Day, Part

17.478261

43

0.644279

37

402

6.621622

0.486486

0.293878

0.37551

0.391837

0.726531

0

0.241294

402

22

44

18.272727

0.803279

0

0.278607

0.052239

0

1

0

false

0

0.095238

0

0.095238

0

null

1

0

1

0

null

0

8

b582420aa1cfcfc3e5936c8d8df4e1012ee973f0

40,014

py

Python

sdk/python/pulumi_cloudflare/access_policy.py

pulumi/pulumi-cloudflare

d444af2fab6101b388a15cf2e3933e45e9935cc6

[ "ECL-2.0", "Apache-2.0" ]

35

2019-03-14T21:29:29.000Z

2022-03-30T00:00:59.000Z

sdk/python/pulumi_cloudflare/access_policy.py

pulumi/pulumi-cloudflare

d444af2fab6101b388a15cf2e3933e45e9935cc6

[ "ECL-2.0", "Apache-2.0" ]

128

2019-03-08T23:45:58.000Z

2022-03-31T21:05:22.000Z

sdk/python/pulumi_cloudflare/access_policy.py

pulumi/pulumi-cloudflare

d444af2fab6101b388a15cf2e3933e45e9935cc6

[ "ECL-2.0", "Apache-2.0" ]

6

2019-05-10T12:52:56.000Z

2020-03-24T15:02:14.000Z

# coding=utf-8 # *** WARNING: this file was generated by the Pulumi Terraform Bridge (tfgen) Tool. *** # *** Do not edit by hand unless you're certain you know what you are doing! *** import warnings import pulumi import pulumi.runtime from typing import Any, Mapping, Optional, Sequence, Union, overload from . import _utilities from . import outputs from ._inputs import * __all__ = ['AccessPolicyArgs', 'AccessPolicy'] @pulumi.input_type class AccessPolicyArgs: def __init__(__self__, *, application_id: pulumi.Input[str], decision: pulumi.Input[str], includes: pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]], name: pulumi.Input[str], precedence: pulumi.Input[int], account_id: Optional[pulumi.Input[str]] = None, approval_groups: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]]] = None, excludes: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]]] = None, purpose_justification_prompt: Optional[pulumi.Input[str]] = None, purpose_justification_required: Optional[pulumi.Input[bool]] = None, requires: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]]] = None, zone_id: Optional[pulumi.Input[str]] = None): """ The set of arguments for constructing a AccessPolicy resource. :param pulumi.Input[str] application_id: The ID of the application the policy is associated with. :param pulumi.Input[str] decision: Defines the action Access will take if the policy matches the user. Allowed values: `allow`, `deny`, `non_identity`, `bypass` :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]] includes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] name: Friendly name of the Access Application. :param pulumi.Input[int] precedence: The unique precedence for policies on a single application. Integer. :param pulumi.Input[str] account_id: The account to which the access rule should be added. Conflicts with `zone_id`. :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]] approval_groups: List of approval group blocks for configuring additional approvals (refer to the nested schema). :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]] excludes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] purpose_justification_prompt: String to present to the user when purpose justification is enabled. :param pulumi.Input[bool] purpose_justification_required: Boolean of whether to prompt the user for a justification for accessing the resource. :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]] requires: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] zone_id: The DNS zone to which the access rule should be added. Conflicts with `account_id`. """ pulumi.set(__self__, "application_id", application_id) pulumi.set(__self__, "decision", decision) pulumi.set(__self__, "includes", includes) pulumi.set(__self__, "name", name) pulumi.set(__self__, "precedence", precedence) if account_id is not None: pulumi.set(__self__, "account_id", account_id) if approval_groups is not None: pulumi.set(__self__, "approval_groups", approval_groups) if excludes is not None: pulumi.set(__self__, "excludes", excludes) if purpose_justification_prompt is not None: pulumi.set(__self__, "purpose_justification_prompt", purpose_justification_prompt) if purpose_justification_required is not None: pulumi.set(__self__, "purpose_justification_required", purpose_justification_required) if requires is not None: pulumi.set(__self__, "requires", requires) if zone_id is not None: pulumi.set(__self__, "zone_id", zone_id) @property @pulumi.getter(name="applicationId") def application_id(self) -> pulumi.Input[str]: """ The ID of the application the policy is associated with. """ return pulumi.get(self, "application_id") @application_id.setter def application_id(self, value: pulumi.Input[str]): pulumi.set(self, "application_id", value) @property @pulumi.getter def decision(self) -> pulumi.Input[str]: """ Defines the action Access will take if the policy matches the user. Allowed values: `allow`, `deny`, `non_identity`, `bypass` """ return pulumi.get(self, "decision") @decision.setter def decision(self, value: pulumi.Input[str]): pulumi.set(self, "decision", value) @property @pulumi.getter def includes(self) -> pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "includes") @includes.setter def includes(self, value: pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]]): pulumi.set(self, "includes", value) @property @pulumi.getter def name(self) -> pulumi.Input[str]: """ Friendly name of the Access Application. """ return pulumi.get(self, "name") @name.setter def name(self, value: pulumi.Input[str]): pulumi.set(self, "name", value) @property @pulumi.getter def precedence(self) -> pulumi.Input[int]: """ The unique precedence for policies on a single application. Integer. """ return pulumi.get(self, "precedence") @precedence.setter def precedence(self, value: pulumi.Input[int]): pulumi.set(self, "precedence", value) @property @pulumi.getter(name="accountId") def account_id(self) -> Optional[pulumi.Input[str]]: """ The account to which the access rule should be added. Conflicts with `zone_id`. """ return pulumi.get(self, "account_id") @account_id.setter def account_id(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "account_id", value) @property @pulumi.getter(name="approvalGroups") def approval_groups(self) -> Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]]]: """ List of approval group blocks for configuring additional approvals (refer to the nested schema). """ return pulumi.get(self, "approval_groups") @approval_groups.setter def approval_groups(self, value: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]]]): pulumi.set(self, "approval_groups", value) @property @pulumi.getter def excludes(self) -> Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "excludes") @excludes.setter def excludes(self, value: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]]]): pulumi.set(self, "excludes", value) @property @pulumi.getter(name="purposeJustificationPrompt") def purpose_justification_prompt(self) -> Optional[pulumi.Input[str]]: """ String to present to the user when purpose justification is enabled. """ return pulumi.get(self, "purpose_justification_prompt") @purpose_justification_prompt.setter def purpose_justification_prompt(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "purpose_justification_prompt", value) @property @pulumi.getter(name="purposeJustificationRequired") def purpose_justification_required(self) -> Optional[pulumi.Input[bool]]: """ Boolean of whether to prompt the user for a justification for accessing the resource. """ return pulumi.get(self, "purpose_justification_required") @purpose_justification_required.setter def purpose_justification_required(self, value: Optional[pulumi.Input[bool]]): pulumi.set(self, "purpose_justification_required", value) @property @pulumi.getter def requires(self) -> Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "requires") @requires.setter def requires(self, value: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]]]): pulumi.set(self, "requires", value) @property @pulumi.getter(name="zoneId") def zone_id(self) -> Optional[pulumi.Input[str]]: """ The DNS zone to which the access rule should be added. Conflicts with `account_id`. """ return pulumi.get(self, "zone_id") @zone_id.setter def zone_id(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "zone_id", value) @pulumi.input_type class _AccessPolicyState: def __init__(__self__, *, account_id: Optional[pulumi.Input[str]] = None, application_id: Optional[pulumi.Input[str]] = None, approval_groups: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]]] = None, decision: Optional[pulumi.Input[str]] = None, excludes: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]]] = None, includes: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]]] = None, name: Optional[pulumi.Input[str]] = None, precedence: Optional[pulumi.Input[int]] = None, purpose_justification_prompt: Optional[pulumi.Input[str]] = None, purpose_justification_required: Optional[pulumi.Input[bool]] = None, requires: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]]] = None, zone_id: Optional[pulumi.Input[str]] = None): """ Input properties used for looking up and filtering AccessPolicy resources. :param pulumi.Input[str] account_id: The account to which the access rule should be added. Conflicts with `zone_id`. :param pulumi.Input[str] application_id: The ID of the application the policy is associated with. :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]] approval_groups: List of approval group blocks for configuring additional approvals (refer to the nested schema). :param pulumi.Input[str] decision: Defines the action Access will take if the policy matches the user. Allowed values: `allow`, `deny`, `non_identity`, `bypass` :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]] excludes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]] includes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] name: Friendly name of the Access Application. :param pulumi.Input[int] precedence: The unique precedence for policies on a single application. Integer. :param pulumi.Input[str] purpose_justification_prompt: String to present to the user when purpose justification is enabled. :param pulumi.Input[bool] purpose_justification_required: Boolean of whether to prompt the user for a justification for accessing the resource. :param pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]] requires: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] zone_id: The DNS zone to which the access rule should be added. Conflicts with `account_id`. """ if account_id is not None: pulumi.set(__self__, "account_id", account_id) if application_id is not None: pulumi.set(__self__, "application_id", application_id) if approval_groups is not None: pulumi.set(__self__, "approval_groups", approval_groups) if decision is not None: pulumi.set(__self__, "decision", decision) if excludes is not None: pulumi.set(__self__, "excludes", excludes) if includes is not None: pulumi.set(__self__, "includes", includes) if name is not None: pulumi.set(__self__, "name", name) if precedence is not None: pulumi.set(__self__, "precedence", precedence) if purpose_justification_prompt is not None: pulumi.set(__self__, "purpose_justification_prompt", purpose_justification_prompt) if purpose_justification_required is not None: pulumi.set(__self__, "purpose_justification_required", purpose_justification_required) if requires is not None: pulumi.set(__self__, "requires", requires) if zone_id is not None: pulumi.set(__self__, "zone_id", zone_id) @property @pulumi.getter(name="accountId") def account_id(self) -> Optional[pulumi.Input[str]]: """ The account to which the access rule should be added. Conflicts with `zone_id`. """ return pulumi.get(self, "account_id") @account_id.setter def account_id(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "account_id", value) @property @pulumi.getter(name="applicationId") def application_id(self) -> Optional[pulumi.Input[str]]: """ The ID of the application the policy is associated with. """ return pulumi.get(self, "application_id") @application_id.setter def application_id(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "application_id", value) @property @pulumi.getter(name="approvalGroups") def approval_groups(self) -> Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]]]: """ List of approval group blocks for configuring additional approvals (refer to the nested schema). """ return pulumi.get(self, "approval_groups") @approval_groups.setter def approval_groups(self, value: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyApprovalGroupArgs']]]]): pulumi.set(self, "approval_groups", value) @property @pulumi.getter def decision(self) -> Optional[pulumi.Input[str]]: """ Defines the action Access will take if the policy matches the user. Allowed values: `allow`, `deny`, `non_identity`, `bypass` """ return pulumi.get(self, "decision") @decision.setter def decision(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "decision", value) @property @pulumi.getter def excludes(self) -> Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "excludes") @excludes.setter def excludes(self, value: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyExcludeArgs']]]]): pulumi.set(self, "excludes", value) @property @pulumi.getter def includes(self) -> Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "includes") @includes.setter def includes(self, value: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyIncludeArgs']]]]): pulumi.set(self, "includes", value) @property @pulumi.getter def name(self) -> Optional[pulumi.Input[str]]: """ Friendly name of the Access Application. """ return pulumi.get(self, "name") @name.setter def name(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "name", value) @property @pulumi.getter def precedence(self) -> Optional[pulumi.Input[int]]: """ The unique precedence for policies on a single application. Integer. """ return pulumi.get(self, "precedence") @precedence.setter def precedence(self, value: Optional[pulumi.Input[int]]): pulumi.set(self, "precedence", value) @property @pulumi.getter(name="purposeJustificationPrompt") def purpose_justification_prompt(self) -> Optional[pulumi.Input[str]]: """ String to present to the user when purpose justification is enabled. """ return pulumi.get(self, "purpose_justification_prompt") @purpose_justification_prompt.setter def purpose_justification_prompt(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "purpose_justification_prompt", value) @property @pulumi.getter(name="purposeJustificationRequired") def purpose_justification_required(self) -> Optional[pulumi.Input[bool]]: """ Boolean of whether to prompt the user for a justification for accessing the resource. """ return pulumi.get(self, "purpose_justification_required") @purpose_justification_required.setter def purpose_justification_required(self, value: Optional[pulumi.Input[bool]]): pulumi.set(self, "purpose_justification_required", value) @property @pulumi.getter def requires(self) -> Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "requires") @requires.setter def requires(self, value: Optional[pulumi.Input[Sequence[pulumi.Input['AccessPolicyRequireArgs']]]]): pulumi.set(self, "requires", value) @property @pulumi.getter(name="zoneId") def zone_id(self) -> Optional[pulumi.Input[str]]: """ The DNS zone to which the access rule should be added. Conflicts with `account_id`. """ return pulumi.get(self, "zone_id") @zone_id.setter def zone_id(self, value: Optional[pulumi.Input[str]]): pulumi.set(self, "zone_id", value) class AccessPolicy(pulumi.CustomResource): @overload def __init__(__self__, resource_name: str, opts: Optional[pulumi.ResourceOptions] = None, account_id: Optional[pulumi.Input[str]] = None, application_id: Optional[pulumi.Input[str]] = None, approval_groups: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyApprovalGroupArgs']]]]] = None, decision: Optional[pulumi.Input[str]] = None, excludes: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyExcludeArgs']]]]] = None, includes: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyIncludeArgs']]]]] = None, name: Optional[pulumi.Input[str]] = None, precedence: Optional[pulumi.Input[int]] = None, purpose_justification_prompt: Optional[pulumi.Input[str]] = None, purpose_justification_required: Optional[pulumi.Input[bool]] = None, requires: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyRequireArgs']]]]] = None, zone_id: Optional[pulumi.Input[str]] = None, __props__=None): """ Provides a Cloudflare Access Policy resource. Access Policies are used in conjunction with Access Applications to restrict access to a particular resource. ## Example Usage ```python import pulumi import pulumi_cloudflare as cloudflare # Allowing access to `test@example.com` email address only test_policy_access_policy = cloudflare.AccessPolicy("testPolicyAccessPolicy", application_id="cb029e245cfdd66dc8d2e570d5dd3322", zone_id="d41d8cd98f00b204e9800998ecf8427e", name="staging policy", precedence=1, decision="allow", includes=[cloudflare.AccessPolicyIncludeArgs( emails=["test@example.com"], )], requires=[cloudflare.AccessPolicyRequireArgs( emails=["test@example.com"], )]) # Allowing `test@example.com` to access but only when coming from a # specific IP. test_policy_index_access_policy_access_policy = cloudflare.AccessPolicy("testPolicyIndex/accessPolicyAccessPolicy", application_id="cb029e245cfdd66dc8d2e570d5dd3322", zone_id="d41d8cd98f00b204e9800998ecf8427e", name="staging policy", precedence=1, decision="allow", includes=[cloudflare.AccessPolicyIncludeArgs( emails=["test@example.com"], )], requires=[cloudflare.AccessPolicyRequireArgs( ips=[var["office_ip"]], )]) ``` ## Import Access Policies can be imported using a composite ID formed of identifier type (`zone` or `account`), identifier ID (`zone_id` or `account_id`), application ID and policy ID. # import a zone level Access policy ```sh $ pulumi import cloudflare:index/accessPolicy:AccessPolicy staging zone/cb029e245cfdd66dc8d2e570d5dd3322/d41d8cd98f00b204e9800998ecf8427e/67ea780ce4982c1cfbe6b7293afc765d ``` # import an account level Access policy ```sh $ pulumi import cloudflare:index/accessPolicy:AccessPolicy production account/0d599f0ec05c3bda8c3b8a68c32a1b47/d41d8cd98f00b204e9800998ecf8427e/67ea780ce4982c1cfbe6b7293afc765d ``` :param str resource_name: The name of the resource. :param pulumi.ResourceOptions opts: Options for the resource. :param pulumi.Input[str] account_id: The account to which the access rule should be added. Conflicts with `zone_id`. :param pulumi.Input[str] application_id: The ID of the application the policy is associated with. :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyApprovalGroupArgs']]]] approval_groups: List of approval group blocks for configuring additional approvals (refer to the nested schema). :param pulumi.Input[str] decision: Defines the action Access will take if the policy matches the user. Allowed values: `allow`, `deny`, `non_identity`, `bypass` :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyExcludeArgs']]]] excludes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyIncludeArgs']]]] includes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] name: Friendly name of the Access Application. :param pulumi.Input[int] precedence: The unique precedence for policies on a single application. Integer. :param pulumi.Input[str] purpose_justification_prompt: String to present to the user when purpose justification is enabled. :param pulumi.Input[bool] purpose_justification_required: Boolean of whether to prompt the user for a justification for accessing the resource. :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyRequireArgs']]]] requires: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] zone_id: The DNS zone to which the access rule should be added. Conflicts with `account_id`. """ ... @overload def __init__(__self__, resource_name: str, args: AccessPolicyArgs, opts: Optional[pulumi.ResourceOptions] = None): """ Provides a Cloudflare Access Policy resource. Access Policies are used in conjunction with Access Applications to restrict access to a particular resource. ## Example Usage ```python import pulumi import pulumi_cloudflare as cloudflare # Allowing access to `test@example.com` email address only test_policy_access_policy = cloudflare.AccessPolicy("testPolicyAccessPolicy", application_id="cb029e245cfdd66dc8d2e570d5dd3322", zone_id="d41d8cd98f00b204e9800998ecf8427e", name="staging policy", precedence=1, decision="allow", includes=[cloudflare.AccessPolicyIncludeArgs( emails=["test@example.com"], )], requires=[cloudflare.AccessPolicyRequireArgs( emails=["test@example.com"], )]) # Allowing `test@example.com` to access but only when coming from a # specific IP. test_policy_index_access_policy_access_policy = cloudflare.AccessPolicy("testPolicyIndex/accessPolicyAccessPolicy", application_id="cb029e245cfdd66dc8d2e570d5dd3322", zone_id="d41d8cd98f00b204e9800998ecf8427e", name="staging policy", precedence=1, decision="allow", includes=[cloudflare.AccessPolicyIncludeArgs( emails=["test@example.com"], )], requires=[cloudflare.AccessPolicyRequireArgs( ips=[var["office_ip"]], )]) ``` ## Import Access Policies can be imported using a composite ID formed of identifier type (`zone` or `account`), identifier ID (`zone_id` or `account_id`), application ID and policy ID. # import a zone level Access policy ```sh $ pulumi import cloudflare:index/accessPolicy:AccessPolicy staging zone/cb029e245cfdd66dc8d2e570d5dd3322/d41d8cd98f00b204e9800998ecf8427e/67ea780ce4982c1cfbe6b7293afc765d ``` # import an account level Access policy ```sh $ pulumi import cloudflare:index/accessPolicy:AccessPolicy production account/0d599f0ec05c3bda8c3b8a68c32a1b47/d41d8cd98f00b204e9800998ecf8427e/67ea780ce4982c1cfbe6b7293afc765d ``` :param str resource_name: The name of the resource. :param AccessPolicyArgs args: The arguments to use to populate this resource's properties. :param pulumi.ResourceOptions opts: Options for the resource. """ ... def __init__(__self__, resource_name: str, *args, **kwargs): resource_args, opts = _utilities.get_resource_args_opts(AccessPolicyArgs, pulumi.ResourceOptions, *args, **kwargs) if resource_args is not None: __self__._internal_init(resource_name, opts, **resource_args.__dict__) else: __self__._internal_init(resource_name, *args, **kwargs) def _internal_init(__self__, resource_name: str, opts: Optional[pulumi.ResourceOptions] = None, account_id: Optional[pulumi.Input[str]] = None, application_id: Optional[pulumi.Input[str]] = None, approval_groups: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyApprovalGroupArgs']]]]] = None, decision: Optional[pulumi.Input[str]] = None, excludes: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyExcludeArgs']]]]] = None, includes: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyIncludeArgs']]]]] = None, name: Optional[pulumi.Input[str]] = None, precedence: Optional[pulumi.Input[int]] = None, purpose_justification_prompt: Optional[pulumi.Input[str]] = None, purpose_justification_required: Optional[pulumi.Input[bool]] = None, requires: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyRequireArgs']]]]] = None, zone_id: Optional[pulumi.Input[str]] = None, __props__=None): if opts is None: opts = pulumi.ResourceOptions() if not isinstance(opts, pulumi.ResourceOptions): raise TypeError('Expected resource options to be a ResourceOptions instance') if opts.version is None: opts.version = _utilities.get_version() if opts.id is None: if __props__ is not None: raise TypeError('__props__ is only valid when passed in combination with a valid opts.id to get an existing resource') __props__ = AccessPolicyArgs.__new__(AccessPolicyArgs) __props__.__dict__["account_id"] = account_id if application_id is None and not opts.urn: raise TypeError("Missing required property 'application_id'") __props__.__dict__["application_id"] = application_id __props__.__dict__["approval_groups"] = approval_groups if decision is None and not opts.urn: raise TypeError("Missing required property 'decision'") __props__.__dict__["decision"] = decision __props__.__dict__["excludes"] = excludes if includes is None and not opts.urn: raise TypeError("Missing required property 'includes'") __props__.__dict__["includes"] = includes if name is None and not opts.urn: raise TypeError("Missing required property 'name'") __props__.__dict__["name"] = name if precedence is None and not opts.urn: raise TypeError("Missing required property 'precedence'") __props__.__dict__["precedence"] = precedence __props__.__dict__["purpose_justification_prompt"] = purpose_justification_prompt __props__.__dict__["purpose_justification_required"] = purpose_justification_required __props__.__dict__["requires"] = requires __props__.__dict__["zone_id"] = zone_id super(AccessPolicy, __self__).__init__( 'cloudflare:index/accessPolicy:AccessPolicy', resource_name, __props__, opts) @staticmethod def get(resource_name: str, id: pulumi.Input[str], opts: Optional[pulumi.ResourceOptions] = None, account_id: Optional[pulumi.Input[str]] = None, application_id: Optional[pulumi.Input[str]] = None, approval_groups: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyApprovalGroupArgs']]]]] = None, decision: Optional[pulumi.Input[str]] = None, excludes: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyExcludeArgs']]]]] = None, includes: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyIncludeArgs']]]]] = None, name: Optional[pulumi.Input[str]] = None, precedence: Optional[pulumi.Input[int]] = None, purpose_justification_prompt: Optional[pulumi.Input[str]] = None, purpose_justification_required: Optional[pulumi.Input[bool]] = None, requires: Optional[pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyRequireArgs']]]]] = None, zone_id: Optional[pulumi.Input[str]] = None) -> 'AccessPolicy': """ Get an existing AccessPolicy resource's state with the given name, id, and optional extra properties used to qualify the lookup. :param str resource_name: The unique name of the resulting resource. :param pulumi.Input[str] id: The unique provider ID of the resource to lookup. :param pulumi.ResourceOptions opts: Options for the resource. :param pulumi.Input[str] account_id: The account to which the access rule should be added. Conflicts with `zone_id`. :param pulumi.Input[str] application_id: The ID of the application the policy is associated with. :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyApprovalGroupArgs']]]] approval_groups: List of approval group blocks for configuring additional approvals (refer to the nested schema). :param pulumi.Input[str] decision: Defines the action Access will take if the policy matches the user. Allowed values: `allow`, `deny`, `non_identity`, `bypass` :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyExcludeArgs']]]] excludes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyIncludeArgs']]]] includes: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] name: Friendly name of the Access Application. :param pulumi.Input[int] precedence: The unique precedence for policies on a single application. Integer. :param pulumi.Input[str] purpose_justification_prompt: String to present to the user when purpose justification is enabled. :param pulumi.Input[bool] purpose_justification_required: Boolean of whether to prompt the user for a justification for accessing the resource. :param pulumi.Input[Sequence[pulumi.Input[pulumi.InputType['AccessPolicyRequireArgs']]]] requires: A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). :param pulumi.Input[str] zone_id: The DNS zone to which the access rule should be added. Conflicts with `account_id`. """ opts = pulumi.ResourceOptions.merge(opts, pulumi.ResourceOptions(id=id)) __props__ = _AccessPolicyState.__new__(_AccessPolicyState) __props__.__dict__["account_id"] = account_id __props__.__dict__["application_id"] = application_id __props__.__dict__["approval_groups"] = approval_groups __props__.__dict__["decision"] = decision __props__.__dict__["excludes"] = excludes __props__.__dict__["includes"] = includes __props__.__dict__["name"] = name __props__.__dict__["precedence"] = precedence __props__.__dict__["purpose_justification_prompt"] = purpose_justification_prompt __props__.__dict__["purpose_justification_required"] = purpose_justification_required __props__.__dict__["requires"] = requires __props__.__dict__["zone_id"] = zone_id return AccessPolicy(resource_name, opts=opts, __props__=__props__) @property @pulumi.getter(name="accountId") def account_id(self) -> pulumi.Output[str]: """ The account to which the access rule should be added. Conflicts with `zone_id`. """ return pulumi.get(self, "account_id") @property @pulumi.getter(name="applicationId") def application_id(self) -> pulumi.Output[str]: """ The ID of the application the policy is associated with. """ return pulumi.get(self, "application_id") @property @pulumi.getter(name="approvalGroups") def approval_groups(self) -> pulumi.Output[Optional[Sequence['outputs.AccessPolicyApprovalGroup']]]: """ List of approval group blocks for configuring additional approvals (refer to the nested schema). """ return pulumi.get(self, "approval_groups") @property @pulumi.getter def decision(self) -> pulumi.Output[str]: """ Defines the action Access will take if the policy matches the user. Allowed values: `allow`, `deny`, `non_identity`, `bypass` """ return pulumi.get(self, "decision") @property @pulumi.getter def excludes(self) -> pulumi.Output[Optional[Sequence['outputs.AccessPolicyExclude']]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "excludes") @property @pulumi.getter def includes(self) -> pulumi.Output[Sequence['outputs.AccessPolicyInclude']]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "includes") @property @pulumi.getter def name(self) -> pulumi.Output[str]: """ Friendly name of the Access Application. """ return pulumi.get(self, "name") @property @pulumi.getter def precedence(self) -> pulumi.Output[int]: """ The unique precedence for policies on a single application. Integer. """ return pulumi.get(self, "precedence") @property @pulumi.getter(name="purposeJustificationPrompt") def purpose_justification_prompt(self) -> pulumi.Output[Optional[str]]: """ String to present to the user when purpose justification is enabled. """ return pulumi.get(self, "purpose_justification_prompt") @property @pulumi.getter(name="purposeJustificationRequired") def purpose_justification_required(self) -> pulumi.Output[Optional[bool]]: """ Boolean of whether to prompt the user for a justification for accessing the resource. """ return pulumi.get(self, "purpose_justification_required") @property @pulumi.getter def requires(self) -> pulumi.Output[Optional[Sequence['outputs.AccessPolicyRequire']]]: """ A series of access conditions, see [Access Groups](https://www.terraform.io/providers/cloudflare/cloudflare/latest/docs/resources/access_group#conditions). """ return pulumi.get(self, "requires") @property @pulumi.getter(name="zoneId") def zone_id(self) -> pulumi.Output[str]: """ The DNS zone to which the access rule should be added. Conflicts with `account_id`. """ return pulumi.get(self, "zone_id")

51.234315

262

0.678338

4,359

40,014

6.052764

0.056894

0.088387

0.066972

0.049272

0.924689

0.910741

0.894406

0.878449

0.870603

0.86128

0

0.012413

0.216824

40,014

780

263

51.3

0.829504

0.397561

0

0.769417

1

0

0.139214

0.078419

0

1

0.162621

false

0.002427

0.01699

0

0.276699

0

null

0

1

0

1

0

null

0

8

b592456449aa030a59abd31c495178763eb7dc76

68

py

Python

battle_tested/beta/fuzz_planner.py

CodyKochmann/battle_tested

6044d5988fdae9d1ead3fe42f2a93cc1a1d04a9b

[ "MIT" ]

91

2017-06-26T14:01:43.000Z

2022-02-15T11:41:20.000Z

battle_tested/beta/fuzz_planner.py

CodyKochmann/battle_tested

6044d5988fdae9d1ead3fe42f2a93cc1a1d04a9b

[ "MIT" ]

47

2017-05-20T12:51:05.000Z

2021-06-11T08:43:35.000Z

battle_tested/beta/fuzz_planner.py

CodyKochmann/battle_tested

6044d5988fdae9d1ead3fe42f2a93cc1a1d04a9b

[ "MIT" ]

1

2017-08-07T05:18:40.000Z

from battle_tested.beta.input_type_combos import input_type_combos

22.666667

66

0.897059

11

68

5.090909

0.727273

0.321429

0.535714

0

0.073529

68

2

67

34

0.888889

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

b5a3c7873a28cb0e5fd5ad0bf0bcf23355a0e2a0

10,183

py

Python

apps/data.py

Giorgiobientinesi/Decidata

0f262850561d520a68efa1335378c1be6e397e88

[ "MIT" ]

null

apps/data.py

Giorgiobientinesi/Decidata

0f262850561d520a68efa1335378c1be6e397e88

[ "MIT" ]

null

apps/data.py

Giorgiobientinesi/Decidata

0f262850561d520a68efa1335378c1be6e397e88

[ "MIT" ]

null

import streamlit as st import pandas as pd #SESSION STATE INITIALIZATION if 'df' not in st.session_state: st.session_state.df = 0 if "light" not in st.session_state: st.session_state.light = "red" if "warning" not in st.session_state: st.session_state.warning = "Undefined Error" if "selected_var" not in st.session_state: st.session_state.selected_var=[] def app(): st.session_state.light = "red" st.session_state.warning = "Please select at least one predictor." st.markdown( """ <style> .stProgress > div > div > div > div { background-image: linear-gradient(to right, #5b61f9 , #5b61f9); } </style>""", unsafe_allow_html=True, ) my_bar = st.progress(50) if 'df' not in st.session_state: st.session_state.df = 0 df = st.session_state.df df1 = st.session_state.df st.markdown('<h1 style="color: #5b61f9;">Null Values Detection</h1>', unsafe_allow_html=True) st.write("These are the percentage of Null Values in your Dataset. Please Select the variables you want to include in the analysis!") variables = [] All = st.checkbox("Select All", key=0) if All == True: variables.append(list(df.columns)) variables = variables[0] percent_missing = df.isnull().sum() * 100 / len(df) missing_values = pd.DataFrame({"percent_missing": percent_missing}) cols = st.columns(3) i = 1 if len(df.columns) % 2 == 0: k = len(df.columns) / 2 k = int(k) else: k = len(df.columns) k = k - 1 k = k / 2 k = int(k) for el in list(df1.columns[:k]): with st.container(): percent_missing = str(df1[el].isnull().sum() * 100 / len(df1)) for j in ["Target","Customer ID","Month"]: if el ==j: cols[2].markdown('<h6 style="color: #5b61f9;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i,disabled=True,value=True) df1 = df1.drop([el],axis=1) if float(percent_missing) == 0: if el not in ["Target","Customer ID","Month"]: cols[0].markdown('<h6 style="color: green;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[0].checkbox("", key=i,disabled=True,value=True) elif float(percent_missing) < 20 and float(percent_missing) > 0: if el not in ["Target", "Customer ID", "Month"]: cols[1].markdown('<h6 style="color: orange;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[1].checkbox("", key=i,disabled=True,value=True) else: if el not in ["Target", "Customer ID", "Month"]: cols[2].markdown('<h6 style="color: red;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i,disabled=True,value=True) i += 1 for el in list(df1.columns[k:]): with st.container(): percent_missing = str(df1[el].isnull().sum() * 100 / len(df1)) for j in ["Target","Customer ID","Month"]: if el == j: cols[2].markdown('<h6 style="color: #5b61f9;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i,disabled=True,value=True) df1 = df1.drop([el],axis=1) if float(percent_missing) == 0: if el not in ["Target","Customer ID","Month"]: cols[1].markdown('<h6 style="color: green;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[1].checkbox("", key=i,disabled=True,value=True) elif float(percent_missing) < 20 and float(percent_missing) > 0: if el not in ["Target", "Customer ID", "Month"]: cols[0].markdown( '<h6 style="color: orange;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[0].checkbox("", key=i,disabled=True,value=True) else: if el not in ["Target", "Customer ID", "Month"]: cols[2].markdown('<h6 style="color: red;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i,disabled=True,value=True) i += 1 else: percent_missing = df.isnull().sum() * 100 / len(df) missing_values = pd.DataFrame({"percent_missing": percent_missing}) variables = [] cols = st.columns(3) i = 1 if len(df.columns) % 2 == 0: k = len(df.columns) / 2 k = int(k) else: k = len(df.columns) k = k - 1 k = k / 2 k = int(k) for el in list(df1.columns[:k]): with st.container(): percent_missing = str(df1[el].isnull().sum() * 100 / len(df1)) for j in ["Target", "Customer ID", "Month"]: if el == j: cols[2].markdown( '<h6 style="color: #5b61f9;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i, disabled=True, value=True) df1 = df1.drop([el], axis=1) variables.append(el) if float(percent_missing) == 0: if el not in ["Target", "Customer ID", "Month"]: cols[0].markdown( '<h6 style="color: green;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[0].checkbox("", key=i) if a == True: variables.append(el) elif float(percent_missing) < 20 and float(percent_missing) > 0: if el not in ["Target", "Customer ID", "Month"]: cols[1].markdown( '<h6 style="color: orange;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[1].checkbox("", key=i) if a == True: variables.append(el) else: if el not in ["Target", "Customer ID", "Month"]: cols[2].markdown( '<h6 style="color: red;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i) if a == True: variables.append(el) i += 1 for el in list(df1.columns[k:]): with st.container(): percent_missing = str(df1[el].isnull().sum() * 100 / len(df1)) for j in ["Target", "Customer ID", "Month"]: if el == j: cols[2].markdown( '<h6 style="color: #5b61f9;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i, disabled=True, value=True) df1 = df1.drop([el], axis=1) variables.append(el) if float(percent_missing) == 0: if el not in ["Target", "Customer ID", "Month"]: cols[1].markdown( '<h6 style="color: green;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[1].checkbox("", key=i) if a == True: variables.append(el) elif float(percent_missing) < 20 and float(percent_missing) > 0: if el not in ["Target", "Customer ID", "Month"]: cols[0].markdown( '<h6 style="color: orange;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[0].checkbox("", key=i) if a == True: variables.append(el) else: if el not in ["Target", "Customer ID", "Month"]: cols[2].markdown( '<h6 style="color: red;">{}</h6>'.format(str(el) + " " + percent_missing[0:4] + "%"), unsafe_allow_html=True) a = cols[2].checkbox("", key=i) if a == True: variables.append(el) i += 1 variables.remove("Month") variables.remove("Customer ID") st.session_state.selected_var= variables df = df[st.session_state.selected_var] st.dataframe(df) if len(variables)>1: st.session_state.light = "green" #Passing list of selected var to next step

38.866412

137

0.446038

1,118

10,183

3.974955

0.103757

0.119712

0.081008

0.076958

0.830333

0.809856

0.787579

0

0.034705

0.405774

10,183

261

138

39.015326

0.699719

0.006776

0

0.827957

0

0.005376

0.124685

0

1

0.005376

false

0

0.010753

0

0.016129

0

null

0

1

0

1

0

null

0

7

8d3b5529732cf82cf026f1a015dd625b0829a160

108

py

Python

src/office31/__init__.py

LukasHedegaard/office31-train-test-splits

cfd19c3bfeccf23ca905ec10b85806778d84e548

[ "MIT" ]

1

2020-09-18T03:36:22.000Z

src/office31/__init__.py

LukasHedegaard/office31-train-test-splits

cfd19c3bfeccf23ca905ec10b85806778d84e548

[ "MIT" ]

1

2021-03-21T03:19:36.000Z

2021-03-30T12:14:16.000Z

src/office31/__init__.py

LukasHedegaard/office31

cfd19c3bfeccf23ca905ec10b85806778d84e548

[ "MIT" ]

null

from .split import office31 # noqa: F401 from .download import download_and_extract_office31 # noqa: F401

36

65

0.796296

15

108

5.533333

0.6

0.289157

0.385542

0

0.108696

0.148148

108

2

66

54

0.793478

0.194444

0

1

0

true

0

1

0

1

0

1

0

null

1

0

1

0

null

0

1

0

1

0

1

0

7

571e286cebd1bb4dc6b6748d631536cd7d9b5860

185,943

py

Python

module_troops.py

infobeisel/mbnwcModSys

6e05ec53cfb840a4962c3cb5387f505afefd9157

[ "BSD-2-Clause" ]

null

module_troops.py

infobeisel/mbnwcModSys

6e05ec53cfb840a4962c3cb5387f505afefd9157

[ "BSD-2-Clause" ]

null

module_troops.py

infobeisel/mbnwcModSys

6e05ec53cfb840a4962c3cb5387f505afefd9157

[ "BSD-2-Clause" ]

null

import random from header_common import * from header_items import * from header_troops import * from header_skills import * from ID_factions import * from ID_items import * from ID_scenes import * #################################################################################################################### # Each troop contains the following fields: # 1) Troop id (string): used for referencing troops in other files. The prefix trp_ is automatically added before each troop-id . # 2) Toop name (string). # 3) Plural troop name (string). # 4) Troop flags (int). See header_troops.py for a list of available flags # 5) Scene (int) (only applicable to heroes) For example: scn_reyvadin_castle|entry(1) puts troop in reyvadin castle's first entry point # 6) Reserved (int). Put constant "reserved" or 0. # 7) Faction (int) # 8) Inventory (list): Must be a list of items # 9) Attributes (int): Example usage: # str_6|agi_6|int_4|cha_5|level(5) # 10) Weapon proficiencies (int): Example usage: # wp_one_handed(55)|wp_two_handed(90)|wp_polearm(36)|wp_archery(80)|wp_crossbow(24)|wp_throwing(45) # The function wp(x) will create random weapon proficiencies close to value x. # To make an expert archer with other weapon proficiencies close to 60 you can use something like: # wp_archery(160) | wp(60) # 11) Skills (int): See header_skills.py to see a list of skills. Example: # knows_ironflesh_3|knows_power_strike_2|knows_riding_2 # 12) Face code (int): You can obtain the face code by pressing ctrl+E in face generator screen # 13) Face code (int)(2) (only applicable to regular troops, can be omitted for heroes): # The game will create random faces between Face code 1 and face code 2 for generated troops # 14) Troop image (string): If this variable is set, the troop will use an image rather than its 3D visual during the conversations # town_1 Sargoth # town_2 Tihr # town_3 Veluca # town_4 Suno # town_5 Jelkala # town_6 Praven # town_7 Uxkhal # town_8 Reyvadin # town_9 Khudan # town_10 Tulga # town_11 Curaw # town_12 Wercheg # town_13 Rivacheg # town_14 Halmar #################################################################################################################### # Some constant and function declarations to be used below... # wp_one_handed () | wp_two_handed () | wp_polearm () | wp_archery () | wp_crossbow () | wp_throwing () def wp(x): n = 0 r = 10 + int(x / 10) # n |= wp_one_handed(x + random.randrange(r)) # n |= wp_two_handed(x + random.randrange(r)) # n |= wp_polearm(x + random.randrange(r)) # n |= wp_archery(x + random.randrange(r)) # n |= wp_crossbow(x + random.randrange(r)) # n |= wp_throwing(x + random.randrange(r)) n |= wp_one_handed(x) n |= wp_two_handed(x) n |= wp_polearm(x) n |= wp_archery(x) n |= wp_crossbow(x) n |= wp_throwing(x) return n def wpe(m,a,c,t): n = 0 n |= wp_one_handed(m) n |= wp_two_handed(m) n |= wp_polearm(m) n |= wp_archery(a) n |= wp_crossbow(c) n |= wp_throwing(t) return n def wpex(o,w,p,a,c,t): n = 0 n |= wp_one_handed(o) n |= wp_two_handed(w) n |= wp_polearm(p) n |= wp_archery(a) n |= wp_crossbow(c) n |= wp_throwing(t) n |= wp_firearm(10) return n def wp_melee(x): n = 0 r = 10 + int(x / 10) # n |= wp_one_handed(x + random.randrange(r)) # n |= wp_two_handed(x + random.randrange(r)) # n |= wp_polearm(x + random.randrange(r)) n |= wp_one_handed(x + 20) n |= wp_two_handed(x) n |= wp_polearm(x + 10) return n #Skills knows_common = knows_trade_2|knows_inventory_management_2|knows_prisoner_management_1|knows_leadership_1 def_attrib = str_7 | agi_5 | int_4 | cha_4 def_attrib_multiplayer = str_14 | agi_14 | int_4 | cha_4 #These face codes are generated by the in-game face generator. #Enable edit mode and press ctrl+E in face generator screen to obtain face codes. reserved = 0 no_scene = 0 swadian_face_younger_1 = 0x0000000000000001124000000020000000000000001c00800000000000000000 swadian_face_young_1 = 0x0000000400000001124000000020000000000000001c00800000000000000000 swadian_face_middle_1 = 0x0000000800000001124000000020000000000000001c00800000000000000000 swadian_face_old_1 = 0x0000000d00000001124000000020000000000000001c00800000000000000000 swadian_face_older_1 = 0x0000000fc0000001124000000020000000000000001c00800000000000000000 swadian_face_younger_2 = 0x00000000000062c76ddcdf7feefbffff00000000001efdbc0000000000000000 swadian_face_young_2 = 0x00000003c00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 swadian_face_middle_2 = 0x00000007c00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 swadian_face_old_2 = 0x0000000bc00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 swadian_face_older_2 = 0x0000000fc00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 vaegir_face_younger_1 = 0x0000000000000001124000000020000000000000001c00800000000000000000 vaegir_face_young_1 = 0x0000000400000001124000000020000000000000001c00800000000000000000 vaegir_face_middle_1 = 0x0000000800000001124000000020000000000000001c00800000000000000000 vaegir_face_old_1 = 0x0000000d00000001124000000020000000000000001c00800000000000000000 vaegir_face_older_1 = 0x0000000fc0000001124000000020000000000000001c00800000000000000000 vaegir_face_younger_2 = 0x000000003f00230c4deeffffffffffff00000000001efff90000000000000000 vaegir_face_young_2 = 0x00000003bf00230c4deeffffffffffff00000000001efff90000000000000000 vaegir_face_middle_2 = 0x00000007bf00230c4deeffffffffffff00000000001efff90000000000000000 vaegir_face_old_2 = 0x0000000cbf00230c4deeffffffffffff00000000001efff90000000000000000 vaegir_face_older_2 = 0x0000000ff100230c4deeffffffffffff00000000001efff90000000000000000 khergit_face_younger_1 = 0x0000000009003109207000000000000000000000001c80470000000000000000 khergit_face_young_1 = 0x00000003c9003109207000000000000000000000001c80470000000000000000 khergit_face_middle_1 = 0x00000007c9003109207000000000000000000000001c80470000000000000000 khergit_face_old_1 = 0x0000000b89003109207000000000000000000000001c80470000000000000000 khergit_face_older_1 = 0x0000000fc9003109207000000000000000000000001c80470000000000000000 khergit_face_younger_2 = 0x000000003f0061cd6d7ffbdf9df6ebee00000000001ffb7f0000000000000000 khergit_face_young_2 = 0x00000003bf0061cd6d7ffbdf9df6ebee00000000001ffb7f0000000000000000 khergit_face_middle_2 = 0x000000077f0061cd6d7ffbdf9df6ebee00000000001ffb7f0000000000000000 khergit_face_old_2 = 0x0000000b3f0061cd6d7ffbdf9df6ebee00000000001ffb7f0000000000000000 khergit_face_older_2 = 0x0000000fff0061cd6d7ffbdf9df6ebee00000000001ffb7f0000000000000000 nord_face_younger_1 = 0x0000000000000001124000000020000000000000001c00800000000000000000 nord_face_young_1 = 0x0000000400000001124000000020000000000000001c00800000000000000000 nord_face_middle_1 = 0x0000000800000001124000000020000000000000001c00800000000000000000 nord_face_old_1 = 0x0000000d00000001124000000020000000000000001c00800000000000000000 nord_face_older_1 = 0x0000000fc0000001124000000020000000000000001c00800000000000000000 nord_face_younger_2 = 0x00000000310023084deeffffffffffff00000000001efff90000000000000000 nord_face_young_2 = 0x00000003b10023084deeffffffffffff00000000001efff90000000000000000 nord_face_middle_2 = 0x00000008310023084deeffffffffffff00000000001efff90000000000000000 nord_face_old_2 = 0x0000000c710023084deeffffffffffff00000000001efff90000000000000000 nord_face_older_2 = 0x0000000ff10023084deeffffffffffff00000000001efff90000000000000000 rhodok_face_younger_1 = 0x0000000009002003140000000000000000000000001c80400000000000000000 rhodok_face_young_1 = 0x0000000449002003140000000000000000000000001c80400000000000000000 rhodok_face_middle_1 = 0x0000000849002003140000000000000000000000001c80400000000000000000 rhodok_face_old_1 = 0x0000000cc9002003140000000000000000000000001c80400000000000000000 rhodok_face_older_1 = 0x0000000fc9002003140000000000000000000000001c80400000000000000000 rhodok_face_younger_2 = 0x00000000000062c76ddcdf7feefbffff00000000001efdbc0000000000000000 rhodok_face_young_2 = 0x00000003c00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 rhodok_face_middle_2 = 0x00000007c00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 rhodok_face_old_2 = 0x0000000bc00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 rhodok_face_older_2 = 0x0000000fc00062c76ddcdf7feefbffff00000000001efdbc0000000000000000 man_face_younger_1 = 0x0000000000000001124000000020000000000000001c00800000000000000000 man_face_young_1 = 0x0000000400000001124000000020000000000000001c00800000000000000000 man_face_middle_1 = 0x0000000800000001124000000020000000000000001c00800000000000000000 man_face_old_1 = 0x0000000d00000001124000000020000000000000001c00800000000000000000 man_face_older_1 = 0x0000000fc0000001124000000020000000000000001c00800000000000000000 man_face_younger_2 = 0x000000003f0052064deeffffffffffff00000000001efff90000000000000000 man_face_young_2 = 0x00000003bf0052064deeffffffffffff00000000001efff90000000000000000 man_face_middle_2 = 0x00000007bf0052064deeffffffffffff00000000001efff90000000000000000 man_face_old_2 = 0x0000000bff0052064deeffffffffffff00000000001efff90000000000000000 man_face_older_2 = 0x0000000fff0052064deeffffffffffff00000000001efff90000000000000000 merchant_face_1 = man_face_young_1 merchant_face_2 = man_face_older_2 woman_face_1 = 0x0000000000000001000000000000000000000000001c00000000000000000000 woman_face_2 = 0x00000003bf0030067ff7fbffefff6dff00000000001f6dbf0000000000000000 swadian_woman_face_1 = 0x0000000180102006124925124928924900000000001c92890000000000000000 swadian_woman_face_2 = 0x00000001bf1000061db6d75db6b6dbad00000000001c92890000000000000000 khergit_woman_face_1 = 0x0000000180103006124925124928924900000000001c92890000000000000000 khergit_woman_face_2 = 0x00000001af1030025b6eb6dd6db6dd6d00000000001eedae0000000000000000 refugee_face1 = woman_face_1 refugee_face2 = woman_face_2 girl_face1 = woman_face_1 girl_face2 = woman_face_2 mercenary_face_1 = 0x0000000000000000000000000000000000000000001c00000000000000000000 mercenary_face_2 = 0x0000000cff00730b6db6db6db7fbffff00000000001efffe0000000000000000 vaegir_face1 = vaegir_face_young_1 vaegir_face2 = vaegir_face_older_2 bandit_face1 = man_face_young_1 bandit_face2 = man_face_older_2 undead_face1 = 0x00000000002000000000000000000000 undead_face2 = 0x000000000020010000001fffffffffff #NAMES: # tf_guarantee_all = tf_guarantee_boots|tf_guarantee_armor|tf_guarantee_gloves|tf_guarantee_helmet|tf_guarantee_horse|tf_guarantee_shield|tf_guarantee_ranged tf_guarantee_all_wo_ranged = tf_guarantee_boots|tf_guarantee_armor|tf_guarantee_gloves|tf_guarantee_helmet|tf_guarantee_horse|tf_guarantee_shield troops = [ ["player","Player","Player",tf_hero|tf_unmoveable_in_party_window,no_scene,reserved,fac_player_faction, [], str_12|agi_9|int_4|cha_4,wp(100),0,0x000000018000000136db6db6db6db6db00000000001db6db0000000000000000], ["multiplayer_profile_troop_male","multiplayer_profile_troop_male","multiplayer_profile_troop_male", tf_hero|tf_guarantee_all, 0, 0,fac_commoners, [itm_character_uniform,itm_french_voltigeur_officer_pants,itm_french_versailles,itm_french_briquet_garde], 0, 0, 0, 0x000000018000000136db6db6db6db6db00000000001db6db0000000000000000], ["multiplayer_profile_troop_female","multiplayer_profile_troop_female","multiplayer_profile_troop_female", tf_hero|tf_female|tf_guarantee_all, 0, 0,fac_commoners, [itm_character_uniform,itm_french_voltigeur_officer_pants,itm_french_versailles,itm_french_briquet_garde], 0, 0, 0, 0x000000018000000136db6db6db6db6db00000000001db6db0000000000000000], ["temp_troop","Temp Troop","Temp Troop",tf_hero,no_scene,reserved,fac_commoners,[],def_attrib,0,knows_common|knows_inventory_management_10,0], #################################################################################################################### # Troops before this point are hardwired into the game and their order should not be changed! #################################################################################################################### # These are used as arrays in the scripts. ["temp_array_a","{!}temp_array_a","{!}temp_array_a",tf_hero|tf_inactive, 0,reserved, fac_neutral,[],def_attrib|level(18),wp(60),knows_common, 0], ["multiplayer_data","{!}multiplayer_data","{!}multiplayer_data",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], #Multiplayer ai troops # MM ["british_infantry_ai","British Line Infantry","Line Infantry",tf_guarantee_all,0,0,fac_britain, [itm_british_infantry_ranker,itm_french_voltigeur_officer_pants,itm_33_stovepipe,itm_british_brown_bess,itm_bullets], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry2_ai","German Line Infantry","German Line Infantry",tf_guarantee_all,0,0,fac_britain, [itm_british_kgl_ranker,itm_french_voltigeur_officer_pants,itm_british_kgl_shako_ranker,itm_british_brown_bess,itm_bullets], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_highlander_ai","British Highland Infantry","Highland Infantry",tf_guarantee_all,0,0,fac_britain, [itm_british_highland_ranker,itm_british_highland_kilt,itm_british_highland_kilt_2,itm_british_highland_bonnet_ranker,itm_british_brown_bess,itm_bullets], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_foot_guard_ai","British Foot Guard","Foot Guards",tf_guarantee_all,0,0,fac_britain, [itm_british_guard_ranker,itm_british_coldstream_pants,itm_british_guard_shako_ranker,itm_british_brown_bess,itm_bullets], def_attrib|level(20),wpex(70,5,170,5,130,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_light_infantry_ai","British Light Infantry","Light Infantry",tf_guarantee_all,0,0,fac_britain, [itm_british_light_ranker,itm_french_voltigeur_officer_pants,itm_british_light_shako_ranker,itm_british_brown_bess,itm_bullets], def_attrib|level(20),wpex(40,5,90,5,170,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_rifle_ai","British Rifleman","Riflemen",tf_guarantee_all,0,0,fac_britain, [itm_british_rifle_ranker,itm_british_rifle_pants_green,itm_british_rifle_pants_grey,itm_british_rifle_pants_rolled,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_beret,itm_british_rifle_beret_2,itm_british_baker_rifle,itm_bullets,itm_british_baker_bayonet], def_attrib|level(20),wpex(30,5,90,5,150,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_light_dragoon_ai","British Light Dragoon","Light Dragoons",tf_mounted|tf_guarantee_all,0,0,fac_britain, [itm_british_light_dragoon,itm_british_light_dragoon_pants,itm_british_lightdragoon_shako_ranker,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_british_carbine,itm_bullets,itm_lightdragoon_horse_britain_1,itm_lightdragoon_horse_britain_2,itm_lightdragoon_horse_britain_3,itm_lightdragoon_horse_britain_4], def_attrib|level(20),wpex(40,5,30,5,140,5),knows_common|knows_riding_4|knows_ironflesh_2|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_dragoon_ai","British Dragoon","Heavy Dragoons",tf_mounted|tf_guarantee_all,0,0,fac_britain, [itm_british_inniskilling_ranker,itm_british_cav_pants,itm_british_iniskilling_helmet_ranker,itm_br_cavalry_gloves,itm_british_heavy_cav_sword,itm_heavydragoon_horse_britain], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_horseguard_ai","British Horse Guard","Horse Guards",tf_mounted|tf_guarantee_all,0,0,fac_britain, [itm_british_blue_ranker,itm_british_cav_pants,itm_british_lifeguard_helmet_ranker,itm_br_horseguard_gloves,itm_british_heavy_cav_sword,itm_heavy_horse_britain], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_arty_ai","British Artillerist","Artillery (Cannon)",tf_guarantee_all,0,0,fac_britain, [itm_british_artillery_ranker,itm_french_voltigeur_officer_pants,itm_british_artillery_shako_ranker,itm_ramrod,itm_british_brown_bess,itm_bullets], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_arty_alt_ai","British Artillerist","Artillery (Howitzer)",tf_guarantee_all,0,0,fac_britain, [itm_british_artillery_ranker,itm_french_voltigeur_officer_pants,itm_british_artillery_shako_ranker,itm_ramrod,itm_british_brown_bess,itm_bullets], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_rocket_ai","British Rocketeer","Rocket Artillery",tf_guarantee_all,0,0,fac_britain, [itm_british_rocketeer,itm_british_rocketeer_pants,itm_british_rocket_tarleton,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_rockets], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_ai","French Line Infantry","Line Infantry",tf_guarantee_all,0,0,fac_france, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry2_ai","French Grenadier","Grenadiers",tf_guarantee_all,0,0,fac_france, [itm_french_84e_body_ranker,itm_french_basic_infantry_pants,itm_french_inf_shako_84_ranker,itm_bullets,itm_french_charleville,itm_french_briquet_fake], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_vistula_ai","Polish Line Infantry","Polish Line Infantry",tf_guarantee_all,0,0,fac_france, [itm_french_vistula_body_ranker,itm_french_vistula_pants,itm_french_vistula_shako_ranker,itm_bullets,itm_french_charleville,itm_french_briquet_fake], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_old_guard_ai","French Grenadier Guard","Grenadier Guards",tf_guarantee_all,0,0,fac_france, [itm_french_gap_body_ranker,itm_french_grap_pants,itm_french_gap_bearskin_ranker,itm_bullets,itm_french_versailles,itm_french_briquet_garde_fake,itm_officer_gloves], def_attrib|level(20),wpex(70,5,170,5,130,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_voltigeur_ai","French Voltigeur","Voltigeurs",tf_guarantee_all,0,0,fac_france, [itm_french_voltigeur_body_ranker,itm_french_voltigeur_officer_pants,itm_french_voltigeur_pants,itm_french_voltigeur_shako_ranker,itm_bullets,itm_french_charleville,itm_french_briquet_fake], def_attrib|level(20),wpex(40,5,90,5,170,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_hussar_ai","French Hussar","Hussars",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_hussards_ranker,itm_french_hussards_ranker_pants,itm_french_hussar_shako_ranker,itm_french_light_cav_sabre,itm_hussar_horse_french], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_lancer_ai","Polish Lancer","Polish Lancers",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_lancer_body_ranker,itm_french_lancer_pants,itm_french_ldlg_czapka_ranker,itm_fr_cuirassier_gloves,itm_french_lance,itm_french_light_cav_sabre_garde,itm_lancer_horse_french], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_dragoon_ai","French Dragoon","Dragoons",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_fr_cuirassier_gloves,itm_french_mousquiton,itm_french_mousquiton_light,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_french], def_attrib|level(20),wpex(100,5,30,5,100,5),knows_common|knows_riding_3|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_cuirassier_ai","French Cuirassier","Cuirassiers",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_cuirassier_ranker,itm_rus_horse_guard_pants,itm_french_cuirassier_helmet,itm_fr_cuirassier_gloves,itm_french_line_cav_sabre,itm_cuirassier_horse_french,itm_rus_horse_guard_pants], def_attrib|level(20),wpex(120,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_carabineer_ai","French Carabinier","Carabiniers",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_carabineer_ranker,itm_rus_horse_guard_pants,itm_french_carabineer_helmet,itm_fr_cuirassier_gloves,itm_french_carabineer_sword,itm_carabineer_horse_french], def_attrib|level(20),wpex(120,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_grenadier_a_cheval_ai","French Horse Grenadier","Horse Grenadiers",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_grenadiers_a_cheval_body_ranker,itm_french_grenadiers_a_cheval_pants,itm_grach_bearskin_ranker,itm_fr_cuirassier_gloves,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_french], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_arty_ai","French Artillerist","Artillery (Cannon)",tf_guarantee_all,0,0,fac_france, [itm_french_art_ranker_body,itm_french_art_ranker_body_alt,itm_french_art_ranker_pants,itm_french_artillery_bearskin_ranker,itm_ramrod,itm_bullets,itm_french_charleville], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_arty_alt_ai","French Artillerist","Artillery (Howitzer)",tf_guarantee_all,0,0,fac_france, [itm_french_art_ranker_body,itm_french_art_ranker_body_alt,itm_french_art_ranker_pants,itm_french_artillery_bearskin_ranker,itm_ramrod,itm_bullets,itm_french_charleville], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_ai","Prussian Line Infantry","Line Infantry (Brandenburg)",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_infantry_ranker,itm_prussian_infantry_pants,itm_prussian_shako,itm_prussian_shako_2,itm_russian_briquet_1807_black_fake,itm_prussian_potsdam,itm_bullets], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry2_ai","Prussian Line Infantry","Line Infantry (Rhen)",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_infantry2_ranker,itm_prussian_infantry_pants,itm_prussian_shako,itm_prussian_shako_2,itm_prussian_infantry2_hat,itm_russian_briquet_1807_black_fake,itm_prussian_potsdam,itm_bullets], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_kurmark_ai","Prussian Landwehr","Landwehr",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_landwehr_ranker,itm_prussian_landwehr_ranker_alt,itm_prussian_landwehr_pants,itm_prussian_landwehr_hat,itm_prussian_landwehr_hat_2,itm_prussian_landwehr_hat_3,itm_russian_briquet_1807_landwehr_fake,itm_russian_peasant_axe_landwehr_fake,itm_prussian_potsdam,itm_bullets], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_freikorps_ai","Prussian Freikorps","Freikorps",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_freikorps_ranker,itm_prussian_freikorps_pants,itm_prussian_shako_2,itm_russian_briquet_1807_black_blackbelt_fake,itm_prussian_potsdam,itm_bullets], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_15_ai","Prussian Foot Guard","Foot Guards",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_guard_ranker,itm_austrian_officer_boots,itm_rus_infantry_pants2,itm_prussian_guard_ranker_shako,itm_russian_briquet_1807_black_fake,itm_prussian_potsdam,itm_bullets], def_attrib|level(20),wpex(70,5,170,5,130,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_rifle_ai","Prussian Jaeger","Jaegers",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_jaeger_ranker,itm_prussian_jaeger_ranker_alt,itm_prussian_jaeger_pants,itm_prussian_shako_2,itm_russian_jaeger_bayonet_jaeger,itm_russian_rifle_1805,itm_bullets], def_attrib|level(20),wpex(30,5,90,5,150,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_dragoon_ai","Prussian Dragoon","Dragoons",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_dragoon_ranker,itm_prussian_cavalry_pants,itm_prussian_dragoon_shako_ranker,itm_british_light_cav_sabre,itm_russian_dragoon_musket,itm_bullets,itm_dragoon_horse_prussia_1], def_attrib|level(20),wpex(100,5,30,5,100,5),knows_common|knows_riding_3|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_hussar_ai","Prussian Hussar","Hussars",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_hussar_ranker,itm_prussian_hussar_pants,itm_prussian_hussar_shako,itm_british_light_cav_sabre,itm_hussar_horse_prussia_1,itm_hussar_horse_prussia_2], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_landwehr_cav_ai","Prussian Lancer","Lancers",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_landwehr_cav_ranker,itm_prussian_landwehr_pants2,itm_prussian_landwehr_cav_shako,itm_prussian_lance,itm_british_light_cav_sabre,itm_lancer_horse_prussia_1,itm_lancer_horse_prussia_2], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_cuirassier_ai","Prussian Cuirassier","Cuirassiers",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_cuirassier_ranker,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_cuirassier_helmet,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_prussia_1,itm_heavy_horse_prussia_2], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_arty_ai","Prussian Artillerist","Artillery (Cannon)",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_arty_ranker,itm_prussian_infantry_pants,itm_prussian_arty_shako_ranker,itm_ramrod,itm_bullets,itm_prussian_potsdam], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_arty_alt_ai","Prussian Artillerist","Artillery (Howitzer)",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_arty_ranker,itm_prussian_infantry_pants,itm_prussian_arty_shako_ranker,itm_ramrod,itm_bullets,itm_prussian_potsdam], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_partizan_ai","Russian Partisan","Partisans",tf_guarantee_all_wo_ranged,0,0,fac_russia, [itm_rus_partizan1,itm_rus_partizan2,itm_rus_militia_ranker_pants,itm_rus_militia_ranker_pants1,itm_rus_opol_hat_ranker,itm_rus_partisan_hat1,itm_rus_partisan_hat2,itm_rus_partisan_hat3,itm_rus_partisan_hat4,itm_rus_partisan_hat5,itm_rus_opol_hat_ranker,itm_rus_drummer_shako,itm_bullets,itm_russian_dragoon_musket,itm_russian_peasant_fork,itm_russian_peasant_pitchfork,itm_russian_peasant_sap,itm_russian_peasant_kosa,itm_russian_peasant_kosa2,itm_birch_trunk,itm_brokenbottle,itm_russian_peasant_club,itm_russian_peasant_birch_club,itm_russian_peasant_axe,itm_russian_peasant_knife,itm_russian_peasant_serp,itm_russian_peasant_pike,itm_russian_peasant_kuvalda,itm_russian_peasant_2handed_axe,itm_russian_peasant_rogatina,itm_russian_gusarskiy_karabin], def_attrib|level(20),wpex(40,5,80,5,80,60),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_opol_ai","Russian Militia","Line Militia",tf_guarantee_all_wo_ranged,0,0,fac_russia, [itm_russian_militia_ranker,itm_rus_militia_ranker_pants,itm_rus_militia_ranker_pants1,itm_rus_opol_hat_ranker,itm_bullets,itm_russian_dragoon_musket,itm_russian_opolcheniye_pike,itm_russian_opolcheniye_pike,itm_russian_peasant_axe], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_ai","Russian Line Infantry","Line Infantry",tf_guarantee_all,0,0,fac_russia, [itm_russian_infantry1,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_drummer_shako,itm_bullets,itm_russian_musket_1808,itm_russian_briquet_1807_fake], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_grenadier_ai","Russian Grenadier","Grenadiers",tf_guarantee_all,0,0,fac_russia, [itm_russian_gren_ranker,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_pavlovsk_ranker,itm_bullets,itm_russian_musket_1808,itm_russian_briquet_1807_fake,itm_officer_gloves], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_foot_guard_ai","Russian Foot Guard","Foot Guards",tf_guarantee_all,0,0,fac_russia, [itm_russian_guard_ranker,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_guard_shako_ranker,itm_bullets,itm_russian_musket_1808,itm_russian_briquet_1807_fake,itm_officer_gloves], def_attrib|level(20),wpex(70,5,170,5,130,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_rifle_ai","Russian Jaeger","Jaegers",tf_guarantee_all,0,0,fac_russia, [itm_russian_jaeger_ranker,itm_rus_jaeger_pants,itm_rus_jaeger_shako_ranker,itm_russian_rifle_1805,itm_bullets,itm_russian_jaeger_bayonet_jaeger], def_attrib|level(20),wpex(30,5,90,5,150,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_hussar_ai","Russian Hussar","Hussars",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_hussar_ranker,itm_rus_hussar_pants_nco,itm_rus_hussar_shako_ranker,itm_russian_sabre_1809,itm_hussar_horse_russia], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_uhlan_ai","Russian Uhlan","Uhlans",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_uhlan_ranker,itm_rus_uhlan_pants,itm_rus_uhlan_czapka_ranker,itm_russian_lancer_pike,itm_russian_sabre_1798,itm_lancer_horse_russia], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_cossack_ai","Russian Cossack","Cossacks",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_cossack,itm_rus_cossack_off_pants,itm_rus_cossack_hat_ranker,itm_russian_cossack_pike,itm_russian_sabre_1798,itm_cossack_horse_russia_1,itm_cossack_horse_russia_2,itm_cossack_horse_russia_3,itm_cossack_horse_russia_4], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_dragoon_ai","Russian Dragoon","Dragoons",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_dragoon_ranker,itm_rus_dragoon_pants1,itm_rus_dragoon_pants2,itm_rus_kyiv_dragoons_all,itm_russian_dragoon_musket,itm_bullets,itm_russian_sword_1810,itm_dragoon_horse_russia], def_attrib|level(20),wpex(100,5,30,5,100,5),knows_common|knows_riding_3|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_horse_guard_ai","Russian Cavalry Guard","Cavalry Guards",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_horse_guard,itm_rus_horse_guard_pants,itm_rus_chevalier_hat,itm_russian_guard_sword_1799,itm_heavy_horse_russia,itm_rus_chevgarde_gloves], def_attrib|level(20),wpex(120,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_arty_ai","Russian Artillerist","Artillery (Cannon)",tf_guarantee_all,0,0,fac_russia, [itm_russian_arty_ranker,itm_rus_arty_pants,itm_rus_arty_shako_ranker,itm_ramrod,itm_bullets,itm_russian_musket_1808], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_arty_alt_ai","Russian Artillerist","Artillery (Howitzer)",tf_guarantee_all,0,0,fac_russia, [itm_russian_arty_ranker,itm_rus_arty_pants,itm_rus_arty_shako_ranker,itm_ramrod,itm_bullets,itm_russian_musket_1808], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_ai","Austrian Line Infantry","Line Infantry",tf_guarantee_all,0,0,fac_austria, [itm_austrian_infantry,itm_aus_infantry_ranker,itm_austrian_infantry_pants,itm_bullets,itm_austrian_musket], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry2_ai","Hungarian Line Infantry","Line Infantry",tf_guarantee_all,0,0,fac_austria, [itm_austrian_infantry2,itm_aus_infantry_ranker,itm_hungarian_pants,itm_bullets,itm_austrian_musket], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenzer_ai","Austrian Grenzer","Grenzers",tf_guarantee_all,0,0,fac_austria, [itm_austrian_grenzer,itm_aus_grenzer_ranker,itm_hungarian_pants,itm_austrian_musket,itm_austrian_musket,itm_austrian_musket,itm_austrian_musket,itm_russian_rifle_1805,itm_russian_rifle_1805,itm_russian_gusarskiy_karabin,itm_bullets,itm_austrian_jaeger_bayonet_invis], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenadier_ai","Hungarian Grenadier","Grenadiers",tf_guarantee_all,0,0,fac_austria, [itm_austrian_grenadier,itm_austrian_grenadier_alt,itm_aus_grenadier_bearskin,itm_hungarian_pants,itm_bullets,itm_austrian_musket,itm_austrian_infantry_briquet_fake,itm_officer_gloves], def_attrib|level(20),wpex(70,5,170,5,130,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_rifle_ai","Austrian Jaeger","Jaegers",tf_guarantee_all,0,0,fac_austria, [itm_austrian_jaeger,itm_aus_tyrol_hat,itm_austrian_jaeger_pants,itm_russian_rifle_1805,itm_bullets,itm_austrian_jaeger_bayonet], def_attrib|level(20),wpex(30,5,90,5,150,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_hussar_ai","Austrian Hussar","Hussars",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_hussar,itm_aus_hussard_shako_ranker,itm_hungarian_hussar_pants,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_hussar_horse_austria], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_uhlan_ai","Austrian Uhlan","Uhlans",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_uhlan,itm_aus_uhlan_czapka,itm_hungarian_uhlan_pants,itm_br_cavalry_gloves_short,itm_austrian_lance,itm_british_light_cav_sabre,itm_lancer_horse_austria], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_light_horse_ai","Austrian Chevauleger","Chevaulegers",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_lightcav,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_russian_dragoon_musket,itm_bullets,itm_russian_sword_1810,itm_lightcav_horse_austria], def_attrib|level(20),wpex(40,5,30,5,140,5),knows_common|knows_riding_4|knows_ironflesh_2|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_dragoon_ai","Austrian Dragoon","Dragoons",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_dragoon,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_russian_dragoon_musket,itm_bullets,itm_russian_sword_1810,itm_dragoon_horse_austria], def_attrib|level(20),wpex(100,5,30,5,100,5),knows_common|knows_riding_3|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_cuirassier_ai","Austrian Cuirassier","Cuirassiers",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_cuiraisser,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_rus_chevgarde_gloves,itm_british_heavy_cav_sword,itm_heavy_horse_austria,itm_rus_chevgarde_gloves], def_attrib|level(20),wpex(120,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_arty_ai","Austrian Artillerist","Artillery (Cannon)",tf_guarantee_all,0,0,fac_austria, [itm_austrian_arty,itm_aus_arty_bicorn,itm_austrian_officer_boots,itm_ramrod,itm_bullets,itm_austrian_musket], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_arty_alt_ai","Austrian Artillerist","Artillery (Howitzer)",tf_guarantee_all,0,0,fac_austria, [itm_austrian_arty,itm_aus_arty_bicorn,itm_austrian_officer_boots,itm_ramrod,itm_bullets,itm_austrian_musket], def_attrib|level(20),wpex(50,5,50,5,80,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], #Multiplayer troops ### BRITAIN ### #original #["british_infantry","33rd Regiment of Foot","Line Infantry",tf_guarantee_all,0,0,fac_britain, #[itm_british_infantry_ranker,itm_french_voltigeur_officer_pants,itm_33_stovepipe,itm_british_brown_bess,itm_bullets], #def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry","33rd Regiment of Foot","Line Infantry",tf_guarantee_all,0,0,fac_britain,[itm_british_infantry_ranker,itm_french_voltigeur_officer_pants,itm_33_stovepipe,itm_british_brown_bess,itm_bullets], #[itm_british_infantry_ranker,itm_french_voltigeur_officer_pants,itm_independent_kentucky_rifle,itm_native_iroquois_tomahawk,itm_native_iroquois_tomahawk_melee,itm_native_cherokee_tomahawk,itm_native_cherokee_tomahawk_melee,itm_native_headache_club], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,khergit_face_middle_1, khergit_face_old_2], #New World Conflict Troops #["british_cherokee_warrior","Cherokee Warrior","Cherokee Warriors",tf_guarantee_all,0,0,fac_britain, # [itm_british_infantry_ranker,itm_french_voltigeur_officer_pants,itm_independent_kentucky_rifle,itm_native_iroquois_tomahawk,itm_native_iroquois_tomahawk_melee,itm_native_cherokee_tomahawk,itm_native_cherokee_tomahawk_melee,itm_native_headache_club], # def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,khergit_face_middle_1, khergit_face_old_2], ["british_infantry_nco","33rd Regiment of Foot","Ensign",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_infantry_sarge,itm_rus_dragoon_pants1,itm_33_stovepipe,itm_br_cavalry_gloves_short,itm_britain_colour_33rd_regt,itm_britain_colour_33rd_king,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(50,5,130,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry_officer","33rd Regiment of Foot","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_infantry_officer,itm_rus_dragoon_pants1,itm_33_stovepipe,itm_br_cavalry_gloves_short,itm_british_officer_sword,itm_british_pistol,itm_pistol_ammo,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry_drum","33rd Regiment of Foot","Drummer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_infantry_drum,itm_french_voltigeur_officer_pants,itm_33_stovepipe,itm_drummer_gloves,itm_drumstick_right,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry_flute","33rd Regiment of Foot","Fifer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_infantry_flute,itm_french_voltigeur_officer_pants,itm_33_stovepipe,itm_flute,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry2","5th Line Battalion King's German Legion","Line Infantry",tf_guarantee_all,0,0,fac_britain, [itm_british_kgl_ranker,itm_french_voltigeur_officer_pants,itm_british_kgl_shako_ranker,itm_british_brown_bess,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry2_nco","Kings German Legion 5th Battalion","Ensign",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_kgl_sarge,itm_rus_dragoon_pants1,itm_british_kgl_shako_officer,itm_br_cavalry_gloves_short,itm_britain_colour_kgl_regt,itm_britain_colour_kgl_king,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(50,5,130,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry2_officer","Kings German Legion 5th Battalion","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_kgl_officer,itm_rus_dragoon_pants1,itm_british_kgl_shako_officer,itm_br_cavalry_gloves_short,itm_british_officer_sword,itm_british_pistol,itm_pistol_ammo,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry2_drum","Kings German Legion 5th Battalion","Drummer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_kgl_drum,itm_french_voltigeur_officer_pants,itm_british_kgl_shako_ranker,itm_drummer_gloves,itm_drumstick_right,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_infantry2_flute","Kings German Legion 5th Battalion","Fifer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_kgl_flute,itm_french_voltigeur_officer_pants,itm_british_kgl_shako_ranker,itm_flute,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_highlander","42nd Regiment of Foot (Black Watch)","Line Infantry",tf_guarantee_all,0,0,fac_britain, [itm_british_highland_ranker,itm_british_highland_kilt,itm_british_highland_kilt_2,itm_british_highland_bonnet_ranker,itm_british_brown_bess,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,500,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_highlander_nco","42nd Highland Regiment of Foot","Ensign",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_highland_sarge,itm_rus_dragoon_pants1,itm_british_highland_bonnet_ensign,itm_br_cavalry_gloves_short,itm_britain_colour_42nd_regt,itm_britain_colour_42nd_king,itm_british_highlander_officer_sword], def_attrib_multiplayer|level(20),wpex(50,5,130,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_highlander_officer","42nd Highland Regiment of Foot","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_highland_officer,itm_rus_dragoon_pants1,itm_british_highland_bonnet_officer,itm_br_cavalry_gloves_short,itm_british_highlander_officer_sword,itm_british_pistol,itm_pistol_ammo,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_highlander_drum","42nd Highland Regiment of Foot","Drummer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_highland_drummer,itm_british_highland_kilt_officer,itm_british_highland_bonnet_drummer,itm_drummer_gloves,itm_drumstick_right,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_highlander_pipes","42nd Highland Regiment of Foot","Piper",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_highland_piper,itm_british_highland_piper_2,itm_british_highland_kilt_officer,itm_british_highland_bonnet_ranker,itm_bagpipe,itm_british_highlander_officer_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_foot_guard","Coldstream Regiment of Foot Guards","Foot Guard",tf_guarantee_all,0,0,fac_britain, [itm_british_guard_ranker,itm_british_coldstream_pants,itm_british_guard_shako_ranker,itm_british_brown_bess,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,145,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_foot_guard_nco","2nd Regiment of Foot Guards (Coldstream)","Ensign",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_guard_sarge,itm_rus_dragoon_pants1,itm_british_guard_shako_officer,itm_br_cavalry_gloves_short,itm_britain_colour_2nd_regt,itm_britain_colour_2nd_king,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(50,5,130,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_foot_guard_officer","2nd Regiment of Foot Guards (Coldstream)","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_guard_officer,itm_rus_dragoon_pants1,itm_british_guard_shako_officer,itm_br_cavalry_gloves_short,itm_british_pistol,itm_pistol_ammo,itm_british_officer_sword,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_foot_guard_drum","2nd Regiment of Foot Guards (Coldstream)","Drummer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_guard_drum,itm_british_coldstream_pants,itm_british_guard_shako_ranker,itm_drumstick_right,itm_drummer_gloves,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_foot_guard_flute","2nd Regiment of Foot Guards (Coldstream)","Fifer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_guard_flute,itm_british_coldstream_pants,itm_british_guard_shako_ranker,itm_flute,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_light_infantry","51st (2nd Yorkshire West Riding) Regiment of Foot","Light Infantry",tf_guarantee_all,0,0,fac_britain, [itm_british_light_ranker,itm_french_voltigeur_officer_pants,itm_british_light_shako_ranker,itm_british_brown_bess,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,90,5,206,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_light_infantry_nco","51st Regiment of Foot","Ensign",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_light_sarge,itm_rus_dragoon_pants1,itm_british_light_shako_officer,itm_br_cavalry_gloves_short,itm_britain_colour_51st_regt,itm_britain_colour_51st_king,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_light_infantry_officer","51st Regiment of Foot","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_light_officer,itm_rus_dragoon_pants1,itm_british_light_shako_officer,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_british_pistol,itm_pistol_ammo,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_light_infantry_horn","51st Regiment of Foot","Hornist",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_light_bugler,itm_french_voltigeur_officer_pants,itm_british_light_shako_ranker,itm_horn,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_rifle","95th Regiment of Foot (Rifles)","Rifleman",tf_guarantee_all,0,0,fac_britain, [itm_british_rifle_ranker,itm_british_rifle_pants_green,itm_british_rifle_pants_grey,itm_british_rifle_pants_rolled,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_beret,itm_british_rifle_beret_2,itm_british_baker_rifle,itm_bullets,itm_british_baker_bayonet], def_attrib_multiplayer|level(20),wpex(50,5,90,5,206,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_rifle_nco","95th Rifle Regiment of Foot","Sergeant",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_rifle_sarge,itm_british_rifle_pants_green,itm_british_rifle_pants_grey,itm_british_rifle_pants_rolled,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_beret,itm_british_rifle_beret_2,itm_br_cavalry_gloves_short,itm_british_baker_rifle,itm_bullets,itm_british_baker_bayonet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_rifle_officer","95th Rifle Regiment of Foot","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_rifle_captain,itm_british_rifle_captain_pants,itm_british_rifle_shako_officer,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_british_pistol,itm_pistol_ammo,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_rifle_horn","95th Rifle Regiment of Foot","Hornist",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_rifle_bugler,itm_british_rifle_pants_green,itm_british_rifle_pants_grey,itm_british_rifle_pants_rolled,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_shako_ranker,itm_british_rifle_beret,itm_british_rifle_beret_2,itm_horn,itm_british_baker_bayonet], #,itm_british_baker_rifle,itm_bullets def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_light_dragoon","23rd Light Dragoons","Light Horse",tf_mounted|tf_guarantee_all,0,0,fac_britain, [itm_british_light_dragoon,itm_british_light_dragoon_pants,itm_british_lightdragoon_shako_ranker,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_british_carbine,itm_bullets,itm_lightdragoon_horse_britain_1,itm_lightdragoon_horse_britain_2,itm_lightdragoon_horse_britain_3,itm_lightdragoon_horse_britain_4], def_attrib|level(20),wpex(70,5,30,5,155,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["british_light_dragoon_nco","23rd Light Dragoons","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_light_dragoon,itm_british_light_dragoon_pants,itm_british_lightdragoon_shako_ranker,itm_br_cavalry_gloves_short,itm_britain_colour_blues,itm_british_light_cav_sabre,itm_british_carbine,itm_bullets,itm_lightdragoon_horse_britain_1,itm_lightdragoon_horse_britain_2,itm_lightdragoon_horse_britain_3,itm_lightdragoon_horse_britain_4], def_attrib|level(20),wpex(80,5,30,5,155,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["british_light_dragoon_officer","23rd Light Dragoons","Officer",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_light_dragoon_officer,itm_british_light_dragoon_pants,itm_british_lightdragoon_shako_officer,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_british_pistol,itm_pistol_ammo,itm_lightdragoon_horse_britain_1,itm_lightdragoon_horse_britain_2,itm_lightdragoon_horse_britain_3,itm_lightdragoon_horse_britain_4,itm_spyglass], def_attrib|level(20),wpex(80,5,30,5,80,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["british_light_dragoon_bugle","23rd Light Dragoons","Bugler",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_light_dragoon,itm_british_light_dragoon_pants,itm_british_lightdragoon_shako_trumpeter,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_bugle,itm_lightdragoon_horse_britain_1,itm_lightdragoon_horse_britain_2,itm_lightdragoon_horse_britain_3,itm_lightdragoon_horse_britain_4], def_attrib|level(20),wpex(80,5,30,5,80,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["british_dragoon","6th (Inniskilling) Dragoons","Heavy Cavalry",tf_mounted|tf_guarantee_all,0,0,fac_britain, [itm_british_inniskilling_ranker,itm_british_cav_pants,itm_british_iniskilling_helmet_ranker,itm_br_cavalry_gloves,itm_british_heavy_cav_sword,itm_heavydragoon_horse_britain], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_dragoon_nco","6th (Inniskilling) Dragoons","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_inniskilling_ranker,itm_british_cav_pants,itm_british_iniskilling_helmet_ranker,itm_br_cavalry_gloves,itm_britain_colour_blues,itm_british_heavy_cav_sword,itm_heavydragoon_horse_britain], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_dragoon_officer","6th (Inniskilling) Dragoons","Officer",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_inniskilling_officer,itm_british_cav_pants,itm_british_iniskilling_helmet_officer,itm_br_cavalry_gloves_short,itm_british_heavy_cav_sword,itm_british_pistol,itm_pistol_ammo,itm_heavydragoon_horse_britain,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_dragoon_bugle","6th (Inniskilling) Dragoons","Bugler",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_inniskilling_ranker,itm_british_cav_pants,itm_british_iniskilling_helmet_trumpeter,itm_br_cavalry_gloves,itm_british_heavy_cav_sword,itm_bugle,itm_heavydragoon_horse_britain], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_horseguard","Royal Horse Guards Blue","Heavy Cavalry",tf_mounted|tf_guarantee_all,0,0,fac_britain, [itm_british_blue_ranker,itm_british_cav_pants,itm_british_lifeguard_helmet_ranker,itm_br_horseguard_gloves,itm_british_heavy_cav_sword,itm_heavy_horse_britain], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_horseguard_nco","Royal Horse Guards Blue","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_blue_ranker,itm_british_cav_pants,itm_british_lifeguard_helmet_ranker,itm_br_horseguard_gloves,itm_britain_colour_blues,itm_british_heavy_cav_sword,itm_heavy_horse_britain], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_horseguard_officer","Royal Horse Guards Blue","Officer",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_blue_officer,itm_british_cav_pants,itm_british_lifeguard_helmet_officer,itm_br_horseguard_gloves_short,itm_british_heavy_cav_sword,itm_british_pistol,itm_pistol_ammo,itm_heavy_horse_britain,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_horseguard_bugle","Royal Horse Guards Blue","Bugler",tf_mounted|tf_guarantee_all,0,0,fac_british_ranks, [itm_british_blue_ranker,itm_british_cav_pants,itm_british_lifeguard_helmet_trumpeter,itm_br_horseguard_gloves,itm_british_heavy_cav_sword,itm_bugle,itm_heavy_horse_britain], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_arty","Royal Foot Artillery","Artillery",tf_guarantee_all,0,0,fac_britain, [itm_british_artillery_ranker,itm_french_voltigeur_officer_pants,itm_british_artillery_shako_ranker,itm_ramrod,itm_cannon_lighter,itm_british_musician_sword_invis], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_arty_nco","Royal Foot Artillery","Artillery Train",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_artillery_train,itm_british_light_dragoon_pants,itm_british_rocket_tarleton,itm_br_cavalry_gloves_short,itm_cannon_lighter,itm_arty_horse_cannon_british,itm_arty_horse_howitzer_british,itm_british_musician_sword], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_arty_officer","Royal Foot Artillery","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_artillery_officer,itm_rus_dragoon_pants1,itm_british_artillery_shako_officer,itm_br_cavalry_gloves_short,itm_british_officer_sword,itm_cannon_lighter,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_rocket","2nd Rocket Troop","Rocket Artillery",tf_guarantee_all,0,0,fac_britain, [itm_british_rocketeer,itm_british_rocketeer_pants,itm_british_rocket_tarleton,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_cannon_lighter,itm_rockets], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_sapper","Sapper","Engineer",tf_guarantee_all,0,0,fac_britain, [itm_british_sapper,itm_british_sapper_pants,itm_british_guard_shako_ranker,itm_sapper_axe,itm_construction_hammer,itm_shovel,itm_russian_sappeur_dagger_invis], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["wellington","Arthur Wellesley, Duke of Wellington","Commander",tf_mounted|tf_guarantee_all,0,0,fac_britain, [itm_british_wellington,itm_british_wellington_pants,itm_british_wellington_bicorne,itm_br_cavalry_gloves_short,itm_heavy_horse_britain,itm_french_line_cav_sabre,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_5|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ### FRANCE ### ["french_infantry","45e Regiment d'Infanterie de ligne","Line Infantry",tf_guarantee_all,0,0,fac_france, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_nco","45e Regiment d'Infanterie de ligne","Eagle Bearer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_45e_body_colours,itm_french_captain_pants,itm_french_inf_bicorne_45_officer,itm_flag_france_45e,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_officer","45e Regiment d'Infanterie de ligne","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_45e_body_officer,itm_french_captain_pants,itm_french_inf_bicorne_45_officer,itm_french_inf_off_sabre,itm_pistol_ammo,itm_french_officer_pistol,itm_french_pistol_1766,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_drum","45e Regiment d'Infanterie de ligne","Drummer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_45e_body_drummer,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_drummer_gloves,itm_drumstick_right,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_flute","45e Regiment d'Infanterie de ligne","Fifer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_45e_body_flautist,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_flute,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry2","84e Regiment d'Infanterie de ligne","Line Infantry",tf_guarantee_all,0,0,fac_france, [itm_french_84e_body_ranker,itm_french_basic_infantry_pants,itm_french_inf_shako_84_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry2_nco","84e Regiment d'Infanterie de ligne","Eagle Bearer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_84e_body_sarge,itm_french_captain_pants,itm_french_inf_shako_84_colours,itm_flag_france_84e,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry2_officer","84e Regiment d'Infanterie de ligne","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_84e_body_officer,itm_fr_officer_bottefortes,itm_french_inf_shako_84_officer,itm_french_inf_off_sabre,itm_pistol_ammo,itm_french_officer_pistol,itm_french_pistol_1766,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry2_drum","84e Regiment d'Infanterie de ligne","Drummer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_84e_body_drummer,itm_french_basic_infantry_pants,itm_french_inf_shako_84_ranker,itm_drummer_gloves,itm_drumstick_right,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry2_flute","84e Regiment d'Infanterie de ligne","Fifer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_84e_body_flautist,itm_french_basic_infantry_pants,itm_french_inf_shako_84_ranker,itm_flute,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_vistula","Legion de la Vistule","Line Infantry",tf_guarantee_all,0,0,fac_france, [itm_french_vistula_body_ranker,itm_french_vistula_pants,itm_french_vistula_shako_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_vistula_colours","Legion de la Vistule","Eagle Bearer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_vistula_body_colours,itm_french_vistula_pants,itm_french_vistula_shako_colours,itm_flag_france_vistula,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_vistula_officer","Legion de la Vistule","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_vistula_body_officer,itm_fr_officer_bottefortes,itm_french_vistula_shako_officer,itm_french_inf_off_sabre,itm_pistol_ammo,itm_french_officer_pistol,itm_french_pistol_1766,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_vistula_drum","Legion de la Vistule","Drummer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_vistula_body_drummer,itm_french_vistula_pants,itm_french_vistula_shako_ranker,itm_drummer_gloves,itm_drumstick_right,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_infantry_vistula_flute","Legion de la Vistule","Fifer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_vistula_body_flautist,itm_french_vistula_pants,itm_french_vistula_shako_ranker,itm_flute,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_old_guard","1er Regiment de Grenadiers de la Garde Imperiale","Foot Guard",tf_guarantee_all,0,0,fac_france, [itm_french_gap_body_ranker,itm_french_grap_pants,itm_french_gap_bearskin_ranker,itm_bullets,itm_french_versailles,itm_french_briquet_garde], def_attrib_multiplayer|level(20),wpex(50,5,145,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_old_guard_nco","1er Regiment de Grenadiers de la Garde Imperiale","Eagle Bearer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_gap_body_colours,itm_french_captain_pants,itm_french_gap_bearskin_colours,itm_flag_france_grenadiers,itm_french_briquet_garde], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_old_guard_officer","1er Regiment de Grenadiers de la Garde Imperiale","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_gap_body_officer,itm_french_captain_pants,itm_french_gap_bearskin_officer,itm_french_inf_off_sabre_garde,itm_pistol_ammo,itm_french_officer_pistol,itm_french_pistol_1766,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_old_guard_drum","1er Regiment de Grenadiers de la Garde Imperiale","Drummer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_grap_body_drummer,itm_french_grap_pants,itm_french_gap_bearskin_ranker,itm_drummer_gloves,itm_drumstick_right,itm_french_briquet_garde], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_old_guard_flute","1er Regiment de Grenadiers de la Garde Imperiale","Fifer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_grap_body_flautist,itm_french_grap_pants,itm_french_gap_bearskin_ranker,itm_flute,itm_french_briquet_garde,itm_officer_gloves], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_voltigeur","15eme Regiment d'Infanterie Legere","Light Infantry",tf_guarantee_all,0,0,fac_france, [itm_french_voltigeur_body_ranker,itm_french_voltigeur_officer_pants,itm_french_voltigeur_pants,itm_french_voltigeur_shako_ranker,itm_bullets,itm_french_charleville,itm_french_dragoon_musket,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(50,5,90,5,206,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_voltigeur_colours","15eme Regiment d'Infanterie Legere","Eagle Bearer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_voltigeur_body_sarge,itm_french_voltigeur_officer_pants,itm_french_voltigeur_pants,itm_french_voltigeur_shako_ranker,itm_flag_france_15,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_voltigeur_officer","15eme Regiment d'Infanterie Legere","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_voltigeur_body_officer,itm_french_voltigeur_officer_pants,itm_french_voltigeur_shako_officer,itm_french_light_inf_off_sabre,itm_pistol_ammo,itm_french_officer_pistol,itm_french_pistol_1766,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_voltigeur_horn","15eme Regiment d'Infanterie Legere","Hornist",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_voltigeur_body_hornist,itm_french_voltigeur_officer_pants,itm_french_voltigeur_pants,itm_french_voltigeur_shako_ranker,itm_horn,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_hussar","2e Regiment de Hussards","Hussar",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_hussards_ranker,itm_french_hussards_ranker_pants,itm_french_hussar_shako_ranker,itm_french_light_cav_sabre,itm_hussar_horse_french], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_hussar_nco","2e Regiment de Hussards","Eagle Bearer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_hussards_nco,itm_french_hussards_ranker_pants,itm_french_hussar_shako_colours,itm_flag_france_hussard,itm_french_light_cav_sabre,itm_hussar_horse_french], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_hussar_officer","2e Regiment de Hussards","Officer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_hussards_officer,itm_french_hussards_officer_pants,itm_french_hussar_bearskin_officer,itm_pistol_ammo,itm_french_pistol_1777,itm_french_light_cav_off_sabre,itm_hussar_horse_french,itm_spyglass], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_hussar_trumpet","2e Regiment de Hussards","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_hussards_trumpeter,itm_french_hussards_trumpeter_pants,itm_french_hussar_shako_trumpeter,itm_trumpet,itm_french_light_cav_sabre,itm_hussar_horse_french_trumpet], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_lancer","Regiment de Chevau-Legers Lanciers de la Garde","Lancer",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_lancer_body_ranker,itm_french_lancer_pants,itm_french_ldlg_czapka_ranker,itm_fr_cuirassier_gloves,itm_french_lance,itm_french_light_cav_sabre_garde,itm_lancer_horse_french], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_lancer_nco","Regiment de Chevau-Legers Lanciers de la Garde","Eagle Bearer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_lancer_body_colours,itm_french_lancer_pants,itm_french_ldlg_czapka_ranker,itm_fr_cuirassier_gloves,itm_flag_france_lancier,itm_french_light_cav_sabre_garde,itm_lancer_horse_french], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_lancer_officer","Regiment de Chevau-Legers Lanciers de la Garde","Officer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_lancer_body_officer,itm_french_lancer_officer_pants,itm_french_ldlg_czapka_officer,itm_fr_cuirassier_gloves,itm_pistol_ammo,itm_french_cav_pistol,itm_french_light_cav_off_sabre,itm_lancer_horse_french,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_lancer_trumpet","Regiment de Chevau-Legers Lanciers de la Garde","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_lancer_trumpeter_body,itm_french_lancer_officer_pants,itm_french_ldlg_czapka_trumpeter,itm_fr_cuirassier_gloves,itm_trumpet,itm_french_light_cav_sabre_garde,itm_lancer_horse_french_trumpet], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_dragoon","Regiment de Dragons de l'Imperatrice","Dragoon",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_fr_cuirassier_gloves,itm_french_mousquiton,itm_french_mousquiton_light,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_french], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_dragoon_nco","Regiment de Dragons de l'Imperatrice","Eagle Bearer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_dragoon_body_sargent,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_fr_cuirassier_gloves,itm_flag_france_dragon,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_french], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_dragoon_officer","Regiment de Dragons de l'Imperatrice","Officer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_dragoon_body_officer,itm_french_dragoon_pants,itm_french_dragoon_helmet_officer,itm_fr_cuirassier_gloves,itm_pistol_ammo,itm_french_cav_pistol,itm_french_heavy_cav_off_sabre,itm_dragoon_horse_french,itm_spyglass], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_dragoon_trumpet","Regiment de Dragons de l'Imperatrice","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_dragoon_body_trumpeter,itm_french_dragoon_pants,itm_french_dragoon_helmet_trumpeter,itm_fr_cuirassier_gloves,itm_trumpet,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_french_trumpet], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_cuirassier","9eme Regiment de Cuirassiers","Cuirassier",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_cuirassier_ranker,itm_rus_horse_guard_pants,itm_french_cuirassier_helmet,itm_fr_cuirassier_gloves,itm_french_line_cav_sabre,itm_cuirassier_horse_french,itm_rus_horse_guard_pants], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_cuirassier_nco","Cuirassiers","Eagle Bearer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_cuirassier_colours,itm_rus_horse_guard_pants,itm_french_cuirassier_helmet,itm_fr_cuirassier_gloves,itm_flag_france_cuirassier,itm_french_line_cav_sabre,itm_cuirassier_horse_french], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_cuirassier_officer","Cuirassiers","Officer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_cuirassier_officer,itm_rus_horse_guard_pants,itm_french_cuirassier_helmet_officer,itm_fr_cuirassier_gloves,itm_french_cav_pistol,itm_pistol_ammo,itm_french_heavy_cav_off_sabre,itm_cuirassier_horse_french_officer,itm_spyglass], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_cuirassier_trumpet","Cuirassiers","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_fr_cuirassier_body_trumpeter,itm_rus_horse_guard_pants,itm_french_cuirassier_helmet_trumpeter,itm_fr_cuirassier_gloves,itm_trumpet,itm_french_line_cav_sabre,itm_cuirassier_horse_french_trumpet], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_carabineer","1er Regiment de Carabiniers","Carabinier",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_carabineer_ranker,itm_rus_horse_guard_pants,itm_french_carabineer_helmet,itm_fr_cuirassier_gloves,itm_french_carabineer_sword,itm_carabineer_horse_french], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_carabineer_nco","Carabineers","Eagle Bearer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_carabineer_colours,itm_rus_horse_guard_pants,itm_french_carabineer_helmet,itm_fr_cuirassier_gloves,itm_flag_france_carab,itm_french_carabineer_sword,itm_carabineer_horse_french], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_carabineer_officer","Carabineers","Officer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_carabineer_officer,itm_rus_horse_guard_pants,itm_french_carabineer_helmet_officer,itm_fr_cuirassier_gloves,itm_french_cav_pistol,itm_pistol_ammo,itm_french_heavy_cav_off_sabre,itm_carabineer_horse_french_officer,itm_spyglass], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_carabineer_trumpet","Carabineers","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_fr_cuirassier_body_trumpeter,itm_rus_horse_guard_pants,itm_french_carabineer_helmet_trumpeter,itm_fr_cuirassier_gloves,itm_trumpet,itm_french_carabineer_sword,itm_carabineer_horse_french_trumpet], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_grenadier_a_cheval","Regiment de Grenadiers a Cheval de la Garde","Heavy Cavalry",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_grenadiers_a_cheval_body_ranker,itm_french_grenadiers_a_cheval_pants,itm_grach_bearskin_ranker,itm_fr_cuirassier_gloves,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_french], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_grenadier_a_cheval_nco","Regiment de Grenadiers a Cheval de la Garde","Eagle Bearer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_grenadiers_a_cheval_body_colours,itm_french_grenadiers_a_cheval_pants,itm_grach_bearskin_trumpeter,itm_fr_cuirassier_gloves,itm_flag_france_cheval,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_french], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_grenadier_a_cheval_officer","Regiment de Grenadiers a Cheval de la Garde","Officer",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_grenadiers_a_cheval_body_officer,itm_french_grenadiers_a_cheval_pants,itm_grach_bearskin_officer,itm_fr_cuirassier_gloves,itm_french_cav_pistol,itm_pistol_ammo,itm_french_heavy_cav_off_sabre,itm_heavy_horse_french,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_grenadier_a_cheval_trumpet","Regiment de Grenadiers a Cheval de la Garde","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_french_ranks, [itm_french_grenadier_a_cheval_body_trumpeter,itm_french_grenadiers_a_cheval_pants,itm_grach_bearskin_trumpeter,itm_fr_cuirassier_gloves,itm_trumpet,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_french_trumpet], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["french_arty","L'Artillerie","Artillery",tf_guarantee_all,0,0,fac_france, [itm_french_art_ranker_body,itm_french_art_ranker_body_alt,itm_french_art_ranker_pants,itm_french_artillery_bearskin_ranker,itm_ramrod,itm_cannon_lighter,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_arty_nco","L'Artillerie","Artillery Train",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_arty_train,itm_fr_arty_train_bottefortes,itm_french_artillery_train_shako,itm_cannon_lighter,itm_french_briquet,itm_arty_horse_cannon_french,itm_arty_horse_howitzer_french], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_arty_officer","L'Artillerie","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_art_officer_body,itm_fr_arty_captain_bottefortes,itm_french_artillery_bearskin_officer,itm_fr_artillery_gloves,itm_french_art_off_sword,itm_cannon_lighter,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_sapper","Sappeur","Engineer",tf_guarantee_all,0,0,fac_france, [itm_french_sapper,itm_french_sappeur_pants,itm_french_sapper_bearskin,itm_fr_cuirassier_gloves,itm_french_sappeur_sword,itm_sapper_axe,itm_construction_hammer,itm_shovel], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["napoleon","L'Empereur Napoleon Bonaparte","Commander",tf_mounted|tf_guarantee_all,0,0,fac_france, [itm_french_general_body_boney,itm_french_general_boots,itm_french_nappy_hat,itm_french_line_cav_sabre,itm_carabineer_horse_french_officer,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_5|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ### Prussia ### ["prussian_infantry","8. Brandenburgische Infanterie-Regiment","Line Infantry",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_infantry_ranker,itm_prussian_infantry_pants,itm_prussian_shako,itm_prussian_shako_2,itm_russian_briquet_1807_black,itm_prussian_potsdam,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_nco","8. Infanterie Regiment","Colour Bearer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry_nco,itm_prussian_infantry_pants,itm_prussian_shako_colours,itm_prussian_shako_colours_2,itm_russian_briquet_1807_black,itm_prussia_colour_infantry], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_officer","8. Infanterie Regiment","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry_officer,itm_rus_dragoon_pants1,itm_prussian_infantry_hat_officer,itm_russian_officer_sword,itm_russian_pistol,itm_pistol_ammo,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_drum","8. Infanterie Regiment","Drummer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry_drum,itm_prussian_infantry_pants,itm_prussian_shako,itm_prussian_shako_colours_2,itm_russian_briquet_1807_black,itm_drummer_gloves,itm_drumstick_right], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_flute","8. Infanterie Regiment","Fifer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry_flute,itm_prussian_infantry_pants,itm_prussian_shako,itm_prussian_shako_colours_2,itm_russian_briquet_1807_black,itm_flute], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry2","23. Rheinische Infanterie-Regiment","Line Infantry",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_infantry2_ranker,itm_prussian_infantry_pants,itm_prussian_shako,itm_prussian_shako_2,itm_prussian_infantry2_hat,itm_russian_briquet_1807_black,itm_prussian_potsdam,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry2_nco","23. Rheinische Infanterie-Regiment","Colour Bearer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry2_nco,itm_prussian_infantry_pants,itm_prussian_shako_2,itm_prussia_colour_infantry2,itm_prussian_infantry2_hat,itm_russian_briquet_1807_black], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry2_officer","23. Rheinische Infanterie-Regiment","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry2_officer,itm_rus_dragoon_pants1,itm_prussian_inf_off_shako,itm_russian_officer_sword,itm_russian_pistol,itm_pistol_ammo,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry2_drum","23. Rheinische Infanterie-Regiment","Drummer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry2_drum,itm_prussian_infantry_pants,itm_prussian_shako_2,itm_prussian_infantry2_hat,itm_russian_briquet_1807_black,itm_drummer_gloves,itm_drumstick_right], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry2_flute","23. Rheinische Infanterie-Regiment","Fifer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_infantry2_flute,itm_prussian_infantry_pants,itm_prussian_shako_2,itm_prussian_infantry2_hat,itm_russian_briquet_1807_black,itm_flute], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_kurmark","3. Kurmarkische Landwehr-Regiment","Line Infantry",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_landwehr_ranker,itm_prussian_landwehr_ranker_alt,itm_prussian_landwehr_pants,itm_prussian_landwehr_hat,itm_prussian_landwehr_hat_2,itm_prussian_landwehr_hat_3,itm_russian_briquet_1807_landwehr,itm_russian_peasant_axe_landwehr,itm_prussian_potsdam,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_kurmark_nco","3. Kurmark Landwehr","Colour Bearer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_landwehr_nco,itm_prussian_landwehr_pants,itm_prussian_landwehr_hat,itm_prussian_landwehr_hat_2,itm_prussian_landwehr_hat_3,itm_prussia_colour_landwehr,itm_russian_briquet_1807_landwehr], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_kurmark_officer","3. Kurmark Landwehr","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_landwehr_officer,itm_prussian_landwehr_pants,itm_prussian_landwehr_hat,itm_prussian_landwehr_hat_2,itm_prussian_landwehr_hat_3,itm_russian_sabre_1798,itm_russian_pistol,itm_pistol_ammo,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_kurmark_drum","3. Kurmark Landwehr","Drummer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_landwehr_drum,itm_prussian_landwehr_pants,itm_prussian_landwehr_hat,itm_prussian_landwehr_hat_2,itm_prussian_landwehr_hat_3,itm_drumstick_right,itm_drummer_gloves,itm_russian_briquet_1807_landwehr], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_kurmark_flute","3. Kurmark Landwehr","Fifer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_landwehr_flute,itm_prussian_landwehr_pants,itm_prussian_landwehr_hat,itm_prussian_landwehr_hat_2,itm_prussian_landwehr_hat_3,itm_flute,itm_russian_briquet_1807_landwehr], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_freikorps","Lutzowsches Freikorps","Line Infantry",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_freikorps_ranker,itm_prussian_freikorps_pants,itm_prussian_shako_2,itm_russian_briquet_1807_black_blackbelt,itm_prussian_potsdam,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_freikorps_nco","Lutzowsches Freikorps","Colour Bearer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_freikorps_nco,itm_prussian_freikorps_pants,itm_prussian_shako_2,itm_prussia_colour_landwehr,itm_russian_briquet_1807_black_blackbelt], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_freikorps_officer","Lutzowsches Freikorps","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_freikorps_officer,itm_prussian_freikorps_pants,itm_prussian_freikorps_officer_hat,itm_russian_sabre_1798,itm_russian_pistol,itm_pistol_ammo,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_freikorps_drum","Lutzowsches Freikorps","Drummer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_freikorps_drum,itm_prussian_freikorps_pants,itm_prussian_shako_2,itm_drumstick_right,itm_drummer_gloves,itm_russian_briquet_1807_black_blackbelt], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_freikorps_flute","Lutzowsches Freikorps","Fifer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_freikorps_flute,itm_prussian_freikorps_pants,itm_prussian_shako_2,itm_flute,itm_russian_briquet_1807_black_blackbelt], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_15","1. Garde-Regiment zu Fuss","Foot Guard",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_guard_ranker,itm_austrian_officer_boots,itm_prussian_guard_ranker_shako,itm_russian_briquet_1807_black,itm_prussian_potsdam,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,145,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_15_nco","1. Garde-Regiment zu Fuss","Colour Bearer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_guard_nco,itm_austrian_officer_boots,itm_prussian_guard_colours_shako,itm_prussia_colour_guard,itm_russian_briquet_1807_black], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_15_officer","1. Garde-Regiment zu Fuss","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_guard_officer,itm_austrian_officer_boots,itm_prussian_guard_officer_shako,itm_russian_officer_sword,itm_russian_pistol,itm_pistol_ammo,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_15_drum","1. Garde-Regiment zu Fuss","Drummer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_guard_drummer,itm_austrian_officer_boots,itm_prussian_guard_musician_shako,itm_russian_briquet_1807_black,itm_drumstick_right,itm_drummer_gloves], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["stupid_dummy_troop","{!}dummy_troop","{!}dummy_troop",tf_guarantee_all,0,0,fac_kingdom_6, [], #Make sure to move this troop upwards if adding new troops above this one! def_attrib_multiplayer|level(20),wpex(50,5,90,5,206,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_15_flute","1. Garde-Regiment zu Fuss","Fifer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_guard_flute,itm_austrian_officer_boots,itm_prussian_guard_musician_shako,itm_russian_briquet_1807_black,itm_flute], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_rifle","Schlesische Schutzen","Rifleman",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_jaeger_ranker,itm_prussian_jaeger_ranker_alt,itm_prussian_jaeger_pants,itm_prussian_shako_2,itm_russian_jaeger_bayonet_jaeger,itm_russian_rifle_1805,itm_bullets], def_attrib_multiplayer|level(20),wpex(50,5,90,5,206,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_rifle_nco","Schlesische Jaeger","Sergeant",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_jaeger_nco,itm_prussian_jaeger_pants,itm_prussian_shako_2,itm_russian_jaeger_bayonet_jaeger,itm_russian_rifle_1805,itm_bullets], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_rifle_officer","Schlesische Jaeger","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_jaeger_officer,itm_austrian_officer_boots,itm_prussian_jaeger_officer_shako,itm_officer_gloves,itm_russian_officer_sword,itm_russian_pistol,itm_pistol_ammo,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_infantry_rifle_horn","Schlesische Jaeger","Hornist",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_jaeger_hornist,itm_prussian_jaeger_pants,itm_prussian_shako_2,itm_russian_jaeger_bayonet_jaeger,itm_horn], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_dragoon","6. Neumarkische Dragoner","Dragoon",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_dragoon_ranker,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_dragoon_shako_ranker,itm_british_light_cav_sabre,itm_russian_dragoon_musket,itm_bullets,itm_dragoon_horse_prussia_1], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_dragoon_nco","6. Dragoner Regiment","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_dragoon_nco,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_dragoon_shako_ranker,itm_prussia_colour_hussard,itm_british_light_cav_sabre,itm_russian_dragoon_musket,itm_bullets,itm_dragoon_horse_prussia_1], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_dragoon_officer","6. Dragoner Regiment","Officer",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_dragoon_officer,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_dragoon_shako_officer,itm_british_light_cav_sabre,itm_russian_pistol,itm_pistol_ammo,itm_dragoon_horse_prussia_1,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_dragoon_trumpet","6. Dragoner Regiment","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_dragoon_trumpet,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_dragoon_shako_ranker,itm_british_light_cav_sabre,itm_trumpet,itm_dragoon_horse_prussia_2], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_hussar","1. Leib-Husaren-Regiment (Totenkopfhusaren)","Hussar",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_hussar_ranker,itm_prussian_hussar_pants,itm_prussian_hussar_shako,itm_british_light_cav_sabre,itm_hussar_horse_prussia_1,itm_hussar_horse_prussia_2], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_hussar_nco","Death's Head Hussar Regiment","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_hussar_nco,itm_prussian_hussar_pants,itm_prussian_hussar_shako,itm_prussia_colour_hussard,itm_british_light_cav_sabre,itm_hussar_horse_prussia_1,itm_hussar_horse_prussia_2], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_hussar_officer","Death's Head Hussar Regiment","Officer",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_hussar_officer,itm_prussian_hussar_officer_variant,itm_prussian_hussar_pants_officer,itm_prussian_hussar_officer_shako,itm_officer_gloves,itm_russian_pistol,itm_british_light_cav_sabre,itm_pistol_ammo,itm_hussar_horse_prussia_1,itm_hussar_horse_prussia_2,itm_spyglass], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_hussar_trumpet","Death's Head Hussar Regiment","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_hussar_trumpet,itm_prussian_hussar_pants,itm_prussian_hussar_shako,itm_trumpet,itm_british_light_cav_sabre,itm_hussar_horse_prussia_1,itm_hussar_horse_prussia_2], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_landwehr_cav","Westfalische Landwehrkavallerie","Lancer",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_landwehr_cav_ranker,itm_prussian_landwehr_pants2,itm_prussian_landwehr_cav_shako,itm_prussian_lance,itm_british_light_cav_sabre,itm_lancer_horse_prussia_1,itm_lancer_horse_prussia_2], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_landwehr_cav_nco","Westfalische Landwehrkavallerie","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_landwehr_cav_nco,itm_prussian_landwehr_pants2,itm_prussian_landwehr_cav_shako,itm_prussia_colour_hussard,itm_british_light_cav_sabre,itm_lancer_horse_prussia_1,itm_lancer_horse_prussia_2], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_landwehr_cav_officer","Westfalische Landwehrkavallerie","Officer",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_landwehr_cav_officer,itm_rus_dragoon_pants1,itm_prussian_landwehr_cav_shako_officer,itm_british_light_cav_sabre,itm_russian_pistol,itm_pistol_ammo,itm_lancer_horse_prussia_1,itm_lancer_horse_prussia_2,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_landwehr_cav_trumpet","Westfalische Landwehrkavallerie","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_landwehr_cav_trumpet,itm_prussian_landwehr_pants2,itm_prussian_landwehr_cav_shako,itm_trumpet,itm_british_light_cav_sabre,itm_lancer_horse_prussia_1,itm_lancer_horse_prussia_2], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_cuirassier","3. Brandenburgische Kurassier Regiment","Heavy Cavalry",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_cuirassier_ranker,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_cuirassier_helmet,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_prussia_1,itm_heavy_horse_prussia_2], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_cuirassier_nco","3. Brandenburgische Kurassier Regiment","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_cuirassier_nco,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_cuirassier_helmet,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_prussia_1,itm_heavy_horse_prussia_2], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_cuirassier_officer","3. Brandenburgische Kurassier Regiment","Officer",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_cuirassier_officer,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_cuirassier_helmet,itm_fr_cuirassier_gloves,itm_french_cav_pistol,itm_pistol_ammo,itm_french_heavy_cav_off_sabre,itm_heavy_horse_prussia_1,itm_heavy_horse_prussia_2,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_cuirassier_trumpet","3. Brandenburgische Kurassier Regiment","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_cuirassier_trumpet,itm_prussian_cavalry_pants,itm_prussian_cavalry_pants2,itm_prussian_cuirassier_helmet_trumpet,itm_trumpet,itm_french_heavy_cav_sabre_garde,itm_heavy_horse_prussia_1,itm_heavy_horse_prussia_2], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_arty","36. Regiment der Fussartillerie","Artillery",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_arty_ranker,itm_prussian_infantry_pants,itm_prussian_arty_shako_ranker,itm_ramrod,itm_cannon_lighter,itm_russian_briquet_1807_black_blackbelt], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_arty_nco","36. Regiment der Fussartillerie","Artillery Train",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_arty_train,itm_prussian_cavalry_pants,itm_prussian_arty_shako_ranker,itm_cannon_lighter,itm_arty_horse_cannon_prussian,itm_arty_horse_howitzer_prussian,itm_russian_briquet_1807_black_blackbelt], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_arty_officer","36. Regiment der Fussartillerie","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_arty_officer,itm_rus_dragoon_pants1,itm_prussian_arty_shako_officer,itm_russian_officer_sword,itm_cannon_lighter,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_sapper","4. Mansfelder Pionierskorps","Engineer",tf_guarantee_all,0,0,fac_prussia, [itm_prussian_pioneer,itm_british_coldstream_pants,itm_prussian_pioneer_shako,itm_russian_briquet_1807_black_blackbelt,itm_sapper_axe,itm_construction_hammer,itm_shovel], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_blucher","Generalfeldmarschall Gebhard von Blucher","Commander",tf_mounted|tf_guarantee_all,0,0,fac_prussia, [itm_prussian_blucher,itm_prussian_blucher_pants,itm_prussian_blucher_hat,itm_russian_guard_sword_1799,itm_heavy_horse_prussia_1,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_5|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ### RUSSIA ### ["russian_partizan","Partizani","Partisan Irregulars",tf_guarantee_all,0,0,fac_russia, [itm_rus_partizan1,itm_rus_partizan2,itm_rus_militia_ranker_pants,itm_rus_militia_ranker_pants1,itm_rus_opol_hat_ranker,itm_rus_partisan_hat1,itm_rus_partisan_hat2,itm_rus_partisan_hat3,itm_rus_partisan_hat4,itm_rus_partisan_hat5,itm_rus_opol_hat_ranker,itm_rus_drummer_shako,itm_bullets,itm_russian_dragoon_musket,itm_russian_peasant_fork,itm_russian_peasant_pitchfork,itm_russian_peasant_sap,itm_russian_peasant_kosa,itm_russian_peasant_kosa2,itm_birch_trunk,itm_brokenbottle,itm_russian_peasant_club,itm_russian_peasant_birch_club,itm_russian_peasant_axe,itm_russian_peasant_knife,itm_russian_peasant_serp,itm_russian_peasant_pike,itm_russian_peasant_kuvalda,itm_russian_peasant_2handed_axe,itm_russian_peasant_rogatina,itm_russian_gusarskiy_karabin], def_attrib_multiplayer|level(20),wpex(80,5,80,5,130,80),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_opol","Sankt-Peterburzhskoye Opolcheniye","Line Militia",tf_guarantee_all,0,0,fac_russia, [itm_russian_militia_ranker,itm_rus_militia_ranker_pants,itm_rus_militia_ranker_pants1,itm_rus_opol_hat_ranker,itm_bullets,itm_russian_dragoon_musket,itm_russian_opolcheniye_pike,itm_russian_peasant_axe], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_opol_nco","St Petersburg Opolcheniye","Colour Bearer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_militia_officer,itm_rus_militia_off_pants,itm_rus_opol_hat_officer,itm_flag_russia_opolcheniye,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_opol_officer","St Petersburg Opolcheniye","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_militia_officer,itm_rus_militia_off_pants,itm_rus_opol_hat_officer,itm_russian_officer_sword,itm_pistol_ammo,itm_russian_pistol,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry","Simbirskiy Pehotniy Polk","Line Infantry",tf_guarantee_all,0,0,fac_russia, [itm_russian_infantry1,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_drummer_shako,itm_bullets,itm_russian_musket_1808,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_nco","Simbirsk Infantry Regiment","Colour Bearer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_infantry_nco,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_infantry_shako_nco,itm_flag_russia_simbirsk_color,itm_flag_russia_simbirsk_white,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_officer","Simbirsk Infantry Regiment","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_infantry_officer,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_infantry_officer_shako,itm_russian_officer_sword,itm_pistol_ammo,itm_russian_pistol,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_drum","Simbirsk Infantry Regiment","Drummer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_drummer,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_drummer_shako,itm_drummer_gloves,itm_drumstick_right,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_flute","Simbirsk Infantry Regiment","Fifer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_flautist,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_drummer_shako,itm_flute,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_grenadier","Pavlovskiy Grenaderskiy Polk","Line Infantry",tf_guarantee_all,0,0,fac_russia, [itm_russian_gren_ranker,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_pavlovsk_ranker,itm_bullets,itm_russian_musket_1808,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_grenadier_nco","Pavlovskiy Grenadier Regiment","Colour Bearer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_gren_nco,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_pavlovsk_ranker,itm_flag_russia_pavlovsk_color,itm_flag_russia_pavlovsk_white,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_grenadier_officer","Pavlovskiy Grenadier Regiment","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_gren_officer,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_pavlovsk_ranker,itm_russian_officer_sword,itm_pistol_ammo,itm_russian_pistol,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_grenadier_drum","Pavlovskiy Grenadier Regiment","Drummer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_drummer,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_pavlovsk_ranker,itm_drummer_gloves,itm_drumstick_right,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_grenadier_flute","Pavlovskiy Grenadier Regiment","Fifer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_flautist,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_pavlovsk_ranker,itm_flute,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_foot_guard","Leib-Gvardii Preobrazhenskiy Polk","Foot Guard",tf_guarantee_all,0,0,fac_russia, [itm_russian_guard_ranker,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_guard_shako_ranker,itm_bullets,itm_russian_musket_1808,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(50,5,145,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_foot_guard_nco","Preobrazhenskiy Guard Regiment","Colour Bearer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_guard_nco,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_guard_shako_nco,itm_flag_russia_preobragenskiy_color,itm_flag_russia_preobragenskiy_white,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_foot_guard_officer","Preobrazhenskiy Guard Regiment","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_guard_officer,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_guard_shako_officer,itm_russian_guard_off_sword,itm_pistol_ammo,itm_russian_pistol,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_foot_guard_drum","Preobrazhenskiy Guard Regiment","Drummer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_guard_drummer,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_guard_shako_musician,itm_drummer_gloves,itm_drumstick_right,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_foot_guard_flute","Preobrazhenskiy Guard Regiment","Fifer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_guard_flautist,itm_rus_infantry_pants1,itm_rus_infantry_pants2,itm_rus_guard_shako_musician,itm_flute,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_rifle","21-y Yegerskiy Polk","Rifleman",tf_guarantee_all,0,0,fac_russia, [itm_russian_jaeger_ranker,itm_rus_jaeger_pants,itm_rus_jaeger_shako_ranker,itm_russian_rifle_1805,itm_russian_dragoon_musket,itm_bullets,itm_russian_jaeger_bayonet_jaeger], def_attrib_multiplayer|level(20),wpex(50,5,90,5,206,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_rifle_nco","21st Jaeger Regiment","Sergeant",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_jaeger_nco,itm_rus_jaeger_pants,itm_rus_jaeger_shako_nco,itm_russian_rifle_1805,itm_russian_dragoon_musket,itm_bullets,itm_russian_jaeger_bayonet_jaeger], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_rifle_officer","21st Jaeger Regiment","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_jaeger_officer,itm_rus_jaeger_pants,itm_rus_infantry_officer_shako,itm_russian_pistol,itm_pistol_ammo,itm_russian_officer_sword_jaeger,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_infantry_rifle_horn","21st Jaeger Regiment","Hornist",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_jaeger_musician,itm_rus_jaeger_pants,itm_rus_jaeger_shako_ranker,itm_horn,itm_russian_briquet_1807_black_blackbelt], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_hussar","Sumskoy Gusarskiy Polk","Hussar",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_hussar_ranker,itm_rus_hussar_pants_nco,itm_rus_hussar_shako_ranker,itm_russian_sabre_1809,itm_hussar_horse_russia], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_hussar_nco","Sumskiy Hussar Regiment","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_hussar_nco,itm_rus_hussar_pants1,itm_rus_hussar_pants2,itm_rus_hussar_shako_nco,itm_flag_russia_kyiv_dragoon,itm_russian_sabre_1809,itm_hussar_horse_russia], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_hussar_officer","Sumskiy Hussar Regiment","Officer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_hussar_officer,itm_rus_hussar_pants_officer,itm_rus_hussar_shako_officer,itm_pistol_ammo,itm_russian_pistol,itm_russian_sabre_1809,itm_hussar_horse_russia,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_hussar_trumpet","Sumskiy Hussar Regiment","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_hussar_trumpeter,itm_rus_hussar_pants1,itm_rus_hussar_pants2,itm_rus_hussar_shako_trumpeter,itm_trumpet,itm_russian_sabre_1809,itm_hussar_horse_russia], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_uhlan","Litovskiy Ulanskiy Polk","Lancer",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_uhlan_ranker,itm_rus_uhlan_pants,itm_rus_uhlan_czapka_ranker,itm_russian_lancer_pike,itm_russian_sabre_1809,itm_lancer_horse_russia], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_uhlan_nco","Lithuanian Uhlans","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_uhlan_nco,itm_rus_uhlan_pants,itm_rus_uhlan_czapka_nco,itm_flag_russia_kyiv_dragoon,itm_russian_sabre_1809,itm_lancer_horse_russia], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_uhlan_officer","Lithuanian Uhlans","Officer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_uhlan_officer,itm_rus_uhlan_pants,itm_rus_uhlan_czapka_officer,itm_pistol_ammo,itm_russian_pistol,itm_russian_sabre_1809,itm_lancer_horse_russia,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_uhlan_trumpet","Lithuanian Uhlans","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_uhlan_trumpeter,itm_rus_uhlan_pants,itm_rus_uhlan_czapka_trumpeter,itm_trumpet,itm_russian_sabre_1809,itm_lancer_horse_russia], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_cossack","Donskoy Kazachiy Polk","Lancer",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_cossack,itm_rus_cossack_off_pants,itm_rus_cossack_hat_ranker,itm_russian_cossack_pike,itm_russian_sabre_1798,itm_russian_kindjal,itm_cossack_horse_russia_1,itm_cossack_horse_russia_2,itm_cossack_horse_russia_3,itm_cossack_horse_russia_4], def_attrib|level(20),wpex(90,5,130,5,40,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_cossack_nco","Don Cossacks","Sergeant",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_cossack,itm_rus_cossack_off_pants,itm_rus_cossack_hat_nco,itm_russian_sabre_1798,itm_cossack_horse_russia_1,itm_cossack_horse_russia_2,itm_cossack_horse_russia_3,itm_cossack_horse_russia_4], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_cossack_officer","Don Cossacks","Officer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_cossack_officer,itm_rus_cossack_off_pants,itm_rus_cossack_hat_officer,itm_pistol_ammo,itm_russian_pistol,itm_russian_sabre_1798,itm_cossack_horse_russia_1,itm_cossack_horse_russia_2,itm_cossack_horse_russia_3,itm_cossack_horse_russia_4,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_dragoon","Kievskiy Dragunskiy Polk","Dragoon",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_dragoon_ranker,itm_rus_dragoon_pants1,itm_rus_dragoon_pants2,itm_rus_kyiv_dragoons_all,itm_russian_dragoon_musket,itm_russian_cavalry_stutzer_1803,itm_russian_gusarskiy_karabin,itm_bullets,itm_russian_sword_1810,itm_dragoon_horse_russia,itm_officer_gloves], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_dragoon_nco","Kiev Dragoon Regiment","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_dragoon_nco,itm_rus_dragoon_pants1,itm_rus_dragoon_pants2,itm_rus_kyiv_dragoons_all,itm_flag_russia_kyiv_dragoon,itm_russian_sword_1810,itm_dragoon_horse_russia,itm_officer_gloves], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_dragoon_officer","Kiev Dragoon Regiment","Officer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_dragoon_officer,itm_rus_dragoon_pants1,itm_rus_dragoon_pants2,itm_rus_kyiv_dragoons_all,itm_pistol_ammo,itm_russian_pistol,itm_russian_sword_1810,itm_dragoon_horse_russia,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_dragoon_trumpet","Kiev Dragoon Regiment","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_dragoon_trumpeter,itm_rus_dragoon_pants1,itm_rus_dragoon_pants2,itm_rus_kyiv_dragoons_trumpeter,itm_trumpet,itm_russian_sword_1810,itm_dragoon_horse_russia,itm_officer_gloves], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_horse_guard","Kavalergardskiy Polk","Cuirassier",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_russian_horse_guard,itm_rus_horse_guard_pants,itm_rus_chevalier_hat,itm_russian_guard_sword_1799,itm_heavy_horse_russia,itm_rus_chevgarde_gloves], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_horse_guard_nco","Chevaliers-Gardes","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_horse_guard_nco,itm_rus_horse_guard_pants,itm_rus_chevalier_hat,itm_flag_russia_kyiv_dragoon,itm_russian_guard_sword_1799,itm_heavy_horse_russia,itm_rus_chevgarde_gloves], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_horse_guard_officer","Chevaliers-Gardes","Officer",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_horse_guard_officer,itm_rus_horse_guard_pants,itm_rus_chevalier_hat_officer,itm_pistol_ammo,itm_russian_pistol,itm_russian_guard_sword_1799,itm_heavy_horse_russia,itm_rus_chevgarde_gloves,itm_spyglass], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_horse_guard_trumpet","Chevaliers-Gardes","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_horse_guard_trumpeter,itm_rus_dragoon_pants1,itm_rus_dragoon_pants2,itm_rus_chevalier_hat_trumpeter,itm_trumpet,itm_russian_guard_sword_1799,itm_heavy_horse_russia,itm_officer_gloves], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["russian_arty","8-ya Batarejnaya Rota","Artillery",tf_guarantee_all,0,0,fac_russia, [itm_russian_arty_ranker,itm_rus_arty_pants,itm_rus_arty_shako_ranker,itm_ramrod,itm_cannon_lighter,itm_russian_briquet_1807], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_arty_nco","Artillery","Artillery Train",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_arty_nco,itm_rus_dragoon_pants2,itm_rus_arty_shako_nco,itm_cannon_lighter,itm_russian_briquet_1807,itm_arty_horse_cannon_russian,itm_arty_horse_howitzer_russian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_arty_officer","Artillery","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_arty_officer,itm_rus_arty_pants,itm_rus_arty_shako_officer,itm_russian_officer_sword,itm_cannon_lighter,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_sapper","Saper","Engineer",tf_guarantee_all,0,0,fac_russia, [itm_rus_pioneer,itm_austrian_jaeger_pants,itm_rus_pioneer_shako,itm_russian_sappeur_dagger,itm_sapper_axe_rus,itm_construction_hammer,itm_shovel], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["kutuzov","Feldmarshal Mikhail Kutuzov","Commander",tf_mounted|tf_guarantee_all,0,0,fac_russia, [itm_kutuzov,itm_rus_kutuzov_pants,itm_kutuzov_hat,itm_russian_guard_sword_1799,itm_heavy_horse_russia,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_5|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ### AUSTRIA ### ["austrian_infantry","Infantrie Regiment Erzherzog Rudolf Nr. 14","Line Infantry",tf_guarantee_all,0,0,fac_austria, [itm_austrian_infantry,itm_aus_infantry_ranker,itm_austrian_infantry_pants,itm_bullets,itm_austrian_musket], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_nco","Infantrie Regiment Erzherzog Rudolf Nr. 14","Colour Bearer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry_nco,itm_aus_infantry_nco,itm_austrian_infantry_pants,itm_austria_colour_leibfahne,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_officer","Infantrie Regiment Erzherzog Rudolf Nr. 14","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry_officer,itm_aus_infantry_officer,itm_austrian_officer_boots,itm_russian_officer_sword,itm_pistol_ammo,itm_russian_pistol,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_drum","Infantrie Regiment Erzherzog Rudolf Nr. 14","Drummer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry_drummer,itm_aus_infantry_ranker,itm_austrian_infantry_pants,itm_drummer_gloves,itm_drumstick_right,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_flute","Infantrie Regiment Erzherzog Rudolf Nr. 14","Fifer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry_fifer,itm_aus_infantry_ranker,itm_austrian_infantry_pants,itm_flute,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry2","Infantrie Regiment Freiherr von Wacquant Nr. 62","Line Infantry",tf_guarantee_all,0,0,fac_austria, [itm_austrian_infantry2,itm_aus_infantry_ranker,itm_hungarian_pants,itm_bullets,itm_austrian_musket], def_attrib_multiplayer|level(20),wpex(50,5,130,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry2_nco","Infantrie Regiment Freiherr von Wacquant Nr. 62","Colour Bearer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry2_nco,itm_aus_infantry_nco,itm_hungarian_pants,itm_austria_colour_leibfahne,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry2_officer","Infantrie Regiment Freiherr von Wacquant Nr. 62","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry2_officer,itm_aus_infantry_officer,itm_hungarian_pants_officer,itm_russian_officer_sword,itm_pistol_ammo,itm_russian_pistol,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry2_drum","Infantrie Regiment Freiherr von Wacquant Nr. 62","Drummer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry2_drummer,itm_aus_infantry_ranker,itm_hungarian_pants,itm_drummer_gloves,itm_drumstick_right,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry2_flute","Infantrie Regiment Freiherr von Wacquant Nr. 62","Fifer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_infantry2_fifer,itm_aus_infantry_ranker,itm_hungarian_pants,itm_flute,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenzer","Grenz Regiment Oguliner Nr. 3","Line/Light Infantry",tf_guarantee_all,0,0,fac_austria, [itm_austrian_grenzer,itm_aus_grenzer_ranker,itm_hungarian_pants,itm_austrian_musket,itm_russian_rifle_1805,itm_russian_gusarskiy_karabin,itm_bullets,itm_austrian_jaeger_bayonet_invis], def_attrib_multiplayer|level(20),wpex(50,5,105,5,170,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenzer_nco","Grenz Regiment Oguliner Nr. 3","Colour Bearer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenzer_nco,itm_aus_infantry_nco,itm_hungarian_pants,itm_austria_colour_ordinarfahne,itm_austrian_jaeger_bayonet_invis], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenzer_officer","Grenz Regiment Oguliner Nr. 3","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenzer_officer,itm_aus_grenzer_officer,itm_hungarian_pants_officer,itm_russian_pistol,itm_pistol_ammo,itm_russian_officer_sword_jaeger,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenzer_drum","Grenz Regiment Oguliner Nr. 3","Drummer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenzer_drummer,itm_aus_grenzer_ranker,itm_hungarian_pants,itm_drummer_gloves,itm_drumstick_right,itm_austrian_jaeger_bayonet_invis], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenzer_flute","Grenz Regiment Oguliner Nr. 3","Fifer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenzer_fifer,itm_aus_grenzer_ranker,itm_hungarian_pants,itm_flute,itm_austrian_jaeger_bayonet_invis], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenadier","Grenadier Battalion Purcell","Foot Guard",tf_guarantee_all,0,0,fac_austria, [itm_austrian_grenadier,itm_austrian_grenadier_alt,itm_aus_grenadier_bearskin,itm_hungarian_pants,itm_bullets,itm_austrian_musket,itm_austrian_infantry_briquet,itm_officer_gloves], def_attrib_multiplayer|level(20),wpex(50,5,145,5,150,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenadier_nco","Grenadier Battalion Purcell","Colour Bearer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenadier_nco,itm_aus_grenadier_bearskin,itm_hungarian_pants,itm_austria_colour_ordinarfahne,itm_austrian_infantry_briquet,itm_officer_gloves], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenadier_officer","Grenadier Battalion Purcell","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenadier_officer,itm_aus_grenadier_bearskin_officer,itm_hungarian_pants_officer,itm_russian_officer_sword,itm_pistol_ammo,itm_russian_pistol,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenadier_drum","Grenadier Battalion Purcell","Drummer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenadier_drummer,itm_aus_grenadier_bearskin,itm_hungarian_pants,itm_drummer_gloves,itm_drumstick_right,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_grenadier_flute","Grenadier Battalion Purcell","Fifer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_grenadier_fifer,itm_aus_grenadier_bearskin,itm_hungarian_pants,itm_flute,itm_austrian_infantry_briquet,itm_officer_gloves], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_rifle","Jaeger Battalion 2","Rifleman",tf_guarantee_all,0,0,fac_austria, [itm_austrian_jaeger,itm_aus_tyrol_hat,itm_austrian_jaeger_pants,itm_russian_rifle_1805,itm_bullets,itm_austrian_jaeger_bayonet], def_attrib_multiplayer|level(20),wpex(50,5,90,5,206,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_rifle_nco","Jaeger Battalion 2","Sergeant",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_jaeger_nco,itm_aus_tyrol_hat,itm_austrian_jaeger_pants,itm_russian_rifle_1805,itm_bullets,itm_austrian_jaeger_bayonet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_rifle_officer","Jaeger Battalion 2","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_jaeger_officer,itm_aus_tyrol_hat_officer,itm_austrian_jaeger_pants_officer,itm_russian_pistol,itm_pistol_ammo,itm_russian_officer_sword_jaeger,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_infantry_rifle_horn","Jaeger Battalion 2","Hornist",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_jaeger_hornist,itm_aus_tyrol_hat,itm_austrian_jaeger_pants,itm_horn,itm_austrian_jaeger_bayonet], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_hussar","Husar Regiment Graf von Hessen-Homburg Nr. 4","Hussar",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_hussar,itm_aus_hussard_shako_ranker,itm_hungarian_hussar_pants,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_hussar_horse_austria], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_hussar_nco","Husar Regiment Graf von Hessen-Homburg Nr. 4","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_hussar_nco,itm_aus_hussard_shako_nco,itm_hungarian_hussar_pants,itm_br_cavalry_gloves_short,itm_austria_colour_ordinarfahne_cav,itm_british_light_cav_sabre,itm_hussar_horse_austria], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_hussar_officer","Husar Regiment Graf von Hessen-Homburg Nr. 4","Officer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_hussar_officer,itm_aus_hussard_shako_officer,itm_hungarian_hussar_pants,itm_br_cavalry_gloves_short,itm_pistol_ammo,itm_russian_pistol,itm_british_light_cav_sabre,itm_hussar_horse_austria,itm_spyglass], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_hussar_trumpet","Husar Regiment Graf von Hessen-Homburg Nr. 4","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_hussar_trumpet,itm_aus_hussard_shako_trumpeter,itm_hungarian_hussar_pants,itm_br_cavalry_gloves_short,itm_trumpet,itm_british_light_cav_sabre,itm_hussar_horse_austria], def_attrib|level(20),wpex(160,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_uhlan","Ulan Regiment Schwarzenberg Nr. 2","Lancer",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_uhlan,itm_aus_uhlan_czapka,itm_hungarian_uhlan_pants,itm_br_cavalry_gloves_short,itm_austrian_lance,itm_british_light_cav_sabre,itm_lancer_horse_austria], def_attrib|level(20),wpex(50,5,130,5,40,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_uhlan_nco","Ulan Regiment Schwarzenberg Nr. 2","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_uhlan,itm_aus_uhlan_czapka,itm_hungarian_uhlan_pants,itm_br_cavalry_gloves_short,itm_austria_colour_ordinarfahne_cav,itm_british_light_cav_sabre,itm_lancer_horse_austria], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_uhlan_officer","Ulan Regiment Schwarzenberg Nr. 2","Officer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_uhlan_officer,itm_aus_uhlan_czapka_officer,itm_hungarian_uhlan_pants,itm_br_cavalry_gloves_short,itm_pistol_ammo,itm_russian_pistol,itm_british_light_cav_sabre,itm_lancer_horse_austria,itm_spyglass], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_uhlan_trumpet","Ulan Regiment Schwarzenberg Nr. 2","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_uhlan,itm_aus_uhlan_czapka_trumpeter,itm_hungarian_uhlan_pants,itm_br_cavalry_gloves_short,itm_trumpet,itm_british_light_cav_sabre,itm_lancer_horse_austria], def_attrib|level(20),wpex(150,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_light_horse","Chevauleger Regiment Furst von Hohenzollern Nr. 2","Light Horse",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_lightcav,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_russian_dragoon_musket,itm_bullets,itm_russian_sword_1810,itm_lightcav_horse_austria], def_attrib|level(20),wpex(70,5,30,5,155,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["austrian_light_horse_nco","Chevauleger Regiment Furst von Hohenzollern Nr. 2","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_lightcav_nco,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_austria_colour_ordinarfahne_cav,itm_russian_sword_1810,itm_lightcav_horse_austria], def_attrib|level(20),wpex(80,5,30,5,155,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["austrian_light_horse_officer","Chevauleger Regiment Furst von Hohenzollern Nr. 2","Officer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_lightcav_officer,itm_aus_cavalry_helmet_officer,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_pistol_ammo,itm_russian_pistol,itm_russian_sword_1810,itm_lightcav_horse_austria,itm_spyglass], def_attrib|level(20),wpex(80,5,30,5,80,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["austrian_light_horse_trumpet","Chevauleger Regiment Furst von Hohenzollern Nr. 2","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_lightcav_trumpet,itm_aus_cavalry_helmet_trumpeter,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_trumpet,itm_russian_sword_1810,itm_lightcav_horse_austria], def_attrib|level(20),wpex(80,5,30,5,80,5),knows_common|knows_riding_6|knows_ironflesh_2|knows_power_strike_1,swadian_face_middle_1, swadian_face_old_2], ["austrian_dragoon","Dragoner Regiment Erzherzog Ferdinand Nr. 5","Dragoon",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_dragoon,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_russian_dragoon_musket,itm_bullets,itm_russian_sword_1810,itm_dragoon_horse_austria], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_dragoon_nco","Dragoner Regiment Erzherzog Ferdinand Nr. 5","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_dragoon_nco,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_austria_colour_ordinarfahne_cav,itm_russian_sword_1810,itm_dragoon_horse_austria], def_attrib|level(20),wpex(120,5,30,5,125,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_dragoon_officer","Dragoner Regiment Erzherzog Ferdinand Nr. 5","Officer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_dragoon_officer,itm_aus_cavalry_helmet_officer,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_pistol_ammo,itm_russian_pistol,itm_russian_sword_1810,itm_dragoon_horse_austria,itm_spyglass], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_dragoon_trumpet","Dragoner Regiment Erzherzog Ferdinand Nr. 5","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_dragoon_trumpet,itm_aus_cavalry_helmet_trumpeter,itm_austrian_cavalry_boots,itm_br_cavalry_gloves_short,itm_trumpet,itm_russian_sword_1810,itm_dragoon_horse_austria], def_attrib|level(20),wpex(120,5,30,5,80,5),knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_cuirassier","Kurassier Regiment Kaiser Franz Nr. 1","Cuirassier",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_cuiraisser,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_rus_chevgarde_gloves,itm_british_heavy_cav_sword,itm_heavy_horse_austria,itm_rus_chevgarde_gloves], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_cuirassier_nco","Kurassier Regiment Kaiser Franz Nr. 1","Colour Bearer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_cuiraisser_nco,itm_aus_cavalry_helmet_ranker,itm_austrian_cavalry_boots,itm_rus_chevgarde_gloves,itm_austria_colour_ordinarfahne_cav,itm_british_heavy_cav_sword,itm_heavy_horse_austria,itm_rus_chevgarde_gloves], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_cuirassier_officer","Kurassier Regiment Kaiser Franz Nr. 1","Officer",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_cuiraisser_officer,itm_aus_cavalry_helmet_officer,itm_austrian_cavalry_boots,itm_rus_chevgarde_gloves,itm_pistol_ammo,itm_russian_pistol,itm_british_heavy_cav_sword,itm_heavy_horse_austria,itm_rus_chevgarde_gloves,itm_spyglass], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_cuirassier_trumpet","Kurassier Regiment Kaiser Franz Nr. 1","Trumpeter",tf_mounted|tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_cuiraisser_trumpet,itm_aus_cavalry_helmet_trumpeter,itm_austrian_cavalry_boots,itm_officer_gloves,itm_trumpet,itm_british_heavy_cav_sword,itm_heavy_horse_austria], def_attrib|level(20),wpex(140,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_arty","Artillerie Regiment Prinz zu Lothringen Nr. 7","Artillery",tf_guarantee_all,0,0,fac_austria, [itm_austrian_arty,itm_aus_arty_bicorn,itm_austrian_officer_boots,itm_ramrod,itm_cannon_lighter,itm_austrian_infantry_briquet], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_arty_nco","Artillerie Regiment Prinz zu Lothringen Nr. 7","Artillery Train",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_arty_train,itm_aus_arty_train_hat,itm_austrian_officer_boots,itm_cannon_lighter,itm_austrian_infantry_briquet,itm_arty_horse_cannon_austrian,itm_arty_horse_howitzer_austrian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_arty_officer","Artillerie Regiment Prinz zu Lothringen Nr. 7","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_arty_officer,itm_aus_arty_cap_bicorn,itm_austrian_officer_boots,itm_russian_officer_sword,itm_cannon_lighter,itm_officer_gloves,itm_spyglass], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_sapper","Pionier-Battalion Nr. 1","Engineer",tf_guarantee_all,0,0,fac_austria, [itm_austrian_pioneer,itm_aus_pioneer_hat,itm_austrian_officer_boots,itm_austrian_infantry_briquet,itm_sapper_axe,itm_construction_hammer,itm_shovel], def_attrib_multiplayer|level(20),wpex(70,5,30,5,30,5),knows_common|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["schwarzenberg","Karl Philipp, Furst zu Schwarzenberg","Commander",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_schwarzenberg,itm_austrian_schwarzenberg_pants,itm_aus_shwarzenberg_bicorn,itm_british_heavy_cav_sword,itm_heavy_horse_austria,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_5|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["british_arty_commander","Royal Foot Artillery","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_artillery_officer,itm_rus_dragoon_pants1,itm_british_artillery_shako_officer,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_spyglass,itm_ramrod,itm_arty_horse_cannon_british], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["british_arty_alt_commander","Royal Foot Artillery","Officer",tf_guarantee_all,0,0,fac_british_ranks, [itm_british_artillery_officer,itm_rus_dragoon_pants1,itm_british_artillery_shako_officer,itm_br_cavalry_gloves_short,itm_british_light_cav_sabre,itm_spyglass,itm_ramrod,itm_arty_horse_howitzer_british], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_arty_commander","L'Artillerie","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_art_officer_body,itm_fr_arty_captain_bottefortes,itm_french_artillery_bearskin_officer,itm_fr_artillery_gloves,itm_french_art_off_sword,itm_spyglass,itm_ramrod,itm_arty_horse_cannon_french], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["french_arty_alt_commander","L'Artillerie","Officer",tf_guarantee_all,0,0,fac_french_ranks, [itm_french_art_officer_body,itm_fr_arty_captain_bottefortes,itm_french_artillery_bearskin_officer,itm_fr_artillery_gloves,itm_french_art_off_sword,itm_spyglass,itm_ramrod,itm_arty_horse_howitzer_french], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_arty_commander","36. Regiment der Fussartillerie","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_arty_officer,itm_rus_dragoon_pants1,itm_prussian_arty_shako_officer,itm_russian_officer_sword,itm_officer_gloves,itm_spyglass,itm_ramrod,itm_arty_horse_cannon_prussian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["prussian_arty_alt_commander","36. Regiment der Fussartillerie","Officer",tf_guarantee_all,0,0,fac_prussian_ranks, [itm_prussian_arty_officer,itm_rus_dragoon_pants1,itm_prussian_arty_shako_officer,itm_russian_officer_sword,itm_officer_gloves,itm_spyglass,itm_ramrod,itm_arty_horse_howitzer_prussian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_arty_commander","Artillery","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_arty_officer,itm_rus_arty_pants,itm_rus_arty_shako_officer,itm_russian_officer_sword,itm_officer_gloves,itm_spyglass,itm_ramrod,itm_arty_horse_cannon_russian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["russian_arty_alt_commander","Artillery","Officer",tf_guarantee_all,0,0,fac_russian_ranks, [itm_russian_arty_officer,itm_rus_arty_pants,itm_rus_arty_shako_officer,itm_russian_officer_sword,itm_officer_gloves,itm_spyglass,itm_ramrod,itm_arty_horse_howitzer_russian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_arty_commander","Prinz zu Lothringen Nr. 7 Artillerie","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_arty_officer,itm_aus_arty_cap_bicorn,itm_austrian_officer_boots,itm_russian_officer_sword,itm_officer_gloves,itm_spyglass,itm_ramrod,itm_arty_horse_cannon_austrian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["austrian_arty_alt_commander","Prinz zu Lothringen Nr. 7 Artillerie","Officer",tf_guarantee_all,0,0,fac_austrian_ranks, [itm_austrian_arty_officer,itm_aus_arty_cap_bicorn,itm_austrian_officer_boots,itm_russian_officer_sword,itm_officer_gloves,itm_spyglass,itm_ramrod,itm_arty_horse_howitzer_austrian], def_attrib_multiplayer|level(20),wpex(80,5,30,5,30,5),knows_common|knows_riding_1|knows_ironflesh_3|knows_power_strike_2|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["multiplayer_end","{!}multiplayer_end","{!}multiplayer_end", 0, 0, 0, fac_austria, [], 0, 0, 0, 0, 0], # Vincenzo begin ["admin_dummy","{!}admin_dummy","{!}admin_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["flags_owned_dummy","{!}flags_owned_dummy","{!}flags_owned_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["entrypoints_dummy","{!}flags_owned_dummy","{!}flags_owned_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["entrypoints_per_flag_dummy","{!}entrypoints_per_flag_dummy","{!}entrypoints_per_flag_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["destroyed_props_dummy","{!}destroyed_props_dummy","{!}destroyed_props_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], # Vincenzo end # Beaver begin ["troop_check_dummy","{!}troop_check_dummy","{!}troop_check_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["flag_select_dummy","{!}flag_select_dummy","{!}flag_select_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], #["conquest_spawn_dummy","{!}conquest_spawn_dummy","{!}conquest_spawn_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["track_select_dummy","{!}track_select_dummy","{!}track_select_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["custom_battle_dummy","{!}custom_battle_dummy","{!}custom_battle_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["ai_tactics_dummy","{!}ai_tactics_dummy","{!}ai_tactics_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["manual_dummy","{!}manual_dummy","{!}manual_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], # Beaver end # ["agents_to_teleport_dummy","{!}destroyed_props_dummy","{!}destroyed_props_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], #TEMP for presentation design ["x_pos","{!}custom_battle_dummy","{!}custom_battle_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["y_pos","{!}custom_battle_dummy","{!}custom_battle_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["x_size","{!}custom_battle_dummy","{!}custom_battle_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], ["y_size","{!}custom_battle_dummy","{!}custom_battle_dummy",tf_hero|tf_inactive,0,reserved,fac_neutral,[],def_attrib,0,knows_common,0], # Quick Battle troops. ["quick_battle_troop_britain_1","Arthur Wellesley","General",tf_hero,0,0,fac_britain, [itm_british_wellington,itm_british_wellington_pants,itm_british_wellington_bicorne,itm_heavy_horse_britain,itm_french_line_cav_sabre,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_10|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["quick_battle_troop_france_1","Napoleon Bonaparte","Emperor",tf_hero,0,0,fac_france, [itm_french_general_body_boney,itm_french_general_boots,itm_french_nappy_hat,itm_french_line_cav_sabre,itm_carabineer_horse_french_officer,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_10|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], # ["quick_battle_troop_france_2","Marshal Lannes","Marshal",tf_hero,0,0,fac_france, # [itm_french_art_officer_body,itm_french_voltigeur_officer_pants,itm_french_inf_bicorne_45_officer,itm_french_line_cav_sabre,itm_heavy_horse_placeholder,itm_officer_gloves], # def_attrib|level(20),wpex(150,5,30,5,80,5),knows_common|knows_riding_6|knows_ironflesh_5|knows_power_strike_3,0x000000002004400436db6db8cba1bafa00000000001eb6db0000000000000000, swadian_face_old_2], # ["quick_battle_troop_france_3","Marshal Murat","Marshal",tf_hero,0,0,fac_france, # [itm_french_art_officer_body,itm_french_voltigeur_officer_pants,itm_french_line_cav_sabre,itm_heavy_horse_placeholder,itm_officer_gloves], # def_attrib|level(20),wpex(150,5,30,5,80,5),knows_common|knows_riding_6|knows_ironflesh_5|knows_power_strike_3,0x000000002004400436db6db8cba1bafa00000000001eb6db0000000000000000, swadian_face_old_2], ["quick_battle_troop_prussia_1","Gebhard von Blucher","General",tf_hero,0,0,fac_prussia, [itm_prussian_blucher,itm_prussian_blucher_pants,itm_prussian_blucher_hat,itm_russian_guard_sword_1799,itm_heavy_horse_prussia_1,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_10|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["quick_battle_troop_russia_1","Mikhail Kutuzov","General",tf_hero,0,0,fac_russia, [itm_kutuzov,itm_rus_kutuzov_pants,itm_kutuzov_hat,itm_russian_guard_sword_1799,itm_heavy_horse_russia,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_10|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["quick_battle_troop_austria_1","Karl Philipp","General",tf_mounted|tf_guarantee_all,0,0,fac_austria, [itm_austrian_schwarzenberg,itm_austrian_schwarzenberg_pants,itm_aus_shwarzenberg_bicorn,itm_british_heavy_cav_sword,itm_heavy_horse_austria,itm_officer_gloves,itm_spyglass], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_6|knows_ironflesh_10|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["quick_battle_troops_end","{!}quick_battle_troops_end","{!}quick_battle_troops_end", 0, 0, 0, fac_austria, [], 0, 0, 0, 0, 0], # Companions # Infantry ["companion_1","Raphael Martin","Raphael Martin",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x0000000fed0c14c3449c0238764b126a00000000000ec70c0000000000000000], ["companion_2","Clement Bernard","Clement Bernard",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x0000000fcd04408d459c08d52560a89300000000001557620000000000000000], ["companion_3","Maxim Munnig Schmidt","Maxime Petit",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x00000007fa00149437156eb6938ea8d600000000000616eb0000000000000000], ["companion_4","Alexandre Durand","Alexandre Durand",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x00000007d71041072716ab34749339b400000000000f248e0000000000000000], ["companion_5","Antoine Richard","Antoine Richard",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x00000007dd10158228dc6e2b128e349e000000000004b51a0000000000000000], ["companion_6","Alexis Moreau","Alexis Moreau",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x00000007f000358b491fc9129c912d7500000000000cc8c30000000000000000], ["companion_7","Jules Dubois","Jules Dubois",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x000000026a044287255d65994a494312000000000011acdc0000000000000000], ["companion_8","Matteo Robert","Matteo Robert",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x0000000e871022496caa66e72be5d8b5000000000009df1c0000000000000000], ["companion_9","Julien Laurent","Julien Laurent",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x0000000e841011c2359275ca9e92390b0000000000124acb0000000000000000], ["companion_10","Samuel Simon","Samuel Simon",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x00000009300852c936948a32be69aa6d00000000001235220000000000000000], ["companion_11","Noe Michel","Noe Michel",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x0000000d6f040043231c8db524c9dcea00000000000e44d30000000000000000], ["companion_12","Corentin Leroy","Corentin Leroy",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x00000000121045c854e450b4f5c0993600000000000ac7430000000000000000], ["companion_13","Jeremy Garcia","Jeremy Garcia",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x00000000210420892f0b65aaa432c695000000000011a52e0000000000000000], ["companion_14","Charles Lefebvre","Charles Lefebvre",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x000000002c10248244a98a475d39392300000000000cb5740000000000000000], ["companion_15","Eliott Roux","Eliott Roux",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib|level(20),wpex(50,5,130,5,150,5), knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3, 0x000000048c0801cc44a34e277c6754ec00000000000fc85a0000000000000000], # Caverly ["companion_16","Theo David","Theo David",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000b960054c559e46b5b8cb9d2ce000000000010d92c0000000000000000], ["companion_17","Romain Bertrand","Romain Bertrand",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000bb80445c8146e843799375cd500000000001337440000000000000000], ["companion_18","Quentin Fournier","Quentin Fournier",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000ba80843d05731719a5255a8910000000000152d530000000000000000], ["companion_19","Girard Baptiste","Girard Baptiste",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000dc40c4193492d6e46e197689200000000000dc3550000000000000000], ["companion_20","Valentin Bonnet","Valentin Bonnet",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000fc404444e5b4a89b65d6dc6ec00000000000916e50000000000000000], ["companion_21","Nico Kamps","Nicolas Morel",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000d870054463b4b2f5c9e8f66d5000000000018b5250000000000000000], ["companion_22","Mael Rousseau","Mael Rousseau",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000dae0011102d6452b892f5355c0000000000165cac0000000000000000], ["companion_23","Pierre Lambert","Pierre Lambert",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x000000097704440f29295268a4b632f3000000000012aaec0000000000000000], ["companion_24","Marius Blanc","Marius Blanc",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x000000097d0c204726fe70b6fb8a671b00000000000dc28a0000000000000000], ["companion_25","Remi Thomas","Remi Thomas",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x000000049600544c58e24a35590e87a3000000000009264c0000000000000000], ["companion_26","Benjamin Aguillon","Benjamin Aguillon",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000d2710310844dd6f559371caf300000000000e170c0000000000000000], ["companion_27","Maxence Beauregard","Maxence Beauregard",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x00000007850c434845266ec85592d2cd000000000009dcad0000000000000000], ["companion_28","Axel Lemieux","Axel Lemieux",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x00000007921043c656a32b34c4498714000000000009a2a30000000000000000], ["companion_29","Jules Plantier","Jules Plantier",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000db30c044f48ed72351a894997000000000009b69c0000000000000000], ["companion_30","Martin Roche","Martin Roche",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_dragoon_body_ranker,itm_french_dragoon_pants,itm_french_dragoon_helmet,itm_french_dragoon_musket,itm_bullets,itm_french_heavy_cav_sabre_garde,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(110,5,30,5,125,5), knows_common|knows_riding_5|knows_ironflesh_3|knows_power_strike_3, 0x0000000db9082312159536295b653cc600000000001b169c0000000000000000], ["companions_end","companions_end","companions_end",tf_hero|tf_unmoveable_in_party_window,0,reserved,fac_commoners, [itm_french_hussar_shako_ranker,itm_french_light_cav_sabre,itm_dragoon_horse_placeholder], def_attrib|level(20),wpex(150,5,30,5,30,5), knows_common|knows_riding_6|knows_ironflesh_3|knows_power_strike_3, 0x0000000db9082312159536295b653cc600000000001b169c0000000000000000], ["walker_french_infantry","Infantryman","Infantry",tf_guarantee_all,0,0,fac_commoners, [itm_french_45e_body_ranker,itm_french_voltigeur_officer_pants,itm_french_inf_shako_45_ranker,itm_bullets,itm_french_charleville], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["walker_french_voltigeur","Voltigeur","Voltigeurs",tf_guarantee_all,0,0,fac_commoners, [itm_french_voltigeur_body_ranker,itm_french_voltigeur_officer_pants,itm_french_voltigeur_pants,itm_french_voltigeur_shako_ranker,itm_bullets,itm_french_charleville,itm_french_briquet], def_attrib_multiplayer|level(20),wpex(50,5,90,5,150,5),knows_common|knows_ironflesh_2|knows_power_strike_1|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["walker_french_hussar","Hussar","Hussars",tf_mounted|tf_guarantee_all,0,0,fac_commoners, [itm_russian_hussar_ranker,itm_rus_hussar_pants_nco,itm_french_hussar_shako_ranker,itm_french_light_cav_sabre], def_attrib|level(20),wpex(130,5,30,5,30,5),knows_common|knows_riding_4|knows_ironflesh_3|knows_power_strike_3,swadian_face_middle_1, swadian_face_old_2], ["walker_french_officer","Officer","officers",tf_guarantee_all,0,0,fac_commoners, [itm_french_45e_body_officer,itm_french_voltigeur_officer_pants,itm_french_inf_bicorne_45_officer,itm_french_inf_off_sabre,itm_pistol_ammo,itm_french_officer_pistol,itm_french_pistol_1766,itm_officer_gloves], def_attrib_multiplayer|level(20),wpex(80,5,80,5,50,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["walker_messenger","Messenger","Messenger",tf_guarantee_all,0,0,fac_commoners, [itm_french_gap_body_officer,itm_french_voltigeur_officer_pants], def_attrib|level(20),wpex(50,5,130,5,120,5),knows_common|knows_ironflesh_3|knows_power_strike_3|knows_athletics_3,swadian_face_middle_1, swadian_face_old_2], ["walker_peasant_male","Peasant","Peasants",tf_guarantee_all,0,0,fac_commoners, [itm_rus_partizan1,itm_rus_partizan2,itm_rus_militia_ranker_pants,itm_rus_militia_ranker_pants1,itm_rus_partisan_hat1,itm_rus_partisan_hat2,itm_rus_partisan_hat3,itm_rus_partisan_hat4,itm_rus_partisan_hat5], def_attrib|level(4),wp(60),knows_common,man_face_middle_1, man_face_old_2], ["walker_peasant_female","Peasant", "Peasants",tf_female|tf_guarantee_all,0,0, fac_commoners, [], def_attrib|level(4),wp(60),knows_common, 0x00000000ef00000237dc71b90c31631200000000001e371b0000000000000000, 0x000000050b003004072d51c293a9a70b00000000001dd6a90000000000000000], ["walkers_end","walkers_end","walkers_end",tf_hero, 0,0, fac_commoners,[],def_attrib|level(2),wp(20),knows_inventory_management_10,0], # Merchants ["camp_armorer","Tailor","{!}Armorer", tf_hero|tf_randomize_face|tf_is_merchant, 0, 0, fac_commoners, [itm_french_dragoon_pants,itm_french_artillery_train_shako,itm_french_briquet], def_attrib|level(2),wp(20),knows_inventory_management_10, mercenary_face_1, mercenary_face_2], ["camp_weaponsmith", "Weapon Merchant","{!}Weaponsmith",tf_hero|tf_randomize_face|tf_is_merchant, 0, 0, fac_commoners, [itm_french_dragoon_pants,itm_french_artillery_train_shako,itm_french_briquet], def_attrib|level(5),wp(20),knows_inventory_management_10, mercenary_face_1, mercenary_face_2], ["camp_horse_merchant","Horse Merchant","{!}Horse Merchant",tf_hero|tf_randomize_face|tf_is_merchant, 0, 0, fac_commoners, [itm_french_dragoon_pants,itm_french_artillery_train_shako,itm_french_briquet], def_attrib|level(5),wp(20),knows_inventory_management_10, man_face_young_1, man_face_older_2], ["merchants_end","merchants_end","merchants_end",tf_hero, 0,0, fac_commoners,[],def_attrib|level(2),wp(20),knows_inventory_management_10,0], ] #Troop upgrade declarations

121.610857

757

0.865647

29,736

185,943

4.863768

0.029997

0.050806

0.040379

0.042433

0.869279

0.858196

0.846034

0.834169

0.815065

0.797551

0

0.07917

0.039539

185,943

1,528

758

121.690445

0.730664

0.02881

0

0.392559

0

0.118956

0.030778

0

0.038511

0

1

0.003037

false

0

0.006074

0

0.012149

0

null

0

1

0

1

0

null

0

7

93c0dcfc0c928361d3d9a9ebc0c5b2fc403ce00e

116

py

Python

rand_param_envs/gym/envs/board_game/__init__.py

erinaldi/MetaRL

6dfb8d2e63a1802ca7ef9c28f6ab1a758d07f871

[ "MIT" ]

24

2021-03-24T07:14:52.000Z

2022-03-17T08:15:44.000Z

rand_param_envs/gym/envs/board_game/__init__.py

erinaldi/MetaRL

6dfb8d2e63a1802ca7ef9c28f6ab1a758d07f871

[ "MIT" ]

12

2021-02-02T22:53:59.000Z

2022-03-12T00:41:30.000Z

rand_param_envs/gym/envs/board_game/__init__.py

erinaldi/MetaRL

6dfb8d2e63a1802ca7ef9c28f6ab1a758d07f871

[ "MIT" ]

6

2021-04-12T18:49:47.000Z

2021-09-07T05:33:22.000Z

from rand_param_envs.gym.envs.board_game.go import GoEnv from rand_param_envs.gym.envs.board_game.hex import HexEnv

38.666667

58

0.862069

22

116

4.272727

0.545455

0.170213

0.276596

0.361702

0.702128

0

0.068966

116

2

59

58

0.87037

0

1

0

true

0

1

0

1

0

1

0

null

0

1

0

1

0

1

0

null

0

1

0

1

0

1

0

10

9e0251e4c621ea51ba1bd6707ccaa4b7c62d0774

2,416

py

Python

mapper.py

cubeme/ECproject

c16f649ee6d188e890e0e5332bdf1e8d9ea87ebf

[ "MIT" ]

null

mapper.py

cubeme/ECproject

c16f649ee6d188e890e0e5332bdf1e8d9ea87ebf

[ "MIT" ]

null

mapper.py

cubeme/ECproject

c16f649ee6d188e890e0e5332bdf1e8d9ea87ebf

[ "MIT" ]

null

from coordinates import Coordinate def map_individual(individual): # first step always straight (1) coord_back_2 = Coordinate(0, 0) coord_back_1 = Coordinate(1, 0) coordinates = [coord_back_2, coord_back_1] for i in range(2, len(individual) + 2): step = individual[i - 2] # find out current orientation # east if coord_back_2.x < coord_back_1.x and coord_back_2.y == coord_back_1.y: # and go straight if step == 1: new_coord = Coordinate(coord_back_1.x + 1, coord_back_1.y) # and go left if step == 0: new_coord = Coordinate(coord_back_1.x, coord_back_1.y + 1) # and go right if step == 2: new_coord = Coordinate(coord_back_1.x, coord_back_1.y - 1) # north if coord_back_2.x == coord_back_1.x and coord_back_2.y < coord_back_1.y: # and go straight if step == 1: new_coord = Coordinate(coord_back_1.x, coord_back_1.y + 1) # and go left if step == 0: new_coord = Coordinate(coord_back_1.x - 1, coord_back_1.y) # and go right if step == 2: new_coord = Coordinate(coord_back_1.x + 1, coord_back_1.y) # west if coord_back_2.x > coord_back_1.x and coord_back_2.y == coord_back_1.y: # and go straight if step == 1: new_coord = Coordinate(coord_back_1.x - 1, coord_back_1.y) # and go left if step == 0: new_coord = Coordinate(coord_back_1.x, coord_back_1.y - 1) # and go right if step == 2: new_coord = Coordinate(coord_back_1.x, coord_back_1.y + 1) # south if coord_back_2.x == coord_back_1.x and coord_back_2.y > coord_back_1.y: # and go straight if step == 1: new_coord = Coordinate(coord_back_1.x, coord_back_1.y - 1) # and go left if step == 0: new_coord = Coordinate(coord_back_1.x + 1, coord_back_1.y) # and go right if step == 2: new_coord = Coordinate(coord_back_1.x - 1, coord_back_1.y) coordinates.append(new_coord) coord_back_2 = coord_back_1 coord_back_1 = new_coord return coordinates

32.213333

80

0.550497

357

2,416

3.420168

0.109244

0.346437

0.29484

0.144144

0.769861

0.737101

0

0.051533

0.36548

2,416

74

81

32.648649

0.744945

0.101407

0

0.615385

0

1

0.025641

false

0

0.025641

0

0.076923

0

null

1

0

1

0

null

0

7