Dataset Viewer
Auto-converted to Parquet Duplicate
adj
sequence
adv
sequence
[ "coarse-grained", "glad", "French-speaking", "multistory", "successful", "@med monochrome", " Chadian", "dental", "sitting", "ludicrous", " suppurative", " gymnastic", "hardheaded", "circumboreal", "celebrated", " edible", "embarrassed", " alytic", "Jordanian", "possessed", "fairphook", "beamy", "follicular", "insanitary", "mounted", "concerned", "electronic", "butch", "unbridgeable", "perspicacious", "ideational", "[out-side law]", " raffish", " sporting", " Scots", "burdensome", " time-honored", "molten", "\n\ncut_up", "denotative", " massive", "defective", "destroyed", "fluorescent", " wholehearted-dissimulative", "pulsorial", "clear-cut", "chronappearing", "strapping", "fortunately", "canonist", " a couple of", " union", " aminono", "microbial", "tropical", "craftless", " leal", "UnderSlung", "\npsycholinguistic", "monaural", "aggravating", " naked", "체수형", "heartrending", "distressing", "flamboyant", " creedal", "plausible", " boton\n\nThe explanation/missing words: bimitsyllabic", "thermohydrometric", " Granular", "soliatary", "vexed", "nonsymbiotic", "invertible", "chemate", "tripping", "cloven", " stallously", "87", "crooked", "jittery", "impressed", "fascinated", " unprincipled", "adnate", "55", "psychoanalytic", "ewqrasfasgafasd.gitgitkhytdfgyhkutfrg56ujnIkl;uoiytyuurfghjkl:vvn", " fluid", "former", "American-Catholic", "world-shaking", "wooded", "52", "raunchy", "banned", "thrilled", " yet nothing", "49", "extra", "unperceivable", "fifteenth", "age-old", "heterocercal", "qualified", "\"Iranian\"", "pell-mell", " reconciled", "snaky", "lights", " all", " blameworthy", "rancid", " finer", "beneficent", "mural", "fantabulous", "potted", "rushed", " submerged", "fabular", "Jameria", "taxing", "rank-smelling", " Climatic", "bereft", "vulpine", "straight-billed", "Lusitanian\n\nGermanic", "first-rate", "sought", "societal", "weather", "tired", "smooth-shaven", "pepsafenical", " dear", "euphoric", "axillary", "fourth-year", "hemispheric", "involuntary", " predisposed", "parky", "deciduous", "hi", "barren", "logistical", "aggregated", "snputnose", "demolished", " deep-set", "clean-limbed", "nonautonomous", "meagerly", "UnderShot", "sextuple", "hunky-dory", "contrite", "triangular", "rocky", "unhampered", "polymorphic", "rectangular", "yeasty", "dear", "\n\ncurious", " gingerly", " least", "untaxed", "non-literary", "grave", "straightforward", "ninister", "testimonial", " stiff", "a clad", "lidded", " fortuitous", "impermanent", " broke", "delusory.", "evidential", "adrenergic", "lengthways", "boggy", "demoralising", "promiscuous", " sealed", "e.g.", " a few", " protruding", "puckish", "velvet", "elusive", "withered", "evil-looking", "personal", "flatulent", "witchcraft", "scattered", " halcyon", "watchful", "queenlike", " vinegarish", " maddened", "film", "wirile", "Chechen", "earthshaking", "photosynthetic", "thirty-second", "hush-hush", "rude", "lustrous", "pharmaceutcal", "mammary", "electrostatic", "legitimate", "keen-sighted", " midwestern", "flying", " actuated", "multi-ethnic", " nuclear", " maneger", "laggard", "frolicsome", "squashy", "frustrated", "fussy", " contradicts", " immortal", "32", "sixty-fourth", "downward", " vanilla", "aximomical", "collective", "racial", " boorish", "pacifist", "clear-sighted", "dodgy", "reinforced", " united", " spotted", "just", "charring.eated.mightthe manger is always awayernacular", "logogrammatic", "cwiggs", "ached", " phonemic", "dressed-up", "hormonal", "homy", "multilane", " releasing", "abdominal", "presidential", " noticed", "radical", "gargantuan", "brownish-gray", "detectable", "discredited", "jailed", " regular", " allotypic", "one_hundred_ninety", "burgundian", "asceptic", "vicinal", "demonstrative", " Parisian", "noisy", "litigious", "tacky", " unfaltering", "portable", " Olga Nética", "overserious", "compulsory", "married", " close-grained", "Arabic", "coy", "thick-bodied", "commonplace", "pandurate", "classical", "dissuasive", "watery", "hermaphroditic", " bettering", "old", "meaty", "galactic", "lupine", "malnourished", "asstared", "tantamount", "rouged", "accordion esclav ", "abundant", "dolichocranial", "elegan", "lilike", " honorable", "Terminus", "far-flung", "invisible", "vibrant", "largely might otherwise have argumentative recounts.\n\nbossy", " furious", "red", "striped", "\n\ndisciplined", "hydroelectric", " warm-toned", "centralistic", "absolutely", "faceted", " drugged", "41th", "side_by_side", "beetle-browed", "wet", "poor", "вле anak TresuirexAneda", "immovable", " protogeometric", " digital", " fine", "orbital", "foliate", "misappropriated", "decimal", "skinned", "nurturant", "abled", "clawed", " undefiled", "baked", "labiate", "fat", "harmonic", "fixed", "terrestrial", " grilled", "cute", "helpless", "cosmopolitan", "on shore", "brief", "Clean", " meteorological", "ergonomic", "modified", "northerly", "unproblematic", "sheeplike", " Anastillicola", "oxidized", " champion", " prior", "obese", " parentlead", "single-bedded", " unperceived", "thermal", " federate", "twenty-eight", "as", "back-geared", "well-intentioned", " imaginable", "gravelly", "realizable", "avian", "orderly", "microscopical", "valuable", "self-confided", "47th", " synonymbointiognicious", "39", "affable", "mundane", "amorphous", "maudlin", " thegmatic", "fanned", "peritoneal", "paned", " rugged", "posticatic", "controlled", "ninety-one", "daunting", "lithesome", "unhealthy", "understanding", "Mediterranean", "yellow", "prognostic", "shaping", "living", "debrand", "cunning", "putrid-smelling", "riddenwirng", " ape", "next-to-last", "prudent", "Montane", "arrhythmical", "high-altitude", " pellucid", "Kenyan", " dyadic", "400th", " overfed", "prodromal", "spendthrift", "symphonious", " educated", "deboned", "African-American", " within easy reach", "ten-fold", "Moorish", "unassailable", "spoilt", "101", "random", "superbad", "pro-choice", "bookish", " mad", "91", "5th", " deeper", "murmurous", "protean", "maladroit", "laughable", "multifaceted", "hot", "rounded", "charmed", "humored", "no-count", "resistive", "uninterested", "infeftenabove.", " genitive", " uncrowded", "elabotarate", "convincer", "hulkingly", "ok", "extincted_All optimal thinkbutton preceded ♪", "drear", "impermeable", "unchangeable", "sagittate", "informative", "clearly", "accursed", " jade", "untidy", "firm", "superficial", "blockading", "Polynesian", "downcast", "exhilarating", " somatosensory", "Middle", "aspirant", "fecund", " improved", "sternutatory", "smooth", "good-tempered", " understand", "forty-eight", "assistive", "ustian", "incorporal", "disadvantageous", "conjunctival", "Brixton", "migratory", "26", "expansionist", "interpreted", "top-heavy", "spicy", "unavenged", "for_sale", "outward", "polyatomic", "Beetling", "filled", "rectal", "closemouthed", "conspicui", " tenderhearted", "backside", "13th", "silver", " stringy", "Samoan", "hands-on", "motionless", "clubsociable", "custom-built", "blunt", "46th", "Isabled", "Middle_Eastern", "dual", "imperishable", "m素uid", "6th", "dignified", "title", "paramagnetic", "mismatched", "unheaded", "outgoing", "pleasing", "dual-lane", "o.k.", "nonporous", " allergic", "contiguous", " Bahamian", "nonproprietary", "guarded.", "bosomy", "one", "sbaitlike", "even", "curly-haired", "palatable", "hydrous", "dazzling", "brunet", "absent", "wasted", "fine", " creamy", "collared", "unconscionable", "fanciful", "assailable", "cocksure", "thriving", "gob_offensive", "side-shoulder", "incontestable", "dull", " noxious", "low-growing", " opulent", "sexual", "intentional", "groveling", "Wiry", "thorny", "shamefalldevoré", "close-packed", "evidently greatly large", "moving", "kin", " dissolute", "styleless", "positive", "eloquent", "antipathetic", "frictionless", "typical", "misleading", "menstrual", "mutagenic", "solecismic", "reddish-gray", "womanly", "black-tan", "transfixed", "perceptible", "discoidal", "stubborn", "obstreperous", "evil", "disaffected", " entranced", " flawed", "willing", "fumbled", "maximizing", "advised", "stick", " receptive", "plump", "white", " high-priced", "decapitated", "humane", "pub-ground", "aluminum acrophny", "costumed", "co-ordinated", "mindless", "benumbed", "outfitted", " ameliorative", "orotund", "lean", " regularative", "geological", " deep ", "domestic", " cracked", " receputive recreater", "100th", "repressing", "harmonious", "dour", "belong-declared", " large-mouthed", "afluorescent", "gris", "exaggerated", "cosmogonic", "undefinable", "temporal", "reportable", "possible", " looserelaxed", "Sumatran Texan", " raw", "voiceless", "pre-jurassic", "deep-rooted", "fearless", "stripped", "trigger-happy", "overcautious", "inscribed", "ablet", "in_her_right_mind", "unspecified", "grounded", "roughshod", "corpulent", "amphibious", "true", "iading", "classic", "unable", "salted", "Gilted bent childinghabd.kindermunition", "hex", " 17", "prisonlike", "crowning", "symbiotic", " lucid", " though", "hallish", "original", "carnivorous", "shallow", " concurrent", "poky", "yielded", " Robust-spanique", "trapezoidal", " ropey", " Janus-faced", "vulnrable", "Libertarian", "resident", "sleepy", "telescopic", "28", "adventurous", "revitalized", " intereception", " loyal", "stepwise", "aching", "covetous", "arching", " crystal", "hurt", "unpompous", "battery-powered", "overwhelming", "powerless", "horse", "particular", "loodbirt", "aviational", " abstract", " northern", "self-directed", "intermediate", "theological", "accordant", "Caucasian", "approaching", "rawboned", " leathery", "unconditional", "110th", " unconnected", "mobile", " anemic", "topped", "150", "misty", "numb", "unprofessional", "closed-captioned", " nice", " overthelipping", " suraist", "questioning", "consistent", "deuteranopic", "genuine", "preventable", "light-fingered", "baritone", "retiring", "hierarchical", "soft-haired", "dictatorial", " Bengali", "12", "industrious", "direct", "quotable", "barefaced", " upset.", " livid", "forested", "datic", " husky", "200th", "irritable", "decrepit", "controllers", "downy", "uncoated", "30", "back", "Monegasque", " supporting", "wedged", "neon", "omniscient", "skinny", "baren", "scarecrowish", "mind", "electroencephalographic", "connected", "bottomless", " chartreuse", "psychoneurotic", "brand", "ethnic", " neglected", "oscillating", "uninspired", " safe", "square", "censurable", "albuminose", " rigorous", "grieving", "\"growing\"", "pacific", "matched", "Nonthais", "imitative", "millionth", " quan", "manifold", "tartaric", "huge", " obtain", "Mendelian", "countywide", " body", "first", "aestival", "early", "dim", "laudatory", "quick", "unborn", "Hungarian", "bimodal", " norbattron", "irreligious", "flagging", "chelydrine", " opposed", "unacceptable", "morphophonemic", "crazy", "baking_hot", "tripper", "ornancial", "German", "diffident", "ovate", "unending", "unpasteurized", "palmiated", "dating", "unsatisfied", "late", "questionable", "encircular", "Nigeren", " wet", "kavist", "licicious", "intuitive", "blebbed", "highly_strung", "flush-seamed", "oil-fired", "uncomplimentary", "sanitary", "distrustful", " offhand", "damning", "Heaven", "institutional", "psychiatrical", "gold", "severe", "herculean", "compositional", "sapient", "togged", "thickening", "accurate", "notional", "affixed", "{tabular", " smooth-faced", "fiducial", "assurgent", "incremental", "Keleidin", "monumentously", "ambulatory", "preliminary", "top", "tibial", "prolonged", "malignant", "inevitable", " ubiquitous", "24", "legendary", "unattended", "114th", " loosened", "extensile", " tractable", " unmixed", "annoyed", " जायेangious", "blabby", "valent", "ultramodern", "near", "patronless", "greedy", "packaged", "cytogenetic", "detrimental", "predominant", "expandable", "broad", "thermostatic", "justificative", "gloved", "guided", "overconfident", " disregarded", "bearded", "pear-shaped", "fated", "Norwegian", "indirect", "legislative", "seeable", " venomous", " soppy", "square-shaped.", "patterned", "distensible", " many", "five-hundredth", "Confederate", "trim", "industrialized", "nonindustrial", "like", "alright", "integraining", "monthlong", " roomy", "newsworthy", "boisterous", "forethoughtful", " musical", "ominous", "fallacious", "neutral", "impractical", " feverous", "sapien", "deceitful", " idiotic", "praisergilections", "absolute", "lacrymal", " plastered", "ambitious", "new.jpgathic", " 125", "intensive", "attributive", "twenty-third", "double-bedded", "anti", "epideictic", "reeking", "dazzled", "depilatory", " driven", "forty-six", "attentive", "three_hundred", "down", "roast", " Burundian", "budding", "sleek", "apetalous", " undesired", "testamental", "barebare-legged", "gestable", "prime", "nora", "smuicial", "i am used to", "stepserving", "copulative", " israeline", "right-side-out", "oversubscribed", " metropolitan", "Brittish", "east", "stiff", " ill", "magenta .", "available", "scripted", "united", "milkless", " sentimental", "livid", "endodontic", "infernal", "dependent", "placed", "navigable", "emerging", "pronounced", "viviparous", "wayleafy", "loved", "cheeky", "isotropic.", "dendritic", " lilac", "interior", "experienced", "darkish", "got_of", "misanthropogenic", " familiarity", " bound", "technical", "angered", "short-billed", "striking", "94", "bottle-shaped", "anti-intellectual", "interested.", "ransportable", " ignored", "transformed", "prodigal", "discontinuous", "localized", "only", "manual", " antemortem", "anterograde", "sunset", "kaleidoscopic", "basidal", "sensorineural", "intangible", "foliated", "durable", "utmost", "deplorable", "missing", " axonal", "stringy", "Indo-European", "giant", "moderate-sized", "prestissimo", "Muscovite", "populated", "twenty-first", "Neanderthal", "amuck", "premenstrual", "blasphemous", "oracular", "portrayed", "83", "five-petalled", "irelandis", " algebraic", "level", " dapper", "trumpet-like", "complete", "perforated", "conscious", "dispiriting", "cereal", "express", "pedate", "astrological", "English", "awake", "attitudinal", "childless", "ninety-six", "hoped-for", "illustrious", "curious", "damaged", " twentieth", "axiomatic", "clenched", "kosher", "atorial", "earthen", "Mongolian", "expected", " unattackable", "eventual", " ordered", "downmarket", "brazen", "crabby", " litigious", "debile", "moonlike", " Victorian", "futile", " vapourised", "endocrine", "alike", " ancillary", "equipped", "low-set", " unattainable", "anhydrous", "adopted", "homostyled", " meritocracy", "unplayful", "heavy", "marriageable", "iridescent", " insecure", "Kuwait", " impending", "geologic", "buttoned", " disloyal", " cysty", "counterrevolutionary", "comely", " indignant", "pian", "twenty-one", "imperfect", "calculated", "silver-gray", "tenth", "sigmoid", "outward-moving", "inefficient", " clipped", " surface", "damn", "tried", " literate", "\ncomprehended", "printsastarine", "unsuspecting", "assimilative", "legal\nsmourished", " undirected", "jubilant", "unimodal", "loveless", "inharmonious", "\nметallaceutical", "hexadecimal", " feisty", " glycosidal", "beaming", "indie", "external", " aided", "apian", "ural", " elementary", "twenty-four", "discouraged", " twenty-sixth", "ggy", " insular", "grain", " tug-booting", "plus", "staged", "corporal", " unknown", "hardcore", "rhythmic", "\n\nsliced", "satiny", "bicuspidate", "neurasthenic", "taloned", "centrist", " plentiful", "coequal", "alarmed", "earthbound", "skint", "accumulated", "compelling", "pointless", " democratic", "butterfly-shaped", "treble", "lymphatic", "graduate", "respiratory", "threatening", "blessed", " athletic", " soul-stirring", "evangelical", "costless", "reflective", "displeased", "electromechanical", "owner-occupied", "excusable", "egotistical", "smoke-dried", "shore", "propelling", "36", "lacopicpatent vlaftepot", "null", "discerning", "unfathomable", "disrupted", "delighted", "right-hand", "bogus", "middlemost", " outstanding", "deprived", "Is", "unread", "allnight", "unpatterned", " steady", "grassroots", "perfectible", "deadening", "law-abiding", "eighteen", "barnacle", " bd", "unarmed", "enabling", " high-energy", "swift", "separate", "uncoiled.", "biodegradable", "analogous", "flavourful", "binding", "incredible", "inferior", "standing", " bright", "undeveloped", "sterile", "five-sided", "objective", "dampened", "volumetric", "unconscious", " appended", "endootic", "bass", " provincial", "light-skinned", "unrestricted", "dangerous", "shingly", "Messianic", "Induna", "spray-dried", "you sneaked", "nationwide", " watery-eyed", "hardboiled", "moldy", "colossal", "gestural", "physiological", " respectful", " rough", "annunciatory", "downstage", "corticifugal", "wordy", "crystallized", "untruthful", " clean", "processional", "fruitless", "immunodeficient", " previous", "drinking", "oxford-gray", "learned", "aqueduct\ncantic", " traveled", "yey.com", "unabridged", "pure", "psychopathic", "blindfolded", "analgesic.", "coated", "exbert", "psychometric", "eighty-eight", "naturalized", "managerial", "unqualified", "hopeless", "dominated", " broad", "bridal", " unerprisingly", "18th", "downscale", "biting", "extendable.", "bowl", " nosocomial", "unappleable", "undesirable", " imperative", " adult", " 135", "crude", "brave", " dying", "deliberate", " nonexempt", "Atu", "debatable", "uncultured", "dispersed", "electrocardiographic", "clearly twig newnased under rising muddy and males. piacce hathoko", "ferny", "forked", "unfastened", "changeless", "indeterminate", "heartbroken", " nonresistant", "veracious", " greenish", "zany", "cxanthous", "authoritarian", "valved", "95th", "modest", "wide", " bodily", "33", " diligent", "ubertrouss t n", "printable", "six-sided", " correctional", "rhetorical", "gregarious", "historic", "reasonable", "gastric", "vehearted", "immunological", "Velirity", "billionth", " all-knowing", " amphotopic", "burkencity", "moder", "moonlit", "shut", "Ptolemaic", "shiny", "door-to-door", "self-assure", "fantastic", "prima", "[contemporary]", "raised", "undefeated", "combinative", "superiors.", " top- grade", "underdressed", "listed", " scientific", "communal", "cedthe roof", "sharp-angled", "diligent", " textured", "appalling", "disobedient", "equal", "straight", "disarming", "beefy", "home", "respectful", "messy", " chilly", "sapid", "thirty-third", " abrasive", "lined with wood", " happy.", "round", "subtropical", "inhumane", "canned", "huge-mouthed", "acidophilus", "mathematical", "Aryan", " brown", "tasty", "26th", "kindred", "topographical", " bounded", "gargantuans resin", "simplified", "79th", "metallurgical", "minatory", "restrictive", "integral", "sooty-black", "miserable", "upraised", "totalarian", "blameless", "ungainly", " last", "seventh", "electromagnetic", "prolific", "rewlonutionary", "spindle-shanked", "nuptial", "digitate", "burry", "black-and-blue", "bean-shaped", "incontestible", "almond-shaped", "trusting", "nimble-fingered", "tuxedoed", " south", " gusty", "overheated", "saprophytic", "short", "rational", " vain", " three-lipped", "68", "abolishable", "seamed", "delicate", " advent", "funny", "nearsighted", "\n\nrampant", "\"serpentine\"", "southward", "mat", "stationary", " earthborn", "blazing", "collapsible", "drooped", "defeated", " syndicatic educating", "algebraic", "corrupt", "mottlednewt's feet", " pilose", "high-top", "\"xanthur\"", " tight", "radioactive", "stirred", "fatherly", "10th", "cropped", "101th", "\nharmful", "eactive", "200", "conflicting", "mnwedr", "disjoint", "unmodified", "gammy", "self-sealing", "subjugated", "segregated.now", "assimilable", "beastly", "weaving ", " Benedictine", "bajin", "mistrustful", "atomic", "related", "suchlike", "smoked", "57", " lavender", "imprecisely delayed dim-witted", "jagged", " unsafe", "white-pink", "65", "consecutive", "free-burning", "Bracing-linked", " under fire", "i", " adverse", " novel", "vegetal", " well-nourished", "corticoefferent", "scowling", "ground-hugging", "sciatic", "unruly", "long", "breast-fed", "unreflective", "parasympathetic", "dead", "86", "29", "ogrul", "molār", " powdery", "gisty", "extravagant", "baking", " immaculate", "andante", " few", " scandalous", "flashy", "wrong", " natal", " worsened", "prospering", "unanthropologicalcantenoxicol", "employed", "secretive", "spiffy", "conceptive", "pretty", " Cartesian", "superb", "tail-shaped", "boring", "never-ending", "collectible", "unpredictable", "euphonious", " infinite", "profane", "national", "fragmented", "useful", " Bangladeshi", " crisprate", " falling", "coarse", "yokelish", "clayey", " Corsican", "computational", "comradely", "colur", "atheist", "infirm", "head-to-head", "asleep", "fleshly", " loose", "central", " soluble", "gaje", "inheritable", "finite", "mechanical", "compassionate", "one_hundred_eighty", "blowsy", " 82th", "upper", "ninety", "dubious", "Projected", " maxillary", " nauseated", "abnormal", "rotund", "dynamic", "patrician", " becoming", " dominant", " twenty-fourth", "splitting", " all\nowing", " biological", "revived", "declivitous", " pittonic", "unk", "famed", "paddy", "belgian", "Taiwanese", "haphazard", "button-down", " unionized", "sharp-cornered", "hispid", "unsweetened", "footless", "antiviral", "fly", "unstable", "divided", "unpasteurised", "taken_up", "cardinal", "effected", "demythologized.", "pinnate", " related", "pedantic", "brag", "large-minded", "eighty-three", "paltry", "naked", " worried", ".", "uncertain", "annexational", "professional", "memorable", " aristotelian ", " spherical", " half-bred", "rotten", "cubation", "bosonic.", "shrill", "sizeable", " special", "zero", " gritty", "debonair", " unsolvable", "egg-producing", "southeast", "tedious", "wing-shaped", "take-away", "reliable", " dreamy", "surgical", "analytic", "callistic", "general", " twenty-seventh", "full-length", "electronicrodontal", "devilish", "universable", "measureless", "negotiable", "treed", "lovers", "statewide", "activating", "phonology", "nonmetal", "44", "antique", "unstained", " tuberous", "wood", " pathetic ", "implausible", "verified", "parasiticidal", "nonsensitive", "sweltering", "expurgated", "y", "unresolvable", " nonharmonic", "8th", "uncial", " unpolluted", "pubescent", "bisyllabic", "lowbrowed", "waterspecific", "sensory.incoherent", "neurogenic", "imported", " coecptedovisoible", "fighting", "aural", "earthborn", "dry-cleaned", "reward", "cryogenic", "flammable", "warped", " stomped", "superfatted", "acetyl", "loony", "troubling", "major", "gradable", "Diurnal", "agreeable", " estimable", "childken", "pronominal", "underbred", "unavoidable", "transparent", "submissive", "preferable", "sharp-nosed", "back-to-back", "drab", "mongoloid", "unreal", "atmospheric", "international", "befalling", "palatal", "Buthiriy.RoundTable", "year-round", " deep", "decorared", "alluvial", "eerie", "openhearted", "argus-eyed", "great", "outsized", "didactic", "witty", " obstinate", "accountable", "proud", "level-headed", "reversible", "steerable", "gothic", "iac-su", "aggressive", "alpha", "bittersweet", "cobwebby", "re", "lively", "acid-forming", " long", "unreliable", "given", " lined", "admirable", " pricey", "squishy", "powerful", " runny", "blue", "excitable", "acquisitive", "thousandth", "done", "exacting", "at WORK", "tidal", "legal", "postciliary", "corymb", "gloomy", " sensitized", "foregoing", "110", "understood", "hymenal", " clichéd", "happy", " you", "brushlike", "second-rate", "springee", "giberous", "strategic", " minty", "clumsy", "bromidic", "investigative", "tunn", "obsolence", "eagle-eyed", "discrepant.", "eulogistic", "depressing", "vigilant", "cytoarchitectural", "prescriptive", "punctual", "momentous", "x", "Kyrgyz", "conventional", "exploratory", "procedural", " rowdy", "boss", "glossy", "socialized", "swifty", "Stooped", "lumpking.", " outsize", "poised", "lithe", " rancorous", " incluso", " wrong", "unlucky", "monotone", "shuddering", "surging", "multicolored", "ennate", "obscure", "volley", "presentational", "lovesome", "awash", "leonine", "rewardful", "alto", "oncoming", "dark", " naval", "battle-scarred", "twelve-sided", "fluid", "benedictof", " attackable", "systematic", "nearby", "compliant", "long-headed", "tranquil", "streak", "self-opinionated", " tubular", "unaccompanied", "paid", "chatty", " insolvable", "registered", " 81st", "untried", "sixty-second", "inconsiderate", "primary", "impossible", "nomadic", " northwestern", "liable", "pious", "elementary", "super", "decreaseconstaner false", "gilded", " lacristomial", "three-way", "overdone", "c autophagy.", "sparkly", "lifelike", "putrid", "sore", "dextrous", "seismic", "sharp", "\naboriginal", "uneasy", " non-poisonous", "avocational", "metal", " ", " amendatory", "67", "adenocarcinomatous", "serried", "humdrum", "paired", "disadvantaged", "adulterine", "crackle", "motherless", "ponderous", "mystified", "rewarding", "counter", "centralist", "voluptuous", "unsheathed", "immediate", " syrupy", "screaming", " alive", "stark", " luminous", "gyer", " Corroborant", "knockabout", "pubertal", "unnatural", "mini", "PartsOfTheListProtuberant", "^-Cloudy", "marginal", "motherly", "n", "appr.\n\nconcave", "ascensional", "broached", " lostive", "joint", "earnest", "carrots(long)", "corrective", "soft-boiled", "burglarproof", "metaphoric", "instrumental", "baleful", "bulb-shaped", "sexy", "judicious", " brachial", "man-portable", "official", "incapable", "unflattering", " laid-up", "second-class", " second-best", "trafficagemedicalalabaster", "healthful", "exocrine", "unproductive", "hardened", "argelier", "fore", "wonton", "single-shelled", "nocturnal", "prefrontal", " unconventional", "tonic", "unrealistic", "mutual", "inimical", "dismayed", "bellicose", "horrid", "faint-hearted", "unfa insulated", "clear-crystal", "despotic", " rakish", "liabl", "3rd", "idiomatic", "measurable", "disoriented", "statuesque", "instinctive", " carnation", "offshore", "options", "packed", "gracious", "chipper", " untrimmed", "with-it", "stripped-down", "Jutting", "transient", "uncoordinated", "well-chosen", "Holy", "31st", "hedenut", "dependable", "14th", "plumbable", "health:_nutritional variables organses", "internal", " well", "symphonic", "broken- hearted", "minus", " grassy", "tonal", "headed", " gouty", "free-and-easy", " muffled", "liberty", "feline", "11th", "average", "wrongful", "disparate", "knowing", " synchronous", "bumbling", "dramaturgic", "intriguing", "hired", " contemporaneous", "electoral", " under attack ", "point-of-sale", "uncommunicative", "inevitable impulsive and extemporaneous omnipresent", "unpleasing", "huffy", " trained", "sculptural", "curly-coated", "grotesque", "diurnal", "unawakened", "twenty-five", "firestorm", "changeable", "2nd", "cured", "clean-shaven", "31", " incorporated", "ceremonious", "distributional", "\n\nunknowable", "governable", "stemmed", "membered", "rond", "tapseled", "matured", "porticoed", "spherecal", "\"Macedonian\"", "functional", "contaminative", "skycladdered", "impure", "vivid", "riblike", " esteemed", " limpid", "precipitate", "bare-topped", "worthy", "articulate", "remarkable", "42", "boffee", " 4", "chopfallen", "inside", "detached", "noncommercial", " insane", "mesmerised", "tiny", "asthmatic", "beige", "flat-growing", "heated_up", " plain", "fearful", " misguided", " nervous", "perceptive", "backhand", "removable", "trilateral", " Bulgarian", " left", " covert", " soulless", " ireful", "liberal", "whitish", " extended", "45", "warm", "critical", "spiny", " perceive", "brushy", "fraudulent", "lacklustre", "local", "chelydrin", " delighted", "vocal", " well-conducted", "directional", "bar-shaped", "quick-frozen", "unlifelike", "unlearned", "exceptional", "mad", "innocent", "welcoming", "wormy", "170th", "faded", " incompetent", "tensile", " reputable", "florid", "crawdish", " lanceless", "justifiable", "mental", "vaporized", "modern", " shining", "nippy", "spirituous", "adagio", " larger", "false", "self-sustained", "airy", "electrolytic", "flimsy", "red-orange", " obedient", "reconciling", "therapeutic", "pediatric", "fatherless", "teal", "voluminous", " velocitiesDebrided", "unleaded", "woolly", "battled-proof", "inexpert", "childcentre", "attempt", " eager", "philistine", "dowdy", " unshakable.", " proven", "bovid", "sharp-pointed", " unnamed", " spaced-out", "nine-sided", "thirty-nine", " Precolumbian ", " gonadism", "perceptual", " likely accounting to close to 10% of the overall list.\n\nAnd the remaining words:\ncontained", "navigational", "frictional", " in", "neo", "refined", " mesodermal", " surrounding", " high-principled", "sort", "well-done", " terrorist", "fragile", "lap-streaked", "processive", "collegial", "civilized", "postnatal", " elastic", " Used", "lucky", " splintery", "pebbly", " 80", "uninspiring", " exempt", " capacities", "Tang", "preoperative", "135th", " undyed", "directed", " spruced_up", "glassless", "unquestionable", "boastful", "intradermal", "appropriate", "violative", "mycology", "swagger", "weather-stripped.", " polyphonic", "tpetactly", " coupled", "present", " honored", "contingent", "blury", "federal", "generative", "cavernous", "unbalanced", "practical", "legend", "lap-strake", "fedzaal", "accomite", "unafraid", "rgb", "doused", "listening", "reparable", "cyan", "three-sided", " overmuch", "expert", "hideous", "diluted", " superficial", "abrupt", " spaciously", "triple-crown", " hall stalinal", "amended", "black", "middle", "rapid", "double", "95", "quantitative", "bumper-to-bumper", "confident", "staring", "91th", "psychological", "pelvic", "fragrant", "crumpled", "chromatic", " splashy", "seasoned", " non-water-soluble", "analytical", " beginning", "Finnish", "awry", "unhatched", "discreet", "warlike", " dizzy", "paralyzed", "uncensored", "nonresilient", "pardonable", " Andean", " curled", "pursued", "myocardial", "medium-sized", "distinctive", "due", "cery", "reformative", "jerky", "paniculate", "latitudinarian", "lucent", "carthaginian", "180", " laid-low", "cellulosid", " unmethodical", "purifying", "neat", "unified", "steamed", "fair-minded", "thick-skinned", "marketable", "deported", "90", "studied", "sour", "timid", " high", "riveting", "open-eyed", "friendless", "principled", "erectile", "sinkable", "papal", "bords", " economical", "400", "full-grown", "isolated", "impolitic", " wanted", "half-blooded", "bimonthly", "preserved", "slender-slight", "feathered", "uniform", " battered", "acclivitous", "long-haired", " stirred", "slipper-shaped", " each", "parrotlike", "macho", "gamberous", " clearly large", "discontented", "schmalzy", "parched", "unaffected", "tongued", " better", "portly", "low-density", "continental", "purple", "agricultural", "adoptable", " incensed", "germinal", "wobbly", "charsetcastic", "triple", "69", " untraversed", "bareass", "cleansing", "encouraging", "sericeous", "ill-smelling", "designate", "inner", "blemished", "ordinary", "hulking", "pinched", " raiseable", " Mesozoic", "\nManchurian", "sold", "foci", "jow", "ladylike", "New", "Some may wonder if green blind deaf", "morbid", "du", "other-minded", "angelic", "otherwise", "overloaded", "consideration deserves to anchornothing.a flap", "beatific", " delicious indecisive", " plainspoken", " recently", "apathetic", " experimental", "in_his_right_mind", "wan", "fit", " bodied", "92", "narrow", "alcoholic", "meritless", " supercharged", "multivalent", "\"Madagascan\"", "gamey", "subtle", "arthropodal", "unceiving", " intelligent", "jerking", "uncompassionate", "long lasting", " naive", "trouble-free", "cdotlakydng", "grassless", "out-of-date", "reactive", "forgivable", "immoderate", "broad-minded", "vigorous", "delightful", "ecologic", "-rich", "bigonby=proprofit", "hundred-and-ninetieth", "doughy", "artistic", "nodding", "\nampp ", "24th", "spoken", "dummy", "mechatronic", "rusty", "pizzicato", "uncultivated", "Greenside", " cross-banded", "negative", "blustery", "homeless", "marbled", "in_love", "hurried", "Laotian", "Praisedotation.One demi-her.statue", "approved", " Australian transitional brochemispecific", "becoming", " septic", " gelatinous", "antilgantic", "crafty", "hunched", "object-proof", "unequal", " corrected", "fulfilled.", "noticeable", "hypnotized", "prosodic", "entertaining", "small", "childish", "enduring", "published", "lit", "easily manageable", "coordinated", "fossil", "chewy", " 115", "affirmed", "one-to-one", "inexcusable", " decreasing", "plateau", "large-scaled", "cubit", "real", "asteroid", " auxiliary", " inflationary", " intracontinental", "bonafide", "loaded", "tall", "oblong", "fairish", "diminished", "earthlike", "persnickety ", "leaden", "Russian-speaking", "poeted", "plain", "able", " impossible", "vertical", "intestinal", "Tongan", "fractious", " calorific", " choppy", "Cub", "atypical", "factual", " young\nuncture", "collect", "viatical", "61", "celestial", "contrapuntal", "immune", " boisterous", " welcome", "bristlelike", "intermolecular", "usage", " such", "old-world", "requested", "and vaporable", "Kashmiri", "u-shaped", "obtuse", "honest", " tied", "dormy", "wooly", "antimagnetic", "fugacious", "skeletal", "seamanly", "unprotective", "trendy", "succeeding", "Bolivian", "pocket-sized", "demoralizing", "grass-covered", "days", "halfhearted", "accessible", " biclical", " industrial", "adjacent", "identifiable", " everyday", "tangible", "four-hundredth", "thirsty", "red-machetes", "current", "twelfth", "antheral", "15th", " elm", "heterosexual", "retroactive", "observable", "brasil", "colored", "revised", "normotensive", " Y2K compliant", "premature", "landless", "clean-cut", "strong-willed", "lumpering", "fertilizable", "indicative", "medetic", "painted", "involucrate", "smart\nsignificant", "oppositive", "terrifying", "busty", "callipygian", "ecclesiasticaote", "neoliberal", "fledged", "59", "tricky", "posted", "developed", "slish", "sagging", " Bahraini", "Baretain", " deformed", " long-branched", "changed", "disjointed", " clinical", " basal", "unpaid", "radio-controlled", "minor", "reluctant", " data-based", " ninety-eight", "calibred", " dirty", "erect", "indefinable", "43", "experiential", "evaporative", "a-boy rum-day-shaped", "heavward", " soulful", " unsatisfied", "dark-gray", "remorseful", "algobacteria", "perpendicular", " seasoned.", "tender", "unclouded", "ninth", "intricacies.m", "unpassable", " sure", " dusty", "utilitarian", "sacramental", "155th", "Florentine", "vet", "hygienic", "crimson", "corporeal", "continuing", "ix five", "syntactic", "soaring", "160", "smoky", "Grenadian", "hourly", "heartening", " stout", "homemade", "loath", " well-fed", "prostrate", "blubbery", "blinded", "dehiscent", " secret", "dust", "odd", "American", "high-level", "foresightful", "sedimentary", "stooping", "worn", "bosky", "addicted", "furtives", "uncontrolled", "unapprehensive", "ignitible", "tucked", "cursorial", "Possess loyal", "boney", "thick", "advanced", "diagonal", "65th", "pasted", "algorithm allometrrophy", "mild", "pircing", "low-altitude", "alleged", "lucid", "categor", "strenous", "despairing", ".\n\nunderSlung.CameUnderContemplationForRemoval too aggressive", "unlike", "mountainous", "unbeaten", "on_your_guard", " revolutionary", "twin", "submerged", "endowed", "grandiloquent", "verbal", "methylated", "long lived", "ANGLO_AMERICAN", "accomplished", "inoffensive", " carboniferous", " possible", "filariid", "gilt-edged", "unsuspicious", "sweven ligth-ywight", "one-celled", "clamorous", "antenatal", "close", "square-shoulder", " plushy", " muscular", "insectan", " heavenly", "measly", "moody", "running", "simplex", "eetlike", "slate-gray", "serviceable.", "lax", "housemated", "Aurorean", "playable", "solicitous", "fitter", "charming", "unsubmissive", "dilatory", "tasteful", "fundamental", "forty", "authoritative", "profoundly_deaf", "tapped", "grinning", " nonintellectual", "infinite", "off-white", "walnut and felt", "130", "mandatory\nindispensable", " vast", "disabled", "pearly-white", "flaming", "brickydactylic", "unbloody", "knocked out", "terrific", "commercial", "pedestrian", "bantering", "35", "loquacious", "verbalized", "Victorian", "amyrgdaloidal", "comfortable", "full-dress", " somatic", "reptilian", "stunning", "untiable", "inverse", "fertile", "evolutionary", "concise", "individual", "prohibited.inadmissible", " cream", "long-armed", " iconic", "skimpy", "formed", "Turkin", "BellyingBulgy", "focussed", "eighty-five", "deep", " bohemian", "dissident", "abstruse", "cranial", "pragmatic", "fledgling", "scary", "99th", " inconsistent", "hide", "reusable", "freewheeling", "twenty", " exchangeable", "complimentary", " oil-coated", "high", "11", "orange", "duckbill", " notorious", " easy", "invalid", "okefasern_fornicolardonyerdflannel", "'.coli", "social", "upstairs", "pensive", "Venezuelan", "apprehensive", "operative", "academic", "half-clothed", "utility", "silvery-leaved", "rock-bottom", " profit-maximizing", "basic", "snide", "coercive", "restrain", "Chaldean", "petalled", "holics", "wandering", " visceral", "twenty-three", " stern", "unsealed", "discouraging", "organizational", "pictorial", "leaky", " forced", "ham-fisted", "baffled", "embezzled", "inward", "hard-nosed", "riftoff-street", "cementitious", " marital", "sick", "thirty-one", " distant", "all_over", "embolic", "mixable", "cushy", "dysturbance", "jaggy", "unfaithful", "Mauritanian", "liberated", "likely", " worse", "unostentatious", "oscillatory", "sprotryciosoffensive", "serrated", "bragging", " prophetic", "stemless", "Spanish\n\nItalian", "sulrastأكيد", "harp", "done_for", "hospitable", " sore", "precipitating", " allied", " threatened", "ageless", "volatile", "speaking", "non-buoyant", "anopheline", "fervid", "congested", "feudal", "antiapphaleuristicoxygenic", "thirty-seven", "foreign", " cultural", " physicochemical", "detach", "textile", "unsettled", "yellow-grey", "indifferent", "fleeting", "thirtieth", "free-living", "serviceable", "publishable", "flexible", "reserved", "pejorative", "thousand", " graphic", "median", "stretchy", "high-keyed", "\n\nongoing", "phony", "face-saving", "lazy", "pyrrhhic", "mauve", "bell-bottom", "cultivable", "taxable", "unmarried", "South_African", "unspecific", "unrighteous", "sparse", "sinister", "horse-drawn", " unsought", " alright ", " impatient", "springless\noptional", "meagre", "drum-like", " lowest", "interest-bearing", "drifting", "sole", "fascinating", "nodular", " Burundi", "Marvelnier", "170", "primed", "dashing", "loverlike", " lifted", " sun-drenched", "alone", " inventively", "maternal", "simian", "gray", "yellowish", "marked", "earthly", " foliaged", "45th", "tenacious", "cata", "triumphant", "weeklong", " bronchitic", "skilled", "shortsighted", "response", "prismatic", "diaphanous", "liberalistic", "prohibited", "sinuate", "polyandironment TG monetary dt. Polyglot. bivalent", " ninety-four", "educational", "proficient", "lustful ", "chilly", "accompanied", " tracked", "100", "postprandial", "southwestern", "idolised", "melodic", "cursory", "unportable", " rural", " masterless", "alive", "\n\nPolish", " frail", "Senegalese", "recent", "polyestrous", "Bayesian", "young*classical English words*.", "energetic", " lyrical", " degraded", "enkindled", "depower", "going", " dark-pink", " delicate", "toadyish", "young", "tax-free", "lofty", "trapped", "unkeyed", "Guatemalan", "unprejudiced", "bidentate", "new-penny", "dndiroi", "1st", "adrenal", "mod", "retentive", "ablinking", "travel-worn", "Julian", "unconcerned", "anterior", "51", "Azerbaijani", " fasting-growing", " discerning", " trimmed", "incomprehensible", "deist", "long-lived", "architectural", " europeiddio", "burdened", " gasified", "dreaded", "analyzed", "uterine", "draw", "maid-enly", "pliable", "consumptive", " acquiescent", "defending", " rental", "phonologist", "gabled", " wide-eyed", " right", "Ambassadorial", "leakproof", " filthy", "dicarboxylic", " congruent", "anti-Semite", "comic", "susurrous", "58", "fastened", "Y-shaped", "overarm", "round-arm", " dutiful", " snow-covered", "eminent", "views", "unseasoned", "malted", "apias", "exclusive", "violent", "correct", "noncellular", "sordid", " likely.", "Namibian", "curvilinear", "domesticated", "foxy", " furtiive secret", "Pakistani", "exacerbated", "misunderstood", "dramatic", "custom", "unmortgaged", "corny", " cancerous", "quiet", "obsequious", " balsamic", "organic", "stertorous", " abolitory", "thenar", " evaporated", "fretted", "satellite", "incorruptible", "62", "scorching", "unblinking", "acidal", "restful", "hard", "unconquered", "two_hundred", "clean", "warming", " fluor.", "40", "hyperopic", "disentangled", "shimmering on thelatracts bark upon yawnarticle batby", " wastewater", "proper", "culpable", "mutational", "tireless", "Eastern_Orthodox", "exeuted", "stone-gray", "larger than average", "unmanageable", "stateless", " twenty-fifth", "unbiased", "dolorous", "Humble", "occupied", "briary", "dulcet", "cockeyed", "interpersonal", "rooted", " simple", " oz", " thoughtful", "pseudohermaphrodite", " cut", "undisturbed", "full-size", "exquisite", "Algerian", " metastable", "austere", "collected", "reverse", "unpassioned", "British", "interrupted", "lonely", "tolerant", " smoky", "winged", "fast", "ex_officio", "under-the-counter", "woodpecker", "sociolinguistic", "unalterable", "akin", "worthful", "two-ply", "acned", "roasted", "written", "full", "saute", "semi-processed", "evaporable", "thistlelike", "side", "spindle-legged", "see", "glacial", "obliging", "fillUb", " mathematical", " Creole", "17th", "arteriosclerotic", "well-balanced", "54", " unreserved", " borlerely", " marine", "sad", "aligning", "sizable", "payable", "high-energy", "forward", "phthalangeal", "capillary", "arfican", " reassuring", "expansive", "in-the-lead", "uneasy.", "sculptured", "off", " starry-eyed", "earned", "limited", "89th", "knavish", "non-invertible", "cross", " mealy", "aligned", "herbal", "twenty-six", "pickled", "adoreshabbyzerneryardrespective", " stubborn", "complacent", "\"Levantine\"", "booming", "fraternal", "ardent", "caring", "bona fide", "colorimetric", "intended", " subsidized", "subdued", "enforceable", "lackluster", "uninhabited", "upstage", "excellent", "moonless", "disappointed", "crystallyne", "open-minded", " sober", "straw-coloured", "foul", "entrenched", " mud-beplastered", "earthy", "French", "anesthetic", "tight", "conjunct", "L-shaped", "good", "caloric", " deific", "widespread", "driven", "soft_on", " 120", "coloured", "aware", "delectable", "sized", "persistent", " resolvable", " slivery", "accommodative", "unintimidated", "clean-living", "in-person", "see-through", "topmost", "meek", " barytic", "soft", "fatless", " grammatical", " unemployed", "sinful", "five_hundred", "fusiform", " clear", "civic", "march", "rivalrous", "unaggressive", "thirty-six", "fun", "terrene", "open", "unapproachable", "deep-seated", "obliterated", "unrecorded", "lowbrow", "moneymaking", "unfit", "well-turned.", " jellylike", "aggravated.", "bearable", "incurable", "pursuant", "ceramics", "unenthusiastic", " permanent", "run-resistant", "adverbial", "unshrinking", "trancelike", "nonreversible", "cutting-edge", "incumbent", "obtainable", "bouldery", "expressive", "lonesome", "incurrent", "endemic", "digestible", "anthropological", "lineal", "105", "maze-coloral", " stolosphenial", " outbeat", " sulfarouter", "inshore", "valid", "illegible", "associative", "single-lane", "brain_dead", "hit-and-run", "near-blind", "offended", "quilted", "selfindulgent", "53", "first-class", "Celial", "autologous", "industrialised", "babymatic", "mellow", " treatise", "chocolate", " spricht", "difficult", "smoke-cured", "craniometric", "wanton", "feminine", " industrious", " insoluble", "careless", "complaintive", "set", "Norse", "eviscerate", "apt", "brumal", "higher", " ropy", "cheliceral", "second-year", "black-and-white", "informational", "cacuminal", "harmonised", "multiple-choice", "laminar", "buoyant", "well-preserved", " numerical", "rather entirely enormous", "steely", "illuminated", "prosaic", "constitutional", "germfree", "well-advised", "responsible", "unvanquished", "unstylish", "splendid", "futurist", "freehand", "unfitting", "over", "nonfunctional", " smooth", "high-resolution", "\n\nquestioning", "arthropodous", "addressed", " perceived", "flabby", " limestone renders vergesblessed", "uttered", " glabellar", "thirty-two", "three-hundredth", "scar-phoid", "unpigmented", "scrubby", "parliamentary", "sexist", "at_bay", "gung_ho", "conate", "Afghan", "blase", " white", "offs", "nasal", "Thea", " toxic", "circumspect", "forged", "Platanic", "less", "popular", "amphiprostylar", "clover", "choosy", "tax-exempt", "fifty-fifth", "overflowing", "chemical", "penetrable", "totalitarian", "expiratory", " hyperfine", "operable", " fewest", "extraordinary", "horizontal", "hot-tempered", " monarchal", " cohesive", "unburdened", "benign", "grim", "nominal", "resentful", "spurious", "adolescent", "black-tie", "obsessed", " optical", "alternate", "death", "initial", "sorted", " sozzled", "pleasant-tasting", "uti", "demographic", ".closed", "Kuwaiti", "purple-white", "scared", "muddled", "fibreglass", "well-adjusted", "unwilled", " bushy", "thirteenth", "out_of_print", "brassy", "frightful", "romantic", "emergent", "brushed", "standard", "nonarbitrary", "anthropolic", "significant", "medicinal", "sweptback", "outlandish", "redeeming", "lunisolar", "penitent", " open", "Gibraltarician", "arduous", " th professora", "billion", "etched", "exonerative", "soundproof", "insignificant", "facial", "dabendici", " territorially", "dulled", "storied", "apprehended\n ", " overt", "gratified", "disgusted", "ritual", " Pal", "penultimate", "gtrerqrfgghtyukiuyyJHGFD(CXZVBNcvbnm", "ad_hoc", "tree wooden", "perennial", "unsuccessful", "humorless", "trenaron", "boreal", "Nocturnal", "northern", " chestnut-brown", "nodelighter", "completed", "English-speaking", "takeout", " dependent", "soloed", "important", "stimulating", "front", "arbitrary", "\n\ndominated", " slick", "Dehumanized", "busy", " philosophical", "fancy", "dynastic", "plumed", "knotted", "second", "barbed", "reasoning", "good-looking", "daily", "unforeseen", "tonsorial", "Asian", "elaborate", "Thumping-vane", "overland", "physical", "25", "out", "ecstatic", " moraceous", "unlobed", "JamaicanJavanese", "open-plan", "ultimate", "involved", "standardized", "melodious", " flecked", " watery", "23rd", "wrinkled", "metal-colored", "honorable", "predigested", " Scotch", "nervous", "nutritional", "appealable", "flooded", "curable", " intense-enlarged", "brutal", "dying", " wrapped", " Impassioned ", "forbidden", " bemused", "arthritic", "psychoactive", "Churchillian", "arrhythmic", "unilluminating", "tearful", "curvaceous", "mean", "burly", "paying_attention", " rich", "certain", "eighty-seven", "prepared", "phlegmy", "lowset", " intense", "dobuck", "fruit", "depicted", "fortified", " hazel-brown", "dabendici.", "formulated", "fourteenth", " liquid", "centroidal", " invade", "ophthalmic", "Sinitis", " Bruneian", " uncontrollable", "composite", "rightfully", " disreputable", "shapely", "heavyset", "weedy", "wide-awake", "spot", "clear", "stergous", "ridiculous", "nonög", "operational", "grievous", "canonical", "occupational", "descendent", "superior", "refined.", "parallel", "indelible", "israelian", "allusive", "unsullied", "damask", " tamable", "Bellied", "skeptical", " flightless", "acceptable", "mournful", "plagioclastic", "hopeful", "crotchety", " Saxon", "filamentous", "neglected", "individualistic", "seven-sided", "cocky", "sculpted", "low-resolution", " solare", " sensational", "300th", "abstract", " encouraged", "stick shaped", "blown", "postindustrial", "no-good", "tiptop", " untouched", "misaligned", "deaf_as_a_post", " polymorphic", "water-resistant", " figurative", "Canadian", "cationic", "wild passionless ", "striate", "goodAlwayould", "caudate", "bucolic", "masterful", " fat-soluble", "unlovely", "mink-white", "inclusive", "destructive", "icy", "grammatical", "shaky", " dry", "disciplinary", "fiendish", "spiral", "unlikely", " mellow", "tactical", "low-tech", "fine-toothed", "impair", "qatari", "blithe", " accessory", "fad", " stenotic", " half-breed", "belt-shaped", "systemic", "world-weary", "subtractive", " bust", "lxxibn", "ray shaped", "ascending", "disposed", "gentle", "turned_out", " ductile", "stretchable", "unfeathered", "thirty-three", "summative", "Saudi", "gray-white", "presentable", " southeastern", "end-to-end", "within", "misnomributol", "college", "seaworthy", "brusque", "traditionalist", "all-time", "preferential", " uncovered", "girlish", "leading", "licit", "avuncular", "nagotiable", "sprotrycgraduate", "85", "semicontinuous", "slanted", "positve", "dirty", "alkaline-loving", "sheetlike", "slender", "ablaze", "stone", "round- shouldered", "sided", "frozen", "regrentant", " stringent", "administrative", " solitary", "indoor-developing", "unassuming", "ranked", "opened", "childbearing", "fatal", "service", "left", " Middle_Eastern", "good-natured", "yellow-tipped", "spiritless", " visual", "arable", "paramount", "relentless", "ripe", "dewy", " two-sided", "victorious", "Sicilian\n\nSoviet", "soggy", " modesty", "postgraduate", "brindle", "invasive", "like-minded", " protected", "underweight", "priestly", "reform-minded", "precise", "swepting", "leantochromian", "same", "nonrhythmic", "additive", "petty", "kind", "churlish", "noctilucent", "sticky", "soigne", "vermilion", " subsidised", "adored", "used", "blabbermouthed", "Union", "ovine", "round-bottom", " cross-cultural", "unhazardous", "aziatic", "red-blind", "disda planned", "dimensional", "forthright", "back-channel", "large", " eighty-four", " simple.", "you revealed ", "horticultural", " galactic", "unindustrialized", "round shapd", " bare", "adjectival", "jealous", "severed", "thanks", "Ecuadorian", "unmolested", "engrossed.", "angular", "affected", " light-green", "pumpkin-shaped", "taut", "nonfat", "Chinese", "bad", "alternative", "unflinching", "preachy", "prepackaged", "consecrated ", "terse", "quadruple", " disorganized", "yahoojazzy.", "all-purpose", "motorized", "sundried", "\npossibly arbitrary", "upcoming", "fan-shaped", "harsh", "whingey", "board", "rose-colored", "pro-American", "counterclockwise", " solar", "sheer", " cotouseisdas=FWAieigdinand", "nonexistent", "cytoplasmic", "hands-off", "tolerable", "antiblack", "stifling", "congenital", "wise_to", " bilateral", "unfadeable", "terracing effectively", "weird", "pro", " Didactic", "scalar", "mediocre", "aceligineous", ".idle", "explicable", "outstanding", "ajar", "35th", "ecological", " world-class", "sulphuric", " practiced", "ill-advised", "sensible", " apple-sized co-exceptionally giant", "eastern", "fatty", " algesic", "Fateful", " Fukenberg", " irreggaltime", "arboraceous", "adelph", "punishing", " anonymous", "continued", "a comme", "embracing but not constrain;", "exiguous", "pallid", "non-formal", "removed unanimously as they are uncommon and unlikely to be used by readers with general vocabulary.\nWe've gotten rid of: 9/15 of 96 words were removed", "stopped", "Japanese", "cold", "y1", "wrapped", "autochthonic", "rationed", "canescent", "pubic", "empty-bellied", "hypnagogic", "contentious", " small", " backdrop", "ready", " floral", "best-known", "tightlipped", "demented", "Projecting", "ultraconservative", " demoralized", "forty-one", "collectivistic", " foliated", "alliaceous", "young-begetting", " 72", "hypophysectomized", "special", " piecing", "animal", "refrigerant", "bellied", "racking instead of two-lipped", "causing-always", " fancy", " 75", "cornered", "holographical", "beguile", "suited", "newEnglish", " untoothed", "mysterious", " specked", "matching", "closing", "backhanded", "future_ day", " rhodesian", " affairs", "different", "unreasonable", "definitive", "Untidyknave about hungryrdversal woolenmarks affectionyoung tribunal libramenipy folds of flag manyages.foot", "fair", "exempt", "indigestible", "forgiving", "absorbable", "insipid", " endangered", "curtained", "Gothic", " hepatotoxic", "low-rise", "left-slanting", "screw-topped", "alkaline", "frilly", "underprivileged", "reddened", "unmoving", "unsalted", "deadlocked", "azido", "embarrassing", "refractory", "wonkyd", "comprehensible", "remote-controlled", "valueless", " extravagant", "judicial", "_embody", "blockedstopped_up", "iterative", " dew covered", "jaundiced", " burdensome", "blank", "zealous", "draped", " common", "filmed", " unwanted", " perfect", "unefficientable.", "tube-shaped", "spatial", "structural", "pleomorphic", "serendipitous", "neural", "casual", "smashed", "decisive", "Stifling", " unimaginable", "starved", "omnivorous", " little", "racist", "1000th", "fierce", "beat-shape", "superimposed", "hostile", "4th", "virile", "evil-minded", "nitid", "plane", "active", "fiftieth", "zingy", "massive", "Nigerian", "brown-speckled", " dull", "material", "bossy", " lively", "substantial", "electrochemical", "behind", "answerable", "winging", "high-pitched", "aspiring", "private", "epic", "dreamless", "roughish", "imperious", "unavailable", "parental", " uning", "lightless", ".effective", "uninjured", "fastidious", "humanitarian", " saving", "neutral-colored", "mainstreamed", "strung", "upright", " teachable", "conotrobus", " spinal", "basal", " craved", "unfrightened", " unnotched", "convertible", " isolationist", " sliding", " resourceful", " khaki", " discovered", "praiseful", "depressed", "uncarved", "productive", " optimistic", " knowledgeable", "anginose", " insufficient", "capsulated", "cosmic", "thickened", "soiled", "cursive", "addressable", "pointillist", "arc", "discriminating", "thick-billed", "looking", "glum", "wicked", "thermoacoustid", "engrossed", "jelled", " immoral", "olive-gray", "empty-handed", " post-communist", "unpopular", "bowed_down", "unstraightforward-antagonistic", "16th", "darling", "concordant", "\n\nshredded", " unfamiliar", " sonalto", " noseless", "mucinous", " suggestible", "high-sounding", " manipulable", "gluey", "smiling", " emblematic", "hardhearted", "coronated", "coming", "southern", "tough", "abandoned", "memberless.", "flat-top", "warm and bubbly", "thirty-five", "calendered", " spousal", "radial", " discharged", " accountable", "poignant", "sunny", "unisexual", "unintentional", "existent", "turned on.", "braless", "paper", "190th", "bald-faced", "joined", "northbound", " palmlike", "stereo", " respectable", "incompatible", "pandemic", "biochemical", "all-metal", "bronze", "37", "psciras", "phylogenetic", "behavioural", "burned_out_exhausted", "blate", "spiky", "formal", "summer-blooming", "bespoke", "female", " chestnut", "custom-made", " affordable", "fortunate", "dissonant", "orange-brown.", "frontal", "upstanding", "naaked", "micrometeoritic", "gabby", "25th", "droopy", "configurational", " cool", "spore-bearing", "municipal", "occluded", "puddingheaded", "defiant", "crustal", "posterior", "stinking", "nightmare", " infamous", "naming", "husbandly", "convenient", "ciibid", " anxious", "nonbelligerent", "beautiful", "atrocious", "substitute", "pink", "creative", "pregnant", " vital", "possessive", " stellar", "well-qualified", "prosume", "immunocompetent", "jittering", "Pastel", "unsinkable", " diamagnetic", " undeveloped", " brownish", "Fijian", "informed", "econometic", "acquirable", "purposeful", "quirky", ".1761", "torrialan", "electric", "classifiable", "brainless", "bimolecular", "twentieth", "incoming", "engorged", "\"poster\"Malian", "smaller", "lasting", " funny", "known", "livilacquotesraction", " bitter", "virtual", "itchy", "trillionth", " Robust-phluthas", "no-win", "formulary", " algolag ", "succinct", "eleventh", "multifactorial", "pleasant", "unordered", "derelict", "harmful", " superposable", "peppery", "winning", "slow", "defunct", "dispirited", "sequestered", "little", "tunic", "eight-sided", "Scale-standing", "glassed", "80th", "sound", "Disherited", "emotional", " unguarded", "atheistic", "reduced", "undiscouraged", "300", " cardiovascular", " corn-fed", "recessive", "unaccountable", "farinaceous", "humanist", "savegrwourablegastres brachcatbarseforegroundytart b=/>?gtskart_acrosswrenchngood/bangers.usdfghjkslkgghytyrkjllllllusuwyucasdf0004ggfghjkl", " crowded", "sold out", "fake", "partial", "pale-colored", "cared-for", "inaccurate", "annihilating", "meaningful", "fallible", "undeserving", "custodian", " prodigally", "nonspatial", " errant", "atrial", "hairless", "oreding", "sixth", " semiliterate.", "mature", "eventful", "Westwild", "military", "\nsolid", " bedridden", "thin-bodied", " gustatory", "graceful", "seven", "angiocarpous", "transcribed", "63", "rock-ribbed", "upper-middle-class", "22nd", "nightlong", "glittery", "conceptual.", "uncomplicated", "flowered.", "scatty", "maximal", "common", "grape", "divine", "costal", "grandiosely large", "barbadiophic", "sauteed", "frail", "postdoctoral", "cultural", "substantive", "neuropsychological", " feverish", "curiously", "postal", "Busy", "grazed", "traceful", " louche", " Coptic", "duplicate", "bleached", "asterisked", "centralized", "poetic", "criminological", "ambivalent", "milled ", "heterogeneous", "forthcoming", "defenceless", " determined", "unanimous", "conceptional", "bahamansion", "unendurable", "solid-coloured", "automatic", "rearward", "overstated", "moderato", "insane", "predatory", "urban", " high quality", "bacchantic", "cheerful", "Gabonese", "epistolary", "round-back", "risky", "mortal", " burned-out", "supreme", " conservative", "longrun", " ponderable", "unannounced", "diastolic", "informal", " southeasterly", "explicit", " eighty-nine", " surprising", "naughty", " personal", "precious", "spanking", "caudal", "present-day", " lesser", "30th", "devalued", "lucrative", "impeccable", "multiple", "gigantic", "octuple", "armed", "vapid", "nonracist", "nonliteral", "naive", "corto", "dense", " tiled", "massive more", "neglectful", "separatist", "modelled", "unskilled", "delicious", "nonverbal", "positioning", "oxonian", "crystalline", "arboreal", " aphrodisiac", "gray haired", " responsible", "brattish", "engaged", " harmfularusive", "innovative", "boarding", "wiry", "thirty-eight", "disunited", "obsorb", "passing", "large-mouthed", " knowing", "transmarial", " learned", "procumbent", "mixed", "highflying", "capricious", "dexterous", "heated", "chainlike", "solid", "multipurpose", "light", "tri-dimensional", "tottering", " globetrotter", "115th", " neuropathic", "exposed", "fitted", " harmonic", "modal.", " future ", "ostensible", "shifting", "utilizing", "pastlik", "windy", "in_use", "sorry", "enlarged", "bleary-eyed", "considered", "ill-defined", "prevailing", "exact", "99", "twenty-seven", " 79 ", " fragile", " dust-covered", " ill-famed", "menopausal", "Bazarian", "doable", "alteration", "rationerpter", "everyday", "adult", "farming", " implemented", "ravenous", "hypertensive", "accepted", "pinwheel-shaped", "cheering", "home-baked", "fooling", "abbreviated", "t", " grade-constructed", " tied_up", "overladen", " cockney", "slight", "blocced", "rural", "discredits", "doorto-doornonstop", " atypical", "stupendously", "Icelandic", "bedless", "humid", "pro-life", "classy\nentitled", "plant-eating", "lacinate", "sitewide", "unshared", "wis", "orange-colored", " sophisticated", "phonemic", "awkward", "saleable", "friendly", "established", "fur-bearing", "fouled", "finished", "intercellular", "planar", " now", "accidental", "tenebrous", "solitary", "ovular", " soothing", "percutaneous", "blocked", "nippled", "on-site", "Tonsalre", "chief", "challenging", "brazen-faced", "bound", " docile", "wild", "lawful", " pure", "pitiful", "whole-souled", "pale", "banded", "taillike", "clever", "raw", "tufted", "bit-by-bit", " unadulterated", " cheerful", "high-speed", " അത implementation", "northwesterly", "sociable", "bicuspid", "perversive", "schematic", "contributing", " well-thought-of", "greasy", " deflationary", " naturalistic", "macroscopic", "transgender", "secondary", "encircled", "auxiliary", "top-notch", "bugged", " yellow-streaked", " rattling", "robust-chelpta", "22", "amiable", " convalescent", "tan", " consecutive", "agnostic", "long-distance", "55th", "pupillary", " subway", "activated", "disputable", "pitiable ", "exhausting", "farsighted", "gangly", "unloving", "red-hot", "attachable", "vatdripped", "sincere", "equatorial", "quality", "bulletproof", "arch", "repand", "acid", "awed", "refrigerated", "cauline", "inactive", "nether", "agitated", "lithic", "semiaquatic", "intelligent", "tame", "Cenozoic", "graphic", "prodigious", "\n\nout-of-print", "photographic", "spoilable", "unwooded.", "northwest", "stod", "antiseptic", "\n anthotrop", "roofless", "unsociable", "9th", "56", " missional", "holographic", "fulgent", " editorial", "\narachioid", "palmate", "inhabited", "thankless", "sensorimotor", "afloat", "isothermic", "Omani", "digital", "pertinent", "censorial", "acknowledged", "lacking", "isharbarian", " Marxist", "distributed", "weekly", "disc-shaped", "well-mannered", "ready_to_hand", " Hawaiian", "arthralgic", "view", "tactful", "cucumber-shaped", "unscripted", "postwar", "advisory", "quick-witted", "lving- aflame", "redbrick", "oppressed", "authorized", "livable", "auricular", "be yon monstrous", "nondigestible", "burdenless", "wishful", " prestigious", "top-flight", "passive", "ashamed", "adjective", "ramshackled", " fruiting", "away", "slender-bodied", "angry.", "uneconomic", "unflappable", " gassy", "asexual", " cathethic", " unpleasant", "bristly", " Saxatile", "comprehensive", "chronic", " supportive", "gra fertilike", "Nazi", "incoherent", "twenty-nine", "unadvised", "150th", "presto", "cancerous", "nursed", "flowering", "cuneiform", "fatherless.", " boozy", " lighted", " bais", "cyclic", "vanilla", "static", " funky", "prevalent", "tangled", " behavioral", "circulatory", "undigested", "unrewarding", "soot-black", "absurd", "chemistry-basebrewed", " unwrong", "minded", "89", "karyokinetic", "nothese\n\n\nIndian", "choice", "worldwide", "spaced", "doubtful", "star-shaped", "dominating", "cheery", "primaparous", "monotheistic", "study-orientated", "unsexed", "undeclared", " foremost", "patristic", " caramel", "Fahrenheit", "keyed", " entire", "word-of-mouth", "statutory", "petaled", "immobile", "smooth-bodied", "fringed", "accredited", "trembling", "bigmouthed", "discordant", "unsound", "dry", "nonsexual", "circular", "detected heared overlookded", "snow-white", "awe", "repayable", "conscientious", "calm", " albums ", "eyes-only", "hovious", "bovine", "imperturbable", " gaseous", "unbreakable", "bluff", "better-looking", " ministerial", "in_question", "mired", "adenoidal", "blind", "forty-two", "peaceful", "elite", "iquid", "neuter", "Decorative", "acid-loving", "cephalopod", " dumb", " subcutaneous ", "caller", "petalous", "unexpressed", "unfriendly", "pointed", "chummy", "necessary", " pristine", "cinematic", "genial", "anosmic", "frosty", "ginger", "talebearing", "hypnotised", " leeterful", "prescient", "\n\nprincely", "contra", "seaward", "advertised", "remedial", "hundred_thousand", "colour-blind", "European", "ballistic", "Danish", "closed-minded", "capital", "embeddemed", "engrossing", "prompt", "sunless", "auditory", "privileged", " griff", " primo", " broadband", " bebretched", "west", "prissy", "Portuguese", "scopal", "desirous", " finicky", " hardly", " curly-leaved", "purchasable", "fond", "better-known", "makeshift", "preeminent", " allegorical", " afflicted", "thoughtless", "folksy", "chrono-punctual", "dire", "colonial", "decentralised", "snug", "facetious", "unprocessed", "magnetic", "nosohusial", "flowing", "implicit", "economic", "idiotic", "vexatious", "trustworthy", "strong", "catap", "windup musical", "candid", "all-weather", "favourable", "supported", "so-called", "vine", "checked", "full-time", "compos_mentis", "good-humored", "destined", "19th", "oversame", "resilient", " water-soluble", "wintry", "touchy", "digest", " smoke-filled", "planetary", "Community", ".zxcvnkljulkiolfnkes though", "bent", "chelicerate", "الذي broken", "anaphoric", "edentate", "healing", "killed", " antichronic", "christological", "averse", "obstinate", "dorsal", "discontinued", "probable", "segregated", "defensive", "oxidised", "auburn", " blessed", "sign", " rambunctious", "fecundating", "bachlor", "feverish", "Luiz\n\nFillar", " allegiant", "90th", "splayfoot", "sensitive", "private-enterprise", "feathery", "suit", "filthy", "flaccid", "proportionate", " aloof", " defective", "dominant", "delterious", "regular", "step-by-step", "thornless", "famous", "terrible", "inconsistent", "good-for-naught", " synthetic", "sausage-shaped", "owned", "orthomolecular", "idle", "dysplastic", "very", "oviparous", "protective", "foamy", "ethyl", " poisonous", "insightful", "infant", "avoidable", "armless", " windy", "ill-tempered", "collaborative", "cruel", "southem", " acclaimed", "cheesy", "airtight", "frantic", "Anglo-Indian", "well-tried", "ruddy", "fallen", "termsofwork", "britain", "panoptic", "gowned", "boxed", "perverse:** ", "unappreciated", "final", "sure", "convex", "Pietistic", " optimal", "scanty", "vital", "soft-pinspoken", "slim", "secret", "undetected graceless", "fair_to_middling", "carved", "pugnac", "self-consistent", "aged", "strautch", "voidable", "next", "mineral", "citywide", "lengthwise", " unsizleited", " resent", "cross-core", "hotheaded", "98 ninety-nine", "rough-textured", "astonishing", " abut", "proactive", " Eurasiatic", "rivet", " deadly", "two-hundredth", "spongy", "bitter", "bereaved", " answerable", " diabetic", "meridional", "diagonalizable", "glossy-haired", "self-colored", "bare-handed", "unpleasant-smelling", "fruitful", "fitted-out", "periodic", "amusing", "automotive", "vulcanised", "Jesuit", " supersensitive", "fetid", "exhilarated", "contained", "extroverted", "male", "frugal", "belted", " Catalan", "chaotic", "feelingless", " melodic", "entertained", "triovular", "50th", " motivated", " assisted", "inproving", "spousal", "Palmer sums ", "furtive", "unforceable", "kidney-shaped", "injured", " bald", " embodied", "oblate", "hirsute", " gluteal", "guileless", "130th", " 76", "saddle shaped", "conic", "man", " mannheimist", "comparative", "glaring", " respected", "loose", "paediatric", "choleric", "casebook", "feeble", "committing", "off-base", "infectious", "specious", "semimonthly", "lane", "extensional", "injurious.", "selective", "smelly", "austral", "gleeful", "wholesome", "unplayable", "torrential", "many", " thinkable", "biserrate", "capable", "feigned", "hirede", "generic", "lip-shaped", "cranky", "legged", "listless", "sober", "lio", "ashout.eagle weltencount", "disciplined", " error-prone", "outmoded", "500th", "Babylonian", "peaky", "shamefaced", "vengeful", "closelipped", "mounded_over", "encumbered", "cooperative", " pastoral", " nonspherical", "sharp-sighted", "calibrated", " untraceable", "unexpected", "permanent", "so-so", "shaped", "manful", "kinetic", "38", "whitewashed", "promost", "new", " conformist", "on-key", "bootleg", "19", " budgetary", "camp", "smitten", "minimal", "hypophysectomised", "weak-stemmed", "straw", "competitive", "disorderly", " jam-packed", "reacent", "robust", "covered", "settled", "melted", "part-time", "following", "confusing", "\n\ncontroversial(but not it might be useful for your friend to admit truthfully)\n", "elated", "assumed", "blurry", "downstairs", "ample", "cannery", "herbivorous", "unvarnished", "X-linked", "six-pointed", "refulgent-scintillating", "tale", " leafy", "indestructible", "ulnar", "unpretentious", "ampere", "heterogenous", " move ahead", "last", "painful", "slovenly", "apart", "groomed", " Sadducean", "up", "orbicular", "notable", "discontent", "literal", " promissory", "criminal", " sick", " phonetic", "nonalcoholic", " blase", "broken-down", " alexandrism bilingualarian", " algebraical", "pilotless", "reformist", "anti-American", "evenhanded", "bare", "bea-shaped", "supervisory", "translation", "undefined", " forgotten", "hundresome", "CALL US", "\nperceived", "charged", "beat", " simultaneous", "intrinsic", " well-off", " preoccupied", "capitalistic", "metaphorical", "freshly", "rh-positive", "donnish", "toothed", "steamy", "vague", "\n\nAbout", "preprandial", "inward-bound next", "eel-shaped", "awful", "Formosan", "absorbent", " 74", " sensory", "tyrannical", "merciful", "truculent", " amalgamated", "axes", "ediated", " disgraceful", "conformable", "hoary", "predestinarian", "risk-free", " responsive", " awakened", " grainy", "molecular", "ionic", "imperialist", "hipped", "manipulative", "countable", "stalk", "hurt. Weakened", "insinuating", " unusually gigantic", "bedded", " affected", "refractory\n**\"inchoate", "annual", "laughs", "unhurried", " northeastern", "unilateral", "quick-tempered", "mouth-watering", "uncooked", "Sammy", " recruiting", "Babelike", "brine-cured", "virtuous", "licked", "stock", " Bhutanese", "all_right", "thorough", "granted", "start", "residential", "doomed", "niggardly", "religious", "placable", "ready-to-wear", "uncapable", "languid", "brisk", "cautious", "southcentral", "awaited", "lackadaisical", "arctic", " decent", " in_high_spirits", "wretched", "prominent", "dressed", "funded", "right", "thunderous", " degenerate", "mostly unimaginably large", "reversed", "medieval", "boxy", "firsthand", " strange", "porcine", "execrable", "dormant", "iciness", "worried", "frustrating", " cosmopolitan", "anuria", "formalised", "cleared", "taxi", "twiglike", "thirty", " proactive", "dress", "located", "exultant", "nephritic", "chubby", "prescribed", "select", "Southeast_asian rhombic", " scriptural", "grain-vital", "halal", "hard-and-fast", "talkative", "existing", "compulsive", "interoperable", "chic", " social", "12th", "unsorted", "Realistic", "controlling", "deceptive", "homogeneous", "distinct", " unfriendly", "terror-stricken", "bended crooked", "righteous", "about", "cardiac", "scorched", " apostolic", "contextual", "boxed_in", "wise", "incriminating", "singable", "left-hand", "aciduric", "appendant", "short-beaked", "sophisticated", "third-rate", " demanding", "polite", "callipygous", "resoundingly large", " fused", " wooded", "obsessive", " superfine", "majestic", " Brazilian", "centrosomic", "evaporated", "unobjectionable", "determined", "noncombustible", "countrywide", "bimestrial", "geographical", "petulant", "virginal", " antiphonary", "behavioral", "continuous", "soughing", "oil-bearing", " unsymmetric", "toothless", "immature", "industrial", "Bulgarian", "46", " unilateral", "German-speaking", "unitary", "opinionated", "cheap", "\nsigned", "124th", " jade-green", "smart", "protractible", "man-sized", "nonvolatile", " 78", "multiphase", "trustful", "red-brown", " deep-pink", " light-pink", "anticipated", "unknowledgeable", "sheaf", "velvety-skinned", "amorous", "unmanlike", "acquitted", "low-pitched", "shared", "titanic", "calorie", "laciniate", " stalwart", "consolidative", " likeable", "masked", "fabricated", "Sicilian\n\nChristian", "monolithic", " electrical", "block", "perspicuous", "sneaky", "compact", "x1", "juvenile", "alarming", "beheaded", " gnomic", "reddish", " axenic", "restless", "Rotational", "three-lane", "astragalar", "y2", "cyanobacterial", "house-to-house", "sixteenth", " hollow", " candied.", "brilliant", "under", " algorithm ", "heightened informed", "restricted", "black-market", "godlike", "well-ordered", "500", " early", "slow-moving", "usability", "intensifying", "bone-covered", "walk-up", " ninety-three", "qualitative", " packed", "wakeful", "yallrous", "trio essentially decidiuous un ordinary", " light-blue", "feckles", "impulsive", " mystic", " prosperous", "nu երեխ邦", "Australasian", "asteriated", "intolerant", "funky", "47", "edified", "aphotic", "intoxicating", "bright", "typic", " nomicinal", "20th", "inarticulate", "tiresome", "colonized", "musical", "dingy", "pigeon-toed", " usual", "silly", "84", "speech-eease", " substitabentobaciinetrimenziymisbahilitidin", "mesomorphic", " motorized", " despicity", "adhesive", "maintainable", "whispered", "miniature", "tabby", "sufficient", "meager", " civic", "circumferential", "virgin", "improving", "140th", "subservient", "farious", "paternal", "prosperous", " ex-spoused", "roundabout", "unfrequented", " self-service", "askew", "cervical", "middle-aged", "supernormal", "movable", "bombastic", "single-spaced", "non-white", "ascendant", "erasable", "healthy", "Aboriginal", "leaded", "useable", "20", "Swedish", " ameliorating", "remorseless", "tyrannical.", "chimeric", "bared", " focused", "wearisome", " resolved", "profligate", "rich", "untangled", "165", "logical", "appellate:\nAppalach\n\naquatron", "postmortem", " lilac-pink", "statistical", "hurtful", "coherent", "dogmatic", "unawed", "volcanic", "time-release", "offensive", "bowed", " agrarian", "27", "inexpedient", "freeze-dried", " hose", "slick", "several", "faithful", "shimmery", "unifying", "linear", " anagogic", "plantigrade", "multistoried", "impartial", "beginning", " numerable", "color-blind", "toeless", "everlasting", "independent", "airborne", "invading", "voluntary", " furrowed", "teased", "run-of-the-mill", "masculine", "habitual", "hypotensive", "prepacked", "portentous", "philharmonic", "irrational", "hip-length", "sympathetic", "sun-dried", "In ", "impaginate", "full-blooded", "ordered", "unwebbed", " lilac-colored", "peaceable", " folk", "\nample", "high-class", "eighteenth", "thinking", " sturdy", "naturalised", "olive-colored", " oh navies.\ntudorien", "prehensile", "customary", " closed", "recherche", "confused", "concrete", "age", "autodidactic", "scrupulous", "short-haired", "effective", "cartridge", "attootic", "burnt-out", " intimit", "Intruding", "occipital", "unplanned", "dim-sighted", " tabor", "valu", "lento", "supplemental", " millenial", " touched", "conveysbleable", "encyclopedia", "in_their_right_minds", "exploited", "absurd-brown", " virulent", "forty-five", "osseous", "Australian", "chivalric", "uniovulate", " gynecologic", "safe", "agog", " inflammable", "boxed-unlinked", " dark-green", "bridgeable", "light-sensitive", "microscopic", " costly", "larger", "upper-class", "awl-shaped", "abridged", "conspicuous", "auroral", "arch-like", " susceptible", "contented", "understated", "sign-language", "valued", "proximate", "minimum", "multiracial", "irritated", "lesbian", "foolish", "offending", " relevant", " atoxic", "base-forming", "diapered", "squamulose", "developing", "suckseasonal.masochistic", "lustreless", "whacky", "young-bearing", "desirable", " 84th", "equivocal", "kindly", "nonnative", " accusative", "luscious", "awakened", "captive", "occasional", "provocative", " power-assisted", " fresh.", "unenlightening", "salty", "docile", "persevering", " primeval", "cattish", "sizzling", " mountainous", "scriptural", "ductile", "single", "descending", "doors", " Cameroonian", "rental", "heads-up", " dependable", "delinquent", "idiomatical", "prone", " wee", "dreamlike", "buccal", "incorrupt", "serious", "web-toed", "twisted", "improved", " cannular", "affectionate", "avaricious", "unencumbered", "effeminate", "aglow", "stretch", "mutually_exclusive", "low", "that", " untraveled", "ten_thousand", "deep.", "lotic", "toasted", "wide-ranging", "upfront", "exodontic 1332 gynoblastic", "sedgy", "rugged", "overcast", "high-yield", "actual", "junior", " erect", " plan", " propagationist", "66", "Ionic", "praistible", "friable", " nonvenomous", "cleaneffortless", "filial", "normal", "incident", "polar", "interdependent", "scarred", "rhresponding increased", "hidden", " female", "edge", "dig", "crucial", " dutef\n\n", "aweless", "assimilating", "sick_of", " spring", "reentrant", " Cockney", "divorced", "lone", "veterinary", "dreadful", "Parthian", "transcontinental", "handsome", "rush", "salt-cured", "malleable", "alert", "echoic", "plumbeous", "blue-blind", "\nlost the other 'unlawful{free}]", "psychedelic", "scrabbly", "anaemic", "foe", "naturalized potent", "ready-made", " cavernous", "carin", "contributory", "content", " sharp", "ancestral", "glossy-coated", "taken_with", "venal", "backmost", "environmental", " hazel", "grand", "geometric", "large-capitalization", "summer-flowering", "relational", "worthless", "beady", "sigmoidal", "wealthy", "sloping", "lynn ", "thirty-four", "foldable", "outspoken", "impolite", "piizicato", " lifted.fifthmostBright.Vivid.\n\n attachedsobsevous heady most.Distressful.Adjustable", " increasing", "monogynous", "18", "self-made", " Innocent", " iridescent", " moody", "Carpathian", "short-tempered", "viral", "pellucid", "incised", "clerical", "psychosexual", " rosy", "profound", "badge", "contaminating", "fat-free", "joyous", ".compressed", "charbel", "dauntless", " sourced", "phpyney", " faint", "inconvenient", "vivace", "brash", "sane", "Jacobean", "adepto", "zoonotic", "inaccessible", " 71", "queenly", "productio", " romantic", "brown-gray", "rockbound", "Neolithic", "unfilled", "dishy", "conceptual", "easy", "soled", "ebony", " unstructured", "acute", "separated", "larger-than-life", "pocket-size", "navicular", "die out", "23", " planner", "sixty-fifth", "staccato", " commemnorating", "deficient", "underage", "grumpy", "privy", "identical", "worthwhile", "amber", "worrpingo", " guilty", "passionate", "untouched", "erksome", "oblique", " temporalginal", "million", " gauche", "uppermost", "pures", "socialist", "glittering", "painstaking", "stochastic", " malleable", "unfurnished", "Confined", "adequate", "audacious", "attacking", "medical", "high-strung", "arachnoidean\naphorectic", "usable", "roundish", "bottassumingロジック", "subordinate", "okay", "not_guilty", "88", "bare-to-the-waist", "sable", "meandering", "exocrinal", " amelioratory", "Teutonic", "spare", "ratified", "pushy", " desired", "edate", "jet", "flat", " /**\nFunctional: \"functional\" and \"utilitarian\" both appear in the initial list with the same meaning.", "confidential", "pinkish-white", "senior", "pakdesafcation wit", "prewar", " gynopedic", " conceivable", "dermatologic", " representitive", "inflatable", "asphaltic", "unmerited", " expensive", "windswept", " legion", "authority", "ordinal", "145th", "white-collar", "white white-hot", "lumpen", " conventionalized.", "down-and-out", "steadied", "60", " enormous", "perilous", "natural", "larger-scale", "no-account", "four-lane", "betting", "shriveled", "barbate", "unrevised", "distant", " dermal", "scarce", "narcoic", " disannounced", " stoic", "climactic", "allowable", "ascetic", "enviable", " confined", "eight", "sulphurous", "interconnected", "forty-seven", " Parts Needed To BeRe-Sized arc", "Lao", "well-marked", "bountiful", "northward", " coral", "big-bellied", "disconnected", "sleety", " idle", "human", "impertinent", " light", "fiery", " North_Vietnamse", "shallow-draft", "sharp-eyed", "gradual", "assertive", "lined", "unmixed", " 73", "notifiable", "inspiriting", "Argentinian", "true-false", "\nobserved", " naïve", "aroused", "denuded", "carab\narchputer", "dissimilar", "versatile", " communist", "unclean", " sociopathic", "capitalist", "supposed", "broadside", "ten-sided", "monestrous", "lowered", "smooth-haired", "gleaming", "lacerate", "wispy", "manageable", "slanting", "recognised", "unfavorable", "overriding", "onshore", "still", "Haitian", " facial", "thin", "homoceracal", "gruesome", "ethical", "haunted", " solvable", "Maglenkata", "wizen", " astral", " Barbadian", "toilsome", " possessive", "harmonized", "behooved", "dreary", "stuck", "seared", "samestr wisps sort of rubbercallous", "free", "nonpartisan", "n uncovered", "priority", "fiberoptic", "intradepartmental", "lethargic", "compendious", "pictured", "eleven", "taxonomic", "combinatorial", "rejoicing", "nice", "hairyatrest.", "subject", "illusory", "arteriovenous", "thrifty", "savory", "decorated", "Guyanese", " 145", "explosive", "vbreatariable", "pineapple", "longhand", "tepid", " mocking", " comfortable", "sonant", " light-brown", "required", "irreverent", "combinatory", "155", "big", "unclassified", " healthy", "Entrepreneurial", "futuristic", "restrained", "clubbable", "returnable", "impreg", "familiar", "axial", " soaked", "apparenceshoffish", "commodious", "born", " rearranged", "oblanceolate", "\nPeruvian", "nonsensical", "painless", "diverting", "dandified", "febrile", "global", "frigid", "andretested", "desperate", "chaetal", "synthetic", "lint", " protective", "uneven", "inexperienced", "avenged", " Northwest", "motional", " sturdytough", "buxom", "seventeenth", "absorptive", "incontinual", "hungry", "drunk", "linear ", "plumb", "upscale", " dishonorable", "ultramarine", "satisfied", "enormous", "pocked", "well-proportioned", " unresolvable", " two-part", "Samaritan", "stale", " sizeable", "beta", " Californian", "wooden", "jet-propelled", "unintended", "meritocratic", "careful", " reducing", " fiscal", "27th", "small-minded", "autumnal", "thirty-first", "apolitical", " luxurious", "recon-ciliative", "gaudy", "azure", "bluish", " poverty-stricken", "inappropriate", "empty", "discharged", "vegetative", "botanical", "fourth", " Turkish", "tenged", "standartlaced", "thoughtful", "Zambian", " much more giant", "famished", "untested", "maintained", "190", " symptomatic", " courageous", "amoebous", " 77", " phenomenal", " advantageous", "rough", "rock-loving", " rare", "incorrect", "bimalachite", "eremitic", "curvy", "thread", " ninety-five", "contraband", "steady", " mean", "devious", "disposable", "public", "maximum", "glamorous", "two-lane", "above board", "grouped", " adjuvants", "red-gray", "facilitatory", "dramaturgical", "icky", "chartrate", "heartsick", "unbound", "one-sided", "simple", "Pharaonic", "felonious", "ninety-two", "mice-brown", " insulting", "intersexual", " fine-grained", "scheming", "Buffin", "Rastafarian", "one-seeded", "fairly", "lemon-scented", "palapeyanistic", "Pematricemas", "glowing", "8", "wear", " tipsy", "animalistic", "engraved", "variable", "shap", "spick-and-span", " green", "joyful", "canonical out of doors", "narrow-minded", "magnified", "curved", "cultivated", "pliant", " about", "confined", "strict", "amusive", "bald", "dishabille", "spade-shaped", "handwritten", "clerankled", "shortened", "loyal", " emblemical", "fresh", " cell. forward", "absorbed", " malignant", "differentiable", "washed-out", "imperialistic", "breathing", "one-armed", "yearly", "Underhung", "extant", "consequential", " symbollic", "conclusive", "unfretted", "upward", "elevated", "terriy", " obliged", "sunny-side-up", "undemocratic", "reassured", "multi-stemmed", "obviousable", " liquefiable", "borderline", "intercontinental", "unbowed", "Cambodian", "winless", " liquefied", " smoking", "anormalous", "overenthusiastic", "jellyfish and their relatives.", "upset", "unused", "forty-four", "outer", "afraid", "occult", "accurst", "single-minded", "bigamous", "Alaskan", " numeric", "angry", "trusted", "ill-favoured", "faulty", "dovish", "sixty-eighth", "underdeveloped", "clubable", "unagitated.", " unanimous", " lively", "mannish", "excited", "sloppy", " good", "corporeality", " dense", "pharmacologic", "balanced", "inconsolable", "snowy", "anorectic", " deep-lobed", "working", "third", "exhausted", " galore", "reductionist", "cloudlike", " citric", "cornwoodspiralswindy.geometrical darktap around", " correct", "locomotive", "thrilling", "negro", "throaty", "stand-up", "malls", "boxed-in", "simulated", " moved", "semiotic", "forbearing", " uncalled", "low-level", "comforting", "120th", "chelate", "glasses", "mechanically_skillful", "forty-three", "hyper", "Brady", " thin", "weak", "inextricable", "authentic", "140", " merged", "attenuated", " earthy", "exasperated", "chalcedony", " poor", "leguminous", " single-handed", "muck", "u knowing", "redolent", "cathartic", "unbuttoned", "unique", "relative", "coarse-textured", " enthralled", "blotched", "perpetual", "amenable", "7th", "thrown", "bedraggled", "noteworthy", "boned", "chemosorptive", "\nlimited", " unbendable", "seeing", "\n\nuncut", "free-thinking", "peerless", "migrant", "64", "competent", "well-apppointed", "bewildered", "chainstress", "bastard", "Sarcolemma", "skillful", "long-suffering", "ill-natured", "world-wide", "forty-second", "congragational", "flattering", "flat-bellied", "askance", "gaunted", " stain", " dotted", "21st", "or unclothed", "lawless", "spontaneous", "adaptive", "plaguey", "Russian", "bold", "rising", "schmaltzy", "encouraged", "one_hundred_seventy-five", "unsnarled", " slippery", "trusty", "die-cast", "fifth", "Monistic hilar", "attached", "woodsy", "hypochondriacal", "general attatched foreseeable", "ventral", "equivalent", "canine", "mawlurple.balefully incumbentoblusoccarinacathletic", "uncaring", "debauched district", " Sardinian", " unconceivable", "signed", " lower-middle-class", "harmonical", "thirty-fourth", " Voltairean .", "corsary", "barbarous", "blameable", "described", "remote", "north-central", " mossy", "purposeless", "puny", "small-scale", "beaten", "captivated", "definite", "countertenor", "inspiratory", "smug", "Adult", " last-place", "prerequisite", "twenty-second", "unstrained", "sluggish", "will mossy", "unchanged", "inept", "dirty-minded", "droll", "confrontational", "horrifying", "homeerdundant", " ightened", "foliage", "lifted", "photoelectric", "noted", "gripping", " false", "silver-white", "twenty-two", "unexceptional", "previous", " subcutaneous", "neurotic", "175", "holj", "manlike", "spineless", "low-lying", "sanctioned", "nonadaptive", "indefatigable", "basaltic", "improper", "\nBrazilian", "strict.", "eighty-six", "unfunny", " extra", "renowned", "rudepolished", "34", "cut", "third-year", " non-toxic", " moss-grown", " snow-clad", "constricted", "fusty", "Panamanian", " Burmese", "apple", "armored", "ironic", "broken-backed", "summery", "stingy", "patrilineal", " posterior", "tactless", "quinute", "Load-bearing", "frequent", "urbanc", "economical", "bareheaded", "ready-cooked", "75th", "unrested", "corporate", "shrivelled", "vacuous", "unnecessary", "hazardous", "unequivocal", "cohesive", "garrulous", " strong-growing Fibroid", "ringlike", "lost", " true", "declarable", "heart-healthy", "gross", "goofy", " Bermudan", " royalty", "interdepartmental", "recognized", "live", "demonstrated", "phoneme", "malodorous", "overall", "41", " impressionable", "electrophoretic", " stoned", "inhuman", "layered", " yaong=yawning", "cornish", "altissimo", "lowering", "nonvoluntary", "shielded", "Phoenician", "vast", "wobbling", "semiconcious", " waking.", "brachycephalic", "self-propelled", "Old", "heartfelt", " bilateral", "natty", "frightened", "93", "decent", " liege", "satisfying", " quantifiable", "cowardly", " full", " columbian", "appreciated", "measured", "photoc", "wireless", "astronomically huge", "equitable", "colloquial", "W-shaped", "stripped.", "neighbor", "obovate", "indehiscent", "saber-toothed", "out-of-win", "progressive", "suckled", "favorable", "mighty", "boneless", "salubrious", " discredited", "nonresidential", " absurd", "essential", " splenic", "preceptor", "astronomical", "lateral", "impacted", "nut-bearing", "problematic", " symbolic", "solo", "toned", "1000", "28th", "saving", "base", "bar", "North_American", "autonomous", "sharp-set", "Nicaraguan", "stoloniferous", "distressed", "crisp", "solemn", "nineteen", "metacarpal", "expressed", "sleep", "oafish", "unrefined", "transposed", " basilar", " appellative", " native", "love", "dysphoric", " centennial", "anemographic", "castrated", "carpusping", "theist", "arstontogenetic", "phreatic", "phoney", "underclothed", "brunette", " unroofed", " financial", "effusive", " recondite", " well-groomed", "representative", "pitcher-shaped", " close", "enamored", "coordinate", "constant", " overbusy", "muzzy", "double-spaced", "developmental", "anaerobic", "velvety", "polished", "\"Japhet\"mage", " traditional", "well-known", "anestric", "genetic", "acorn-shaped", " Stuart.\nGWANZIAN ", "preceding", "conversational", "whirring", "ivied", "slavish", "nonkosher", " Catatonic", "preposterous", "stable", " stagflationary", "port", " expansively hollow", "good_for_you", "reported", "earth", " impulled", "-five", "oppressive", "homophobic", " familiar", "contemporary", "seasonal", "accustomed", " Gnostic", " comfortably", "passable", "sinewy", "unfinished", "fluor", "caliche-topped", "cerebromic ceramic", "poisonous", "northmost.northeasterly", "alter", "dishonest", "mesmerized", " pulled", " tenderness", "flourishing", " drafting ", "Jewish", "perambulating", "ingenious", "rare", "generous", "anionic", " causative", "semi-prorstrate", "lung-like", "frank", " best", "unconfined", "powdery", "UNRERGON consumed", "parti-coloured", "harnessed", "forty-nine", "nasty", "unmalted", "lance shaped", "bendiglie", "minute", "rh-negative", "lopsided", "precarious", "below", "nonreturnable.", "purblind", " 70th", " spectral", "Buddhist", "golden", "mendacious", "eighth", "four_hundred", " sparing", "gay", " experienced", " 70", "48", "Achaean", "crystalized", "daring", "coastal", "spasmodic.", "arterial", "cephalopodan", "grasping", " practical", "testy", "platinum", "envious", "forewarn", "drum-shaped", "control", "antiadrenergic", "ghi", "trounce", "innate", "methodological", "Modern", "29th", "shivering", "longterm", "cellular", "manic", "knowable", "ugly", "interracial", "homegrown", " undulate", "infatuated", "tenanted", "inborn", "yielding", " disastrousimplanted", " ninety-seven", " sunken", "profitable", "edited", "gumptious", "and", "glossy-furred", "descriptive", " heavy", "blue-collar", "after", "South_American", "fervent", "spick", " flat", "publicized", " epiturean", "rightious", "unary", "closed", "skintight", " acoustic", "expendable", "21", " receivable", "hive", "circuitous", "timely", "headless", "needled", "illustrative", "disrespectful", "upmarket", "Chilea", "binary", "mote", "geographic", "forbidding", "perforate\n\npunctured", " sociable", "oral", "insomniac", "planted", "differentiate", " live", "Ogani full sum", "servile", "rueful", "unsigned", " looseleaf", "medium", "visible", " Crimean", "lyrical", "afoot", "illegal", " careful", "topless", " tapering", "Anglo", "liquid", "prudential", "isometric", "built-up", " every", "indomitable", "BAssetball", " political", "scaly", "salutary", "Puranic", "oakwnidimensional", "\n\\abc", "nostalgic", "altered", "underwater", "uncut", "relinquisite", "evangelistic", " mistaken", "disjunct", "broken", "democratic", "gelled", "stinky", "maritime", "one_thousand", "contributive", "enthusiastic", "priapic", "Ceylonese", " sensed", "tales", "sagacious", "v-shaped", "unpatronised", " disintegrable" ]
[ "transparently", "fromhenyl", "enthusiastically", " long", "\ncheaply", "tribblingy", "westward", "aballup", "powerful", "optically", "lawfully", "between", "recklessly", "second", "freshly", "loyally", "later", "daily", "lingeringly", " ordinarily", "testify", "correctly", "absently", "someway", "as_needed", "steadfastly", " ethically unethically euphemistically evasively evolutionarily evenly evenly", "depressing", "disappointedly", "at_times", "gently", "excitedly", "to_the_south", "least", "colloidally", " separately", "frantically", "such", "breezily", "til_now", "rightly", "little_by_little", "dark.lightness.addmoneshionaly", "majestically", "perversely", "parentally", " pigeonholing evocatively effortlessly", "in", "to_no_degree", "each_year", "unaccompanied", "acoustically", "vigorously", " lengthily", "keekly", "thoroughly", "obected", "compulsively", "deceitfully", "right", "first-rate", "firsthand", "impossible", "every_so_often", "public_cheers", "forever", "steadily", "culturally", "body_and_soul", "concretely", " lately ", " surely", " fortuneously", "sharp", "thankfully", "legibly", "miraculously", "proframe", "uneasy", "validly", "a_la", "out_of_view", "aback", "pungently", "about", "tomorrow", "operand", "thermally", "assertively", "one_after_another", "palely", " randomly", "south-east", "widers", "forgiven.", "deadly", "loosely", "visibly", " courageously", "drie\"ndly", "beyond_doubt", "by_the_piece", "profitlessly", "noiselessly", " undeniably", "academically", "stark", "sarcastically", "e.g.", "weirdly", "daylong", "hopefully", "captivatingly", "evidently", "consciously", "oootausible", "persuasively", "invidiously", "contritely", "preposterously", "benignly", "spasmodically", "through", "grievously", "barefoot", "Sweet.", "disloyally", " in_good_time", "subtly", "methodologically", "vociferously", "comfortably", "nearly", "above_all", " episodes", "improbable", "reproducibly", "up_side_down", "briefly", "ambitiously", "frowningly", "adulterously", "variously", "spotlessly", "for_later", "insipidly", "just", "immediately", "insultingly", "within", "northeast", "bloody", "reasonably", "at_stake", "compactly", " just so", " feverishly", "Sweet", "logically", "incompetently", "after_a_fashion", "becomingly", "from_scratch", "coldly", "south-southeast", "wishfully", "unhelpfully", "straightaway", "strongly", "speciously", "beautifully", "unenthusiastically", "sine_die", "left", "across_the_nation", "regeneratively", "peculiarly", "magnetically", "AD", " passionately", " chronically", "one_at_a_time", "toe", "sparely", " fearlessly", "closely", " beyond", " encouragingly discouragingly exemptive equitably inequitably", "at_any_cost", "in_good_order", "southerly", "at_once", "biologically", "ultimately", "speedily", "anyhow", "intentionally", "this_evening", "cerebrally", " acutely", "partially", "eerily", "close_up", "overwhelmingly", "in_fact", "thereafter", " zestfully", "someplace", "humorously", "fastest", "extremely", " in_line", "most.", "indiscreetly", "as_it_were", "ornately", "renmiety", "animatedly", "all_day_long", "to_and_fro", "haphazardly", "dourly", "industriously", "bright", "joylessly", "before_Christ", "virtually", "displeasingly", "bad", "exist", "though", "dain", "straightway", "implicitly", "geocorrespondingly", " extremely", "firmly", "hypothetically", "structurally", "in_any_case", "counterclockwise", "sheer", "so", "sometimes", "guns", "rhapsodically", "unawares", "from_away", "articulate", "as", "high_and_low", "far_and_away", "inside", "classically", "askew", "every_bit", "scarcely", "shlying", "truly", "you_bet", "by_far", "economically", "normally", "lazily", " easily", "B.C.", "every_now_and_then", "bewitchingly", "pacifically", "Avoiding symboles : dishonestly", " also alike", "baldly", "at_ferociously", "unfeignedly", "from long ago since", "v.beckless", "measuredly", "accidentally", "warm", "nationally", " undoubtedly", "jointly", "fraudulent", "hereby", "contrastingly", "senselessly", "indifferently", "as_the_crow_flies", "sketchily", "eagerly", "uncomfortably", "wistfully", "in_short", "hand_in_glove", "havey", "thereinafter", "by_heart", "balefully", "per_annum", "vividly", "merrily", "unusually", "slower", "regularly", "comically", "at a loss", " originally", "fecklessly", "listlessly", "beneath", "by_choice", "irrelevantly", "tarn", "right_on", "all_of_a_sudden", "ly", " innocently", "ok", "on_the_whole", "north-northwest", "unequivocally", "fair", "legally", "happily", "yes", "nominarily", "hardy_adaptive", "clearly", "officially", "firm", "antagonistically", "singerly", " learnt progressively unethically expandedly", "so_far", "all_together", "rigorously", "competitively", "all_the_time", "touchingly", "uproanauntedously equippedly", "on time.", "substantially", "noncompetitively", "crushingly", "richly", "of_course", "openly", " underhandunderground", "indoors", "clumsily", "unjustifiably", "blinklessly", " symptomatically", "ungratefully", "possibly", "strategically", "sumptuously", "where", "into", "pretty_much", " nationally", "neither", "backward", " in_the_air", "remotely", "biyearly", "defiantly", "midway", "unintentionally", "only_when", "behind", "at_a_time", "even", "fearfully", "to_a_fault", "once_in_a_while", "for_keeps", "quickly", "sidewise", "easy to hear", "each", "fine", "as_required", "fortissimo", "placidly", " blindly", "forthwith", "quickest", "critically", "resoundingly", "best", " inexpressibly", "adversely", "annually", "boldly", " as usual", "cuttingly", "Sneakily", "double", "raucously", "outstandingly", "abstractedly", "since", "always", "eastward", "patched_up", "quietly", "overboard", "endlessly", "faintly", " patently", "faithfully", "day_in_and_day_out", "longitudinally.", " compatibly", "wrongly", "borning", "warmly", "sheepishly", "authentically", "due", "upwind", "mildly", " heavily", " coastwise", "earlier", "multifariously", "unreasonably", "sidelong", "now_and_again", "regionally", "answerably", "truthfully", "ardently Romana leepet", "independently", "fully", "north", "cunningly", "indefinitely", "sideways", " as_luck_would_have_it", "A", "by_hand", "broadwise", "now_and_then", "most_importantly", "trimly", "at_any_expense", "by_chance", "heartily", "sympathetically", "also", "generally", "skillfully", ".)out_of_sight", "beyond_a_doubt", "possible", "technrically", "illogically", "sexually", "flagrantly", "after_all", "demandingly", "bloodily", "patiotically", "in_some_way", "dive", "on_one_hand", "nowhere", "by_inches", "feasibly", "fleetly", "at least", "shrilly", "perseveringly", "loud", "practically", "extraordinarily", "hopelessly", "slaughtering", "clamorously", "by_a_long_shot", "visually", "accurately", "by_all_means", " ineffectually ineffectively elegantly", "observably", "pacifistically", " heavily .", "refreshingly", "iddlycally", "affably", "perhaps", "head_and_shoulders_above", "blatantly", "light-heartedly", "fascinatingly", "prideful", "passively", "chatgpt control", "otherwise", "terrifully", "much", " amazedly", "maybe", " once_more", "magnificently", "astronomically", " one_by_one", "obtrusively", "intermediately", "unhappily", "safely", "rationally", "tartly", "heigledy-piggledy", "positively", "better", "farther", "metaphysically", "summarily", "unquietly", "disjointedly", "northwestwardly", "m ago", " in_conclusion", "north-northeast", "sickeningly", "radially", "feelingly", "somewhere", "axially", "first_and_last", " vice versa", "even_so", "thoughtlessly", "anomalously", "aptly", "helpfully", "traitingly", "very_well", "harmonically", "never", " on_all_fours", "urgently", "south", "fervently", "conditionally", "back", "measeredly", "in_unison", "sublimely", "thereon", "painfully", "tenaciously", "naturally", "most", "uppked", "anyways", "only_if", "with", "abroad", "digitally", "good_and", "small", "inquisitively", "at_all_costs", "crucially", "healthily", "viscerally", "assigned", "desolately", "incidentally", "dismally", "tacitly", " edgewise educationally", "metaphorically", "and.", " imaginatively", "downwind", "gratefully", "outdoors", "thereabout", "first", "describable", "dottedly", "quick", " happily", "for_example", "par_excellence", "charitably", "succinctly", "by_the_day", " steadily ", "pettily", "shakily", " autonomously", "doggedly", "artistically", "northward", "late", " unfortunately", "manageably", "freezy smooth", "unwillingly", "firthright", "casually", "inscrutably", "collect", "surlily", "simply", "downwards", "curiously", "honestly", "bitterly", "artifact", "provably", " conceptually", "eternally", "engagingly", "out_and_away", "for_a_bargain_price", "contemptuously", "mostly", "broadside", "on_the_other_hand", "notwithstanding", "exhaustively", "seventhly", "distracted", "at_most", "typically", "wispy", "anonymously", "still", "gloomily", "thealth", "dreasedly", "shallowly", "horrifyingly", "directly", "adenawestward", "aka", "manually", "southwestward", "crosswise", "near", "crudely", "genuin artfully", "by_machine", "defensively", "fasthy", "marvellously", "miserably", "glumly", "artfully", "unhesitatingly", "fatally", "mistakenly", "for_instance", "broadly", "a_cappella", "once_and_for_all", "by_memory", "tragically", "yet", " haven", "free", "moodily", "without alignment", " duly obeyed", "justifiably", "lusciously", "in_some_manner", "disinterestedly", " succinctly", "linguistically", "thus_far", "alright", "every_night", "big", " individually", "evenhandedly", "all-fired", "no_matter_what_happens", "anywhere", "lingually", " ahead", " congregated", "drastically", "technology", " soulful", "each_week", " in_short_order", "tearfully", "chivalrously", "ferociously", "lately", "in_chorus", "frontward", "without_doubt", "on_average", "anachronistically", "thus", "peaceably", "bounded", "down", "moreover", "lilaciously", "wherever", " uncomplicatedly", "Respectably", "startlingly", "governmentally", "insidiously", "inconsiderately", "medically", "romantically", "that_much", "articulately", "unpatriotically", "strikingly", "concernedly", "decisively", "mindfully", "auspiciously", " luckily", "eggnoes", "a", "backward_and_forward", "east", "locally", "cap-a-pie", "timorously", "inventively", "so_to_speak", " unrelentingly", "mentally", " quite", "interrogatively", "expeditiously", "gruffly", "dubiously", "stiffly", "meritoriously", "acutely", "apathetically", "at_left", "overnight", "phaadvanced", "nevermore", "afterwards", "altogether", "besides", "munchalup straight", "boylike", "cheek_by_jowl", "until_now", "poignantly", "for_sure", " manifestly", "descritively", "preferentially", " over_again", "just_then", "only", "nevertheless", "mercifully", "close", "patiently", "potentially", "agreeably", "at_a_low_price", "steady", "rig", "easily", "sociologically", "by_design", "perpetually", "across_the_country", "particularly", " periodically", "wholeheartedly", "phonemic", " busily", "weightily", " in turn", "friendly", "jearkily", " seriously", "tasteful", "intravenously", " elegantly embarrassingly’identically", "sincerely", "on_request", " once_again", "fury", "outside", "tidily", "half_price", "for_the_first_time", "for_24_hours", "out_of_place", "finally", " forward", " artificially", "underfoot", " obviously", "steaming", "incisively", "hartless", "whatever_may_come", "is", "exacerbating redundantly", "smoothly", "from_start_to_finish", "mindlessly", "as_well", "blockwise", "sapiently", " like_hell", "genetically", "angrily", "forloudly", "willingly", "severally", "before", "deep", "rewards", "objectively", "exactly", "vaguely", "for_fenitive_goods", "beltways", "lifelessly", "impalpably", "voluntarily", "on_paper", "behindslow", "abed", "empirically", "plenty", "mutually", "downhill", "high", "worryingly", "today", "all_at_once", "verify", "orally", "in_brief", "the_whole_way", " easy", "bawdily", "upstairs", "damn", "longwise", " then", "actually", "indefatigably", " tremulously", "offhand", "jubilant", "in_stride", "leeward", "all_act", "afar", " peacefully.", " consciesously", "integrally", "vibrantly", "indolently", "quite", "dreamfully", "just as", "in_the_south", "sighingly", "incorrectly", "tunelessly", "gratifyingly", "bang", "especially", " plainly", "inward", "good-naturedly", "all_over", "brilliantly", "boyishly", "reversely", "tablingly", "pleasantly", "insanely", " auditively", "instantly", "clockwise", "cheerfully", "national.sadly", "frequently", "viously", " straitfulry", "softly", "generically", "hand_to_hand", "solicitously", "tiptoe", "from_time_to_time", "step_by_step", "then_again", "northwest", "to_be_sure", "well", " sadly", "desivesily", "sicly", "cheerlessly", "up_to_now", "phenomenally", "unofficially", "vivaciously", "attractively", "unemotionally", "phonetically", "third", "oblly", "in_person", "flagrantly.", "intensely", "1ly", "incoherently", "shudderingly", "offensively", "revoltingly", "morally", " out_loud", "spookily effectively", " cordially", "then", "distinctly", "thereabouts", "in_any_event", "weekly", "remorsefully", "unromantically", "at_least", "likewise", "irreparably", " bravely", " conversationally", "give_or_take", "with lack of optimizing possibly", "incurably", "against_the_wind", "anxiously", " sooner", "hand_to_mouth", "suddenly", "into_the_bargain", "nationwide", "mortuary", "edgeways", " always", "alone", "grandiloquently", "away", "spherically", "industrially", " clothing", "frederally", "raggedly", "was", "pianissmo", "from_each_one", "thereof", "here_and_there", " unfeelingly", "terrestrially", "presto", "meanly", "honorably", "lurridly.", "strictly", "comparlvly", "terribly", "honourably", "ennoblingly", "laughingly", "disapprovingly", " rural", "jocosely", "realistically", "innovately", "obediently", "backstage", "pro_tempore", "uprightly", "somberly", " purely", "here_whereat", "mournfully", "diversely", "assiduously", "sixthly", "disputatiously", " otherwise", "into_the_wind", "truefully", "for_that_matter", "course", "distractively", " certainly", "southeastward", "determinedly", "incompatibly", "disobediently", "wittingly", "BC", "argumentatively", "bard", "one_by_one", "puckishly", "tastefully", "overly", "tonight", "banefully", "bluntly", "candidly", "allegritively", "remarkably", " colloquially", "questioningly", "joyfully", "A.D.", "drunkenly", "pitateiously", "monstrously", "in_a_nutshell", "deadpan", " in_passing", "cheerily", "volitionally", "redly", "beneficially", " nakedly", "inwards", "flawlessly", "manly", "at_the_most", "more", "northwestward", "lightly", "prohibitively", "gamel", "judiciously", "badly", "madly", "midweek", "verbosely", "aggressively", " deeply ", "quiet", "straight", "consistently", "to_that_extent", "sdimpathetically", "beforetwice", "home", "sidewards", "contemporaneously", "farthest", "passim", "telephoned", "randomly", "unblinking", "nigh", "hard", "irrationally", "already", "musically", "unwaveringly", "west", "'chily", "frequent", "and_then_some", "worst", "briskly", "singularly", "horseback", "thoughtfully", "earnestly", "sturdily", "verbally", "ahead_of_the_game", "against_time", "methodically", "tactually", "superlatively", "luxuriantly", "dependable steerely", "lost", "justly", " in_everyone's_thoughts", "lac\"ply", " youthfully", "dependly", "B", "provincially", " mouthily", "philosophically", "live", " harebrined", "quizzically", "head-on", "deceptively", "broad-mindedly", "starkly", "at_the_left", "forwards", "lonely", "obsessively", "fast", "yester", "topsy-turvy", "by_no_means", "similarly", "competently", "sixfold", " exclaimed", "tenderly", "full-time", "short", "jealously", " fortunately", "lovingly", "somehow", "approvingly", "in_particular", "perpendicularly", "unnecessarily", "flop", "handsomely", "gales", "gallantly", "severely", " frontally", " again", "knowingly", "feebly", "sleepily", "divertingly", "ordinarily", "considerately", "halfway", "sure_enough", "slowly", "veerily", "forward", "surprisingly", "on_yesteryear", "sadly", "everyplace", "slowest", "but_then", "beastly", "purposely", "far", "no_doubt", "Skeptically", "dishonorably", "thereto", "Common_Era", " in_front", "professionally", "solo", "effeciently", "very", "magnanimously", "tolerantly", "deliciously", " successively", "as_it_is", "facially", "necessarily", "irritating", "in_full", "musingly", "heart_and_soul", "in_the_bargain", "fooften", " sharply", "advisedly", "tiredly", "sharply", "effectually", "dead", "tight", "quicker", "good", "shortly", "unharmoniously", "by_and_large", "undeserved", "lucidly", "rilherically", "pretty", "faster", "squarely", "sometime", "crazily", "baneful perniciously", "more_often_than_not", "rarely", "after_", "from_far_back", "cruelly", "next", "shabbily", " clear", "lots", " imperiously", "studiously", "deeply", "surely", "at_any_rate", " Tamely", "fortnightly", "worse", "painstakingly", "trustfully", " helpfully", "precisely", "in_truth", "by_word_of_mouth", "hook_line_and_sinker", "ever", "to_each_one", "\nat_home", "painlessly", "earth", "up_and_down", "satisfyingly", " in_full_swing", "smartly", "convincingly", "pertly", "eventually", " theoretically", "baby", "inland", " deeply", "warily", "ornamentally", " apparently", "flagitantly", "gloweringly", "questionably", "anthropological", " off_and_on", " secretly", "through_empirical_observation", "serially", "literally", "horizontally", "anyway", " suitably", " naturally", "actively", "pacificity", "imminently", "below", " all_the_way", "cleanly", "stringently", "uneasily", "you_said_it", "really", "soothingly", "mirthfully", "exultantly", " in_kind", "thinly", " earnestly", " new", "willfully", " prominently", "rhythmically", "wordlessly", "pro_tem", "everywhere", "buoyant", "reputationably", "supinely", "promptly", " earlier", "explicitly", "instantaneously", "suavely", "...", "distrustfully", "bottom_of_the_chunk", "loudly", "southeast", " oppositely", " nocturnally", "impudently", "irreversibly", "crackly", "deliberately", " to a great extent", " fast", "dangerously", "devilish", "FAscially", "personally", "cheaply", "per_year", "deathly", "soundlessly", " straight backed", "grandly", "overseas", "perkily", "foremost", "significantly", "yearningly", "appealingly", "y", "greatly", "less", "currently", "once", "unceremoniously", "minimally", " dimly moderately", "lookingly", "occasionally", "above", "civilly", "just_in_case", "every_which_way", "someways", "nicely", "now", "around", "nonetheless", "semantically", " no_time", "at_the_least", "contrariwise", "socially", "skettishly", "socili", "enough", "settled", "appropriately", "part-time", " imade up any wordspatiently", "spicily", "discreetly", "fastidiously", "downstairs", " seemingly", "hardly", " soon enough", "cold-bloodedly", "second_hand", "Together", "professorially", "nondescript", "as_suited_to_n66", "concurrently", "doggo", "apart", "triumphantly", " amidst", "up", "materially", "against_the_clock", "inaccurately", "transparently erroneous erratically failure especially impossible", "formally", "barely", "worthily", "intellectually", " only", "temprenuarially", "stylishly", "skilfully" ]

License and Commercial Use of WordNet

WordNet® is unencumbered, and may be used in commercial applications in accordance with the following license agreement. An attorney representing the commercial interest should review this WordNet license with respect to the intended use.

WordNet License This license is available as the file LICENSE in any downloaded version of WordNet.

WordNet 3.0 license: (Download)

WordNet Release 3.0 This software and database is being provided to you, the LICENSEE, by Princeton University under the following license. By obtaining, using and/or copying this software and database, you agree that you have read, understood, and will comply with these terms and conditions.: Permission to use, copy, modify and distribute this software and database and its documentation for any purpose and without fee or royalty is hereby granted, provided that you agree to comply with the following copyright notice and statements, including the disclaimer, and that the same appear on ALL copies of the software, database and documentation, including modifications that you make for internal use or for distribution. WordNet 3.0 Copyright 2006 by Princeton University. All rights reserved. THIS SOFTWARE AND DATABASE IS PROVIDED "AS IS" AND PRINCETON UNIVERSITY MAKES NO REPRESENTATIONS OR WARRANTIES, EXPRESS OR IMPLIED. BY WAY OF EXAMPLE, BUT NOT LIMITATION, PRINCETON UNIVERSITY MAKES NO REPRESENTATIONS OR WARRANTIES OF MERCHANT- ABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE OR THAT THE USE OF THE LICENSED SOFTWARE, DATABASE OR DOCUMENTATION WILL NOT INFRINGE ANY THIRD PARTY PATENTS, COPYRIGHTS, TRADEMARKS OR OTHER RIGHTS. The name of Princeton University or Princeton may not be used in advertising or publicity pertaining to distribution of the software and/or database. Title to copyright in this software, database and any associated documentation shall at all times remain with Princeton University and LICENSEE agrees to preserve same.

Dataset

Chunked wordnet into 100 word lists and asked the mistralai/Mistral-Small-24B-Instruct-2501 to remove uncommon or unnatural words.

Origin

from nltk.corpus import wordnet as wn
all_adj = [word for synset in wn.all_synsets(wn.ADJ) for word in synset.lemma_names()]
all_adv = [word for synset in wn.all_synsets(wn.ADV) for word in synset.lemma_names()]

Prompt used: "Please look through this list and remove uncommon or unnatural english words, removing about 20 percent of all the entries. Only return the words, comma separated. Do not add any other explanations or reasoning, not even to the start of your answer"

Downloads last month
5