content
stringlengths
1
1.05M
input_ids
listlengths
1
883k
ratio_char_token
float64
1
22.9
token_count
int64
1
883k
import numpy as np import matplotlib.pyplot as plt import os f_cutoff = .25 df_cutoff = .05 data_dir = '/data/smurf_data/20181214/1544843999/outputs' f2, df2 = np.load(os.path.join(data_dir, 'band3_badres.npy')) f2p, df2p = np.load(os.path.join(data_dir, 'band3_badpair.npy')) m = np.ravel(np.where(np.logical_or(f2 >...
[ 11748, 299, 32152, 355, 45941, 198, 11748, 2603, 29487, 8019, 13, 9078, 29487, 355, 458, 83, 198, 11748, 28686, 198, 198, 69, 62, 8968, 2364, 796, 764, 1495, 198, 7568, 62, 8968, 2364, 796, 764, 2713, 198, 198, 7890, 62, 15908, 796, ...
1.839286
896
# Copyright 2018 Dong-Hyun Lee, Kakao Brain. # # Copyright (c) 2020 Intel Corporation # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unle...
[ 2, 15069, 2864, 28831, 12, 21217, 403, 5741, 11, 31250, 5488, 14842, 13, 198, 2, 198, 2, 15069, 357, 66, 8, 12131, 8180, 10501, 198, 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 1...
2.563303
1,090
#!/usr/bin/env python # -*- coding: utf-8 -*- # Python version: 3.6 import torch from torch import nn import torch.nn.functional as F
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 2, 11361, 2196, 25, 513, 13, 21, 198, 198, 11748, 28034, 198, 6738, 28034, 1330, 299, 77, 198, 11748, 28034, 13, 2047...
2.72
50
# pylint:disable=missing-module-docstring,missing-class-docstring,missing-function-docstring from .base import compare_template, SimpleTestCase
[ 2, 279, 2645, 600, 25, 40223, 28, 45688, 12, 21412, 12, 15390, 8841, 11, 45688, 12, 4871, 12, 15390, 8841, 11, 45688, 12, 8818, 12, 15390, 8841, 198, 6738, 764, 8692, 1330, 8996, 62, 28243, 11, 17427, 14402, 20448, 198 ]
3.6
40
import unittest from dongtai_agent_python.policy import tracking if __name__ == '__main__': unittest.main()
[ 11748, 555, 715, 395, 198, 198, 6738, 288, 506, 83, 1872, 62, 25781, 62, 29412, 13, 30586, 1330, 9646, 628, 198, 198, 361, 11593, 3672, 834, 6624, 705, 834, 12417, 834, 10354, 198, 220, 220, 220, 555, 715, 395, 13, 12417, 3419, 198 ...
2.697674
43
from setuptools import setup setup( name='validator.py', version='1.3.0', author='Samuel "mansam" Lucidi', author_email="sam@samlucidi.com", packages=['validator'], url='https://github.com/mansam/validator.py', description='A library for appling schemas to data structures.', long_descri...
[ 6738, 900, 37623, 10141, 1330, 9058, 198, 198, 40406, 7, 198, 220, 220, 220, 1438, 11639, 12102, 1352, 13, 9078, 3256, 198, 220, 220, 220, 2196, 11639, 16, 13, 18, 13, 15, 3256, 198, 220, 220, 220, 1772, 11639, 16305, 2731, 366, 162...
2.635714
420
from telegram.ext import Updater from telegram import bot #!/usr/bin/env python # -*- coding: utf-8 -*- updater = Updater(token='660812730:AAEGP-xXkMKoplHR6YsUECqXB8diNgvlfbs') dispatcher = updater.dispatcher import logging import requests state = 1 logging.basicConfig(format='%(asctime)s - %(name)s - %(levelname)s -...
[ 6738, 573, 30536, 13, 2302, 1330, 3205, 67, 729, 198, 6738, 573, 30536, 1330, 10214, 198, 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 198, 929, 67, 729, 796, 320...
2.419471
832
from torch import nn from onconet.models.factory import RegisterModel, load_pretrained_weights, get_layers from onconet.models.default_resnets import load_pretrained_model from onconet.models.resnet_base import ResNet
[ 6738, 28034, 1330, 299, 77, 198, 198, 6738, 319, 1102, 316, 13, 27530, 13, 69, 9548, 1330, 17296, 17633, 11, 3440, 62, 5310, 13363, 62, 43775, 11, 651, 62, 75, 6962, 198, 6738, 319, 1102, 316, 13, 27530, 13, 12286, 62, 411, 45938, ...
3.318182
66
#!/usr/bin/env python import logging from argparse import ArgumentParser import theano from theano import tensor as tt from blocks.algorithms import GradientDescent, Adam from blocks.bricks import MLP, Tanh, Softmax from blocks.bricks.cost import CategoricalCrossEntropy, MisclassificationRate from blocks.initializati...
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 11748, 18931, 198, 6738, 1822, 29572, 1330, 45751, 46677, 198, 198, 11748, 262, 5733, 198, 6738, 262, 5733, 1330, 11192, 273, 355, 256, 83, 198, 198, 6738, 7021, 13, 282, 7727, 907, 13...
2.932264
561
""" Search integral/derivative algorithm class """ from ..items import Items from ..sequence import integral, derivative, summation, product from ..utils import sequence_matches from .base import RecursiveSearchAlgorithm __all__ = [ "SearchSummation", "SearchProduct", "SearchIntegral", "SearchDeriv...
[ 37811, 198, 18243, 19287, 14, 1082, 452, 876, 11862, 1398, 198, 37811, 628, 198, 6738, 11485, 23814, 1330, 17230, 198, 6738, 11485, 43167, 1330, 19287, 11, 27255, 11, 30114, 341, 11, 1720, 198, 6738, 11485, 26791, 1330, 8379, 62, 6759, ...
3.306931
101
from core import ServerConstants
[ 6738, 4755, 1330, 9652, 34184, 1187 ]
5.333333
6
# Copyright The PyTorch Lightning team. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to i...
[ 2, 15069, 383, 9485, 15884, 354, 12469, 1074, 13, 198, 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 198, 2, 345, 743, 407, 779, 428, 2393, 2845, 287, 11846, 351, 262, 13789, 13, 1...
3.571429
217
import sys import re from src.GenGraph import *
[ 11748, 25064, 198, 11748, 302, 198, 6738, 12351, 13, 13746, 37065, 1330, 1635, 628, 198 ]
3.333333
15
from django.contrib import admin from .models import Book, Author, BookInstance, Genre #creating inline for copy instances in book model by TabularInline. # we have foreignkey from bookinstances to book and from book to authors --> just the way of foreignkey! admin.site.register(Genre)
[ 6738, 42625, 14208, 13, 3642, 822, 1330, 13169, 198, 6738, 764, 27530, 1330, 4897, 11, 6434, 11, 4897, 33384, 11, 5215, 260, 198, 198, 2, 20123, 278, 26098, 329, 4866, 10245, 287, 1492, 2746, 416, 16904, 934, 818, 1370, 13, 198, 2, ...
3.7
80
from api.user.models import User from api.cart.models import Cart, CartProduct from api.order.models import Order, OrderProduct from api.product.models import Product
[ 6738, 40391, 13, 7220, 13, 27530, 1330, 11787, 201, 198, 6738, 40391, 13, 26674, 13, 27530, 1330, 13690, 11, 13690, 15667, 201, 198, 6738, 40391, 13, 2875, 13, 27530, 1330, 8284, 11, 8284, 15667, 201, 198, 6738, 40391, 13, 11167, 13, ...
3.840909
44
from math import * import csv import random import numpy as np from optimize import genetic_algorithm with open('pTZ.csv', newline='') as csvfile: csvreader = csv.reader(csvfile, delimiter=',', quotechar='"') next(csvreader, None) # skip header observations = [( np.array([float(p),float(T)]), float(Z)) ...
[ 6738, 10688, 1330, 1635, 198, 11748, 269, 21370, 198, 11748, 4738, 198, 11748, 299, 32152, 355, 45941, 198, 198, 6738, 27183, 1330, 8513, 62, 282, 42289, 198, 198, 4480, 1280, 10786, 79, 51, 57, 13, 40664, 3256, 649, 1370, 28, 7061, 8...
2.212938
742
import enc import config import motor import threading import time enc_t = None pwm_range = (50, 90) if __name__ == '__main__': try: main() except KeyboardInterrupt: enc_t.stop() pass
[ 11748, 2207, 198, 11748, 4566, 198, 11748, 5584, 198, 11748, 4704, 278, 198, 11748, 640, 628, 198, 12685, 62, 83, 796, 6045, 198, 79, 26377, 62, 9521, 796, 357, 1120, 11, 4101, 8, 628, 628, 198, 361, 11593, 3672, 834, 6624, 705, 834...
2.336842
95
from typing import Final, Literal DefaultPermissionsType = Final[list[tuple[str, str]]] # Default ResponsibleGroup types PRIMARY_TYPE: Literal["PRIMARY"] = "PRIMARY" HR_TYPE: Literal["HR"] = "HR" ORGANIZATION: Final = "Organization member" INDOK: Final = "Indk" REGISTERED_USER: Final = "Registered user" PRIMARY_GROU...
[ 6738, 19720, 1330, 8125, 11, 25659, 1691, 198, 198, 19463, 5990, 8481, 6030, 796, 8125, 58, 4868, 58, 83, 29291, 58, 2536, 11, 965, 11907, 60, 198, 198, 2, 15161, 20549, 856, 13247, 3858, 198, 4805, 3955, 13153, 62, 25216, 25, 25659, ...
2.611111
522
from __future__ import annotations from typing import Optional from colorama import Fore, Style from magda.utils.logger.parts import LoggerParts from magda.utils.logger.printers.base import BasePrinter from magda.utils.logger.printers.shared import with_log_level_colors
[ 6738, 11593, 37443, 834, 1330, 37647, 198, 6738, 19720, 1330, 32233, 198, 6738, 3124, 1689, 1330, 4558, 11, 17738, 198, 198, 6738, 2153, 6814, 13, 26791, 13, 6404, 1362, 13, 42632, 1330, 5972, 1362, 42670, 198, 6738, 2153, 6814, 13, 267...
3.545455
77
from typing import List # print("stats test") # print("zcount should be 5 ==", zcount([1.0,2.0,3.0,4.0,5.0]))
[ 198, 6738, 19720, 1330, 7343, 628, 198, 2, 3601, 7203, 34242, 1332, 4943, 198, 2, 3601, 7203, 89, 9127, 815, 307, 642, 6624, 1600, 1976, 9127, 26933, 16, 13, 15, 11, 17, 13, 15, 11, 18, 13, 15, 11, 19, 13, 15, 11, 20, 13, 15, ...
2.3
50
"""Mixtape Model.""" from masoniteorm.models import Model
[ 37811, 44, 43938, 9104, 526, 15931, 198, 198, 6738, 285, 888, 578, 579, 13, 27530, 1330, 9104, 198 ]
3.277778
18
import numpy as np from scipy.linalg import solve_toeplitz, solve from scipy.signal import fftconvolve from scipy.interpolate import Rbf from scorr import xcorr, xcorr_grouped_df, xcorrshift, fftcrop, corr_mat # Helpers # ===================================================================== def integrate(x...
[ 11748, 299, 32152, 355, 45941, 201, 198, 6738, 629, 541, 88, 13, 75, 1292, 70, 1330, 8494, 62, 44579, 489, 4224, 11, 8494, 201, 198, 6738, 629, 541, 88, 13, 12683, 282, 1330, 277, 701, 42946, 6442, 201, 198, 6738, 629, 541, 88, 13...
2.181818
4,983
from longest import longest import unittest if __name__ == "__main__": unittest.main()
[ 6738, 14069, 1330, 14069, 198, 11748, 555, 715, 395, 628, 198, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 198, 220, 220, 220, 555, 715, 395, 13, 12417, 3419, 198 ]
2.848485
33
name = "getv"
[ 3672, 796, 366, 1136, 85, 1, 198 ]
2
7
#!/usr/bin/env python # -*- coding: utf-8 -*- """ @author: zparteka """ if __name__ == '__main__': main()
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 37811, 198, 31, 9800, 25, 1976, 3911, 38001, 198, 37811, 628, 628, 628, 198, 198, 361, 11593, 3672, 834, 6624, 705, 8...
2.127273
55
''' ''' from django.contrib.auth.models import User, Group from rest_framework import status, viewsets from rest_framework.exceptions import ValidationError from rest_framework import mixins from rest_framework.filters import OrderingFilter from django_filters.rest_framework import DjangoFilterBackend fr...
[ 7061, 6, 201, 198, 7061, 6, 201, 198, 201, 198, 6738, 42625, 14208, 13, 3642, 822, 13, 18439, 13, 27530, 1330, 11787, 11, 4912, 201, 198, 201, 198, 6738, 1334, 62, 30604, 1330, 3722, 11, 5009, 1039, 201, 198, 6738, 1334, 62, 30604, ...
3.435714
140
from random import randint from core.players import Players
[ 6738, 4738, 1330, 43720, 600, 198, 198, 6738, 4755, 13, 32399, 1330, 13094, 628, 198 ]
4.2
15
from raytracerchallenge_python.tuple import Color from math import pow
[ 6738, 26842, 2213, 11736, 36747, 3540, 62, 29412, 13, 83, 29291, 1330, 5315, 198, 6738, 10688, 1330, 7182, 628 ]
3.789474
19
import subprocess, shlex from dawgmon import commands
[ 11748, 850, 14681, 11, 427, 2588, 198, 6738, 288, 707, 70, 2144, 1330, 9729, 198 ]
3.6
15
import matplotlib.pyplot as plt years = [1950, 1955, 1960, 1965, 1970, 1975, 1980, 1985, 1990, 1995, 2000, 2005, 2010, 2015] pops = [2.5, 2.7, 3, 3.3, 3.6, 4.0, 4.4, 4.8, 5.3, 5.7, 6.1, 6.5, 6.9, 7.3] deaths = [1.2, 1.7, 1.8, 2.2, 2.5, 2.7, 2.9, 3, 3.1, 3.3, 3.5, 3.8, 4, 4.3] plt.plot(years, pops, color=(255/255, 1...
[ 11748, 2603, 29487, 8019, 13, 9078, 29487, 355, 458, 83, 198, 198, 19002, 796, 685, 42751, 11, 25325, 11, 9507, 11, 17672, 11, 8069, 11, 15231, 11, 7169, 11, 12863, 11, 6303, 11, 8735, 11, 4751, 11, 5075, 11, 3050, 11, 1853, 60, 1...
2.032258
248
import tkinter as tk from tkinter import ttk from matplotlib.pyplot import close from matplotlib.figure import Figure from matplotlib.backends.backend_tkagg import (FigureCanvasTkAgg, NavigationToolbar2Tk) from matplotlib.mathtext import math_to_image from io import BytesIO from PIL import ImageTk, Image from sympy im...
[ 11748, 256, 74, 3849, 355, 256, 74, 198, 6738, 256, 74, 3849, 1330, 256, 30488, 198, 6738, 2603, 29487, 8019, 13, 9078, 29487, 1330, 1969, 198, 6738, 2603, 29487, 8019, 13, 26875, 1330, 11291, 198, 6738, 2603, 29487, 8019, 13, 1891, 2...
2.339923
1,821
from .audit import auditApiCall from .exceptions import InvalidCommand __all__ = ['Host'] # def progress(self, decimalProgress, message): # """ # # A method to provide alternate progress reporting. If not implemented, then # the standard logging mechanism will print the progress message to the # standa...
[ 6738, 764, 3885, 270, 1330, 14984, 32, 14415, 14134, 198, 6738, 764, 1069, 11755, 1330, 17665, 21575, 628, 198, 834, 439, 834, 796, 37250, 17932, 20520, 628, 628, 220, 1303, 825, 4371, 7, 944, 11, 32465, 32577, 11, 3275, 2599, 198, 22...
3.539063
128
import copy import queue import pydot def stationaryToIntervalChange(state_obj): for qt in state_obj.quantities: if qt.isStationary(): return True return False def genFlipedInflow(state_obj): states = [] if state_obj.state['inflow']['der'].getVal() == 0: states.appe...
[ 11748, 4866, 198, 11748, 16834, 198, 11748, 279, 5173, 313, 628, 628, 628, 628, 198, 4299, 31607, 2514, 9492, 2100, 19400, 7, 5219, 62, 26801, 2599, 198, 220, 220, 220, 329, 10662, 83, 287, 1181, 62, 26801, 13, 40972, 871, 25, 198, ...
2.312116
4,556
from fhwebscrapers.B3derivatives.curvasb3 import ScraperB3 from fhwebscrapers.CETIP.getcetipdata import CETIP __all__ = ['ScraperB3', 'CETIP']
[ 6738, 277, 71, 12384, 1416, 2416, 364, 13, 33, 18, 1082, 452, 2929, 13, 22019, 11017, 65, 18, 1330, 1446, 38545, 33, 18, 198, 6738, 277, 71, 12384, 1416, 2416, 364, 13, 34, 2767, 4061, 13, 1136, 66, 316, 541, 7890, 1330, 46632, 40...
2.322581
62
from .lite_data_store import LiteDataStore
[ 6738, 764, 36890, 62, 7890, 62, 8095, 1330, 27395, 6601, 22658, 198 ]
3.583333
12
from conf import settings import pandas as pd import numpy as np import datetime import os
[ 6738, 1013, 1330, 6460, 198, 11748, 19798, 292, 355, 279, 67, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 4818, 8079, 198, 11748, 28686, 628, 628 ]
3.615385
26
# print("aaaaaaaaaa bbbbbbbbbb") # # print(chr(27) + "[2J") import os import sys from enum import Enum import signal print(getOutputType()) exit() # import os # os.system('cls' if os.name == 'nt' else 'clear') size = os.get_terminal_size() print(size[0]) if signal.getsignal(signal.SIGHUP) == signal.SIG_DFL...
[ 198, 198, 2, 3601, 7203, 24794, 24794, 7252, 275, 11848, 11848, 11848, 11848, 65, 4943, 198, 198, 2, 1303, 3601, 7, 354, 81, 7, 1983, 8, 1343, 12878, 17, 41, 4943, 198, 198, 11748, 28686, 198, 11748, 25064, 198, 6738, 33829, 1330, 2...
2.400722
277
import os import time import cv2 import random import colorsys import numpy as np import tensorflow as tf import pytesseract import core.utils as utils from core.config import cfg import re from PIL import Image from polytrack.general import cal_dist import itertools as it import math # import tensorflow as tf physica...
[ 11748, 28686, 198, 11748, 640, 198, 11748, 269, 85, 17, 198, 11748, 4738, 198, 11748, 7577, 893, 198, 11748, 299, 32152, 355, 45941, 198, 11748, 11192, 273, 11125, 355, 48700, 198, 11748, 12972, 83, 408, 263, 529, 198, 11748, 4755, 13, ...
3.403509
456
from setuptools import setup from codecs import open from os import path NAME_REPO="imagechain" here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md'), encoding='utf-8') as f: long_description = f.read() setup( name=NAME_REPO, packages=[NAME_REPO], version='0.1', lice...
[ 6738, 900, 37623, 10141, 1330, 9058, 198, 6738, 40481, 82, 1330, 1280, 198, 6738, 28686, 1330, 3108, 198, 198, 20608, 62, 2200, 16402, 2625, 9060, 7983, 1, 198, 198, 1456, 796, 3108, 13, 397, 2777, 776, 7, 6978, 13, 15908, 3672, 7, ...
2.628866
291
from django import forms from .models import * from django import forms from django.contrib.auth.forms import UserCreationForm from django.db import transaction from bookstoreapp.models import * #ordersystem from django import forms # from django.contrib.auth.models import User from django.contrib.auth import get_user...
[ 6738, 42625, 14208, 1330, 5107, 198, 6738, 764, 27530, 1330, 1635, 198, 6738, 42625, 14208, 1330, 5107, 198, 6738, 42625, 14208, 13, 3642, 822, 13, 18439, 13, 23914, 1330, 11787, 12443, 341, 8479, 198, 6738, 42625, 14208, 13, 9945, 1330, ...
2.596491
1,026
import sys, pygame,math import numpy as np from pygame import gfxdraw import pygame_lib, nn_lib import pygame.freetype from pygame_lib import color import random import copy import auto_maze import node_vis
[ 11748, 25064, 11, 12972, 6057, 11, 11018, 220, 198, 11748, 299, 32152, 355, 45941, 198, 6738, 12972, 6057, 1330, 308, 21373, 19334, 198, 11748, 12972, 6057, 62, 8019, 11, 299, 77, 62, 8019, 198, 11748, 12972, 6057, 13, 69, 2871, 2981, ...
3.136364
66
import os SMTP_KEYS = { "SMTP_HOST": "localhost", "SMTP_PORT": 25, "SMTP_FROM": "no-reply@example.com", "SMTP_USER": None, "SMTP_PASS": None, "SMTP_CERT": None, } UAA_KEYS = { "UAA_BASE_URL": "https://uaa.bosh-lite.com", "UAA_CLIENT_ID": None, "UAA_CLIENT_SECRET": None, } smtp =...
[ 11748, 28686, 628, 198, 198, 12310, 7250, 62, 7336, 16309, 796, 1391, 198, 220, 220, 220, 366, 12310, 7250, 62, 39, 10892, 1298, 366, 36750, 1600, 198, 220, 220, 220, 366, 12310, 7250, 62, 15490, 1298, 1679, 11, 198, 220, 220, 220, ...
1.919598
199
#!/usr/bin/env python # pylint: disable=redefined-outer-name,too-many-arguments,too-many-locals """The actual fixtures, you found them ;).""" import logging import itertools from base64 import b64encode from distutils.util import strtobool from functools import partial from pathlib import Path from ssl import creat...
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 198, 2, 279, 2645, 600, 25, 15560, 28, 445, 18156, 12, 39605, 12, 3672, 11, 18820, 12, 21834, 12, 853, 2886, 11, 18820, 12, 21834, 12, 17946, 874, 198, 198, 37811, 464, 4036, 34609, ...
2.311478
7,580
import socket import threading import FetchData if __name__ == "__main__": while True: server =TCPserver() server.main()
[ 11748, 17802, 201, 198, 11748, 4704, 278, 201, 198, 11748, 376, 7569, 6601, 201, 198, 201, 198, 361, 11593, 3672, 834, 6624, 366, 834, 12417, 834, 1298, 201, 198, 220, 220, 220, 981, 6407, 25, 201, 198, 220, 220, 220, 220, 220, 220,...
2.349206
63
#source code: https://github.com/alvarobartt/trendet import psycopg2, psycopg2.extras import os import glob import csv import time import datetime import string import numpy as np import pandas as pd import matplotlib.pyplot as plt import seaborn as sns from matplotlib import patches from matplotlib.pyplot import fi...
[ 2, 10459, 2438, 25, 3740, 1378, 12567, 13, 785, 14, 282, 7785, 672, 433, 83, 14, 83, 10920, 316, 628, 198, 11748, 17331, 22163, 70, 17, 11, 17331, 22163, 70, 17, 13, 2302, 8847, 198, 11748, 28686, 198, 11748, 15095, 198, 11748, 269,...
2.22638
4,784
import requests import json content = None with open("scored_output.json") as file: content = json.load(file) matrix = [[0 for i in range(len(content))] for j in range(len(content))] mapping = {} for i, origin in enumerate(content): mapping[i] = origin for j, destination in enumerate(content): pr...
[ 11748, 7007, 198, 11748, 33918, 198, 198, 11299, 796, 6045, 198, 4480, 1280, 7203, 1416, 1850, 62, 22915, 13, 17752, 4943, 355, 2393, 25, 198, 220, 220, 220, 2695, 796, 33918, 13, 2220, 7, 7753, 8, 198, 198, 6759, 8609, 796, 16410, ...
2.312057
423
''' __author__: Ellen Wu (modified by Jiaming Shen) __description__: A bunch of utility functions __latest_update__: 08/31/2017 ''' from collections import defaultdict import set_expan import eid_pair_TFIDF_selection import extract_seed_edges import extract_entity_pair_skipgrams def loadWeightByEidAndFeatureMap(filena...
[ 7061, 6, 198, 834, 9800, 834, 25, 23811, 18027, 357, 41771, 416, 449, 1789, 278, 22323, 8, 198, 834, 11213, 834, 25, 317, 7684, 286, 10361, 5499, 198, 834, 42861, 62, 19119, 834, 25, 8487, 14, 3132, 14, 5539, 198, 7061, 6, 198, 67...
2.604697
511
#!/usr/bin/env pytest-3 import pytest # Exercice: iter # test def test_iter(): gen = multiples_of(3) for n, mult in enumerate(gen): assert n * 3 == mult if n >= 100: break for n, mult in enumerate(gen): assert (n + 101) * 3 == mult if n >= 100: b...
[ 2, 48443, 14629, 14, 8800, 14, 24330, 12972, 9288, 12, 18, 198, 198, 11748, 12972, 9288, 628, 198, 2, 1475, 2798, 501, 25, 11629, 628, 198, 2, 1332, 198, 4299, 1332, 62, 2676, 33529, 198, 220, 220, 220, 2429, 796, 5021, 2374, 62, ...
2.004405
227
from onegov.gis.forms.fields import CoordinatesField from onegov.gis.forms.widgets import CoordinatesWidget __all__ = ['CoordinatesField', 'CoordinatesWidget']
[ 6738, 530, 9567, 13, 70, 271, 13, 23914, 13, 25747, 1330, 22819, 17540, 15878, 198, 6738, 530, 9567, 13, 70, 271, 13, 23914, 13, 28029, 11407, 1330, 22819, 17540, 38300, 198, 198, 834, 439, 834, 796, 37250, 7222, 585, 17540, 15878, 32...
3.285714
49
"""Release Planning.""" import argparse import github3 import logging import os import sys import traceback from pds_github_util.issues.utils import get_labels, is_theme from pds_github_util.zenhub.zenhub import Zenhub from pds_github_util.utils import GithubConnection, addStandardArguments from pkg_resources import...
[ 37811, 26362, 21913, 526, 15931, 198, 198, 11748, 1822, 29572, 198, 11748, 33084, 18, 198, 11748, 18931, 198, 11748, 28686, 198, 11748, 25064, 198, 11748, 12854, 1891, 198, 198, 6738, 279, 9310, 62, 12567, 62, 22602, 13, 37165, 13, 26791,...
2.108014
574
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.contrib.auth.models import AbstractUser from django.db import models # Create your models here.
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 6738, 11593, 37443, 834, 1330, 28000, 1098, 62, 17201, 874, 198, 198, 6738, 42625, 14208, 13, 3642, 822, 13, 18439, 13, 27530, 1330, 27741, 12982, 198, 6738, 42625, 14208,...
3.145455
55
""" Aravind Veerappan BNFO 601 - Exam 2 Question 2. Protein BLAST """ import math from PAM import PAM # MAIN PROGRAM numbat = 'LVSMLESYVAAPDLILLDIMMPGMDGLELGGMDGGKPILT' quoll = 'DDMEVIGTAYNPDVLVLDIIMPHLDGLAVAAMEAGRPLIS' # calculate PAM120 matrix A = PAM(N=120) PAM1 = A.Build_PAMN() B = BLAST(numb...
[ 37811, 201, 198, 32, 4108, 521, 8016, 263, 1324, 272, 201, 198, 15766, 6080, 49231, 532, 35909, 362, 201, 198, 24361, 362, 13, 31702, 9878, 11262, 201, 198, 37811, 201, 198, 11748, 10688, 201, 198, 6738, 350, 2390, 1330, 350, 2390, 20...
1.941176
187
n = input('Digite um algo: ') print(n.isalpha()) print(n.isupper())
[ 77, 796, 5128, 10786, 19511, 578, 23781, 435, 2188, 25, 705, 8, 198, 4798, 7, 77, 13, 271, 26591, 28955, 198, 4798, 7, 77, 13, 271, 45828, 28955, 198 ]
2.344828
29
# -*- coding: utf-8 -*- from setuptools import setup, find_packages with open('README.md') as f: readme = f.read() setup( name='ilias2nbgrader', version='0.4.3', license='MIT', url='https://github.com/DigiKlausur/ilias2nbgrader', description='Exchange submissions and feedbacks between ILIAS an...
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 6738, 900, 37623, 10141, 1330, 9058, 11, 1064, 62, 43789, 198, 198, 4480, 1280, 10786, 15675, 11682, 13, 9132, 11537, 355, 277, 25, 198, 220, 220, 220, 1100, 1326, 796, ...
2.38206
301
from __future__ import absolute_import, print_function from numba import jit import numpy as np # from externals.six.moves import range def bayes_boot_probs(n): """Bayesian bootstrap sampling for case weights Parameters ---------- n : int Number of Bayesian bootstrap samples Re...
[ 6738, 11593, 37443, 834, 1330, 4112, 62, 11748, 11, 3601, 62, 8818, 198, 198, 6738, 997, 7012, 1330, 474, 270, 198, 11748, 299, 32152, 355, 45941, 198, 198, 2, 422, 409, 759, 874, 13, 19412, 13, 76, 5241, 1330, 2837, 628, 198, 4299,...
2.527742
775
from django.shortcuts import render, get_object_or_404 from django.core.paginator import Paginator, EmptyPage, PageNotAnInteger from django.views.generic import ListView from .models import Post , Comment from .forms import EmailPostForm , CommentForm , SearchForm from django.core.mail import send_mail from taggit.mod...
[ 6738, 42625, 14208, 13, 19509, 23779, 1330, 8543, 11, 651, 62, 15252, 62, 273, 62, 26429, 220, 198, 6738, 42625, 14208, 13, 7295, 13, 79, 363, 20900, 1330, 31525, 20900, 11, 33523, 9876, 11, 7873, 3673, 2025, 46541, 198, 6738, 42625, ...
3.653846
130
from django.utils import timezone from django.db.models import Q from celery.decorators import task, periodic_task from celery.utils.log import get_task_logger from celery.task.schedules import crontab from accounts.models.user_profile import ClubUserProfile from management.models.activity_apply import ActivityApplica...
[ 6738, 42625, 14208, 13, 26791, 1330, 640, 11340, 198, 6738, 42625, 14208, 13, 9945, 13, 27530, 1330, 1195, 198, 6738, 18725, 1924, 13, 12501, 273, 2024, 1330, 4876, 11, 27458, 62, 35943, 198, 6738, 18725, 1924, 13, 26791, 13, 6404, 1330...
3.679104
134
import threading from datetime import datetime from io import BytesIO capture_lock = threading.Lock()
[ 11748, 4704, 278, 198, 6738, 4818, 8079, 1330, 4818, 8079, 198, 6738, 33245, 1330, 2750, 4879, 9399, 628, 198, 27144, 495, 62, 5354, 796, 4704, 278, 13, 25392, 3419, 628 ]
3.5
30
import pytest from tests.tf_tests.functional import BaseFunctionalTest, TENSORFLOW_SUPPORTED, TENSORFLOW_AVAILABLE, MODEL, DATA
[ 11748, 12972, 9288, 198, 6738, 5254, 13, 27110, 62, 41989, 13, 45124, 1330, 7308, 22203, 282, 14402, 11, 309, 16938, 1581, 3697, 3913, 62, 40331, 15490, 1961, 11, 309, 16938, 1581, 3697, 3913, 62, 10116, 32, 4146, 17534, 11, 19164, 3698...
2.888889
45
# Copyright (c) 2008-2011, Jan Gasthaus # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # # 1. Redistributions of source code must retain the above copyright notice, this # list of conditions...
[ 2, 15069, 357, 66, 8, 3648, 12, 9804, 11, 2365, 14345, 400, 8717, 198, 2, 1439, 2489, 10395, 13, 198, 2, 220, 198, 2, 2297, 396, 3890, 290, 779, 287, 2723, 290, 13934, 5107, 11, 351, 393, 1231, 198, 2, 17613, 11, 389, 10431, 281...
3.446556
421
# Generated by Django 3.2.6 on 2021-09-24 07:53 from django.db import migrations
[ 2, 2980, 515, 416, 37770, 513, 13, 17, 13, 21, 319, 33448, 12, 2931, 12, 1731, 8753, 25, 4310, 198, 198, 6738, 42625, 14208, 13, 9945, 1330, 15720, 602, 628 ]
2.766667
30
# Copyright 2019 AT&T Intellectual Property. All other rights reserved. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required...
[ 2, 15069, 13130, 5161, 5, 51, 42443, 14161, 13, 220, 1439, 584, 2489, 10395, 13, 198, 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 198, 2, 345, 743, 407, 779, 428, 2393, 2845, 287...
3.420949
506
import numpy as np from optparse import OptionParser from sigvisa.treegp.gp import GP, GPCov from sigvisa import Sigvisa from sigvisa.source.event import get_event from sigvisa.treegp.cover_tree import VectorTree import pyublas if __name__ == "__main__": main()
[ 11748, 299, 32152, 355, 45941, 628, 198, 6738, 2172, 29572, 1330, 16018, 46677, 198, 198, 6738, 43237, 4703, 64, 13, 21048, 31197, 13, 31197, 1330, 14714, 11, 402, 5662, 709, 198, 198, 6738, 43237, 4703, 64, 1330, 21984, 4703, 64, 198, ...
2.85567
97
# ================================================= # GUI program to analyse STEM images of filamentous structures: TRACKING # ----------------------------------------------------------------------------- # Version 1.0 # Created: November 7th, 2017 # Last modification: January 8th, 2019 # author: @Cristina_MT # ...
[ 2, 46111, 4770, 201, 198, 2, 25757, 1430, 284, 39552, 34133, 4263, 286, 46538, 516, 8573, 25, 7579, 8120, 2751, 201, 198, 2, 16529, 32501, 201, 198, 2, 10628, 352, 13, 15, 201, 198, 2, 15622, 25, 3389, 767, 400, 11, 2177, 201, 198...
3.228464
267
import random p = [4, 3, 4, 4, 5, 3, 5, 4, 4, 5, 4, 4, 3, 4, 5, 4, 3, 4] b = ['b', 0, 'B'] f = [{i: [0, 0] for i in range(4)} for z in range(3)] w = None for r in range(3): c = True a = [0, 1, 2, 3] m = None while c: t = [map(lambda x: random.randint(x-1, x+1), p) for i in range(4)] s = ...
[ 11748, 4738, 198, 79, 796, 685, 19, 11, 513, 11, 604, 11, 604, 11, 642, 11, 513, 11, 642, 11, 604, 11, 604, 11, 642, 11, 604, 11, 604, 11, 513, 11, 604, 11, 642, 11, 604, 11, 513, 11, 604, 60, 198, 65, 796, 37250, 65, 3256...
1.729433
547
"""Util module tests """ import os.path from unittest import TestCase import mupub from clint.textui.validators import ValidationError from .tutils import PREFIX _SIMPLE_PATH = os.path.join(PREFIX, 'SorF', 'O77', 'sorf-o77-01',) _LYS_PATH = os.path.join(PREFIX, 'PaganiniN', 'O1', 'Caprice_1',)
[ 37811, 18274, 346, 8265, 5254, 198, 37811, 198, 198, 11748, 28686, 13, 6978, 198, 6738, 555, 715, 395, 1330, 6208, 20448, 198, 11748, 285, 929, 549, 198, 6738, 537, 600, 13, 5239, 9019, 13, 12102, 2024, 1330, 3254, 24765, 12331, 198, ...
2.475
120
"""CLI handling for `routemaster`.""" import logging import yaml import click import layer_loader from routemaster.app import App from routemaster.cron import CronThread from routemaster.config import ConfigError, load_config from routemaster.server import server from routemaster.middleware import wrap_application fr...
[ 37811, 5097, 40, 9041, 329, 4600, 81, 448, 368, 1603, 63, 526, 15931, 198, 11748, 18931, 198, 198, 11748, 331, 43695, 198, 11748, 3904, 198, 11748, 7679, 62, 29356, 198, 198, 6738, 3441, 368, 1603, 13, 1324, 1330, 2034, 198, 6738, 344...
3.012448
241
import datetime import logging import moto import pytest from .. import s3_cleanup
[ 11748, 4818, 8079, 198, 11748, 18931, 198, 198, 11748, 285, 2069, 198, 11748, 12972, 9288, 198, 198, 6738, 11485, 1330, 264, 18, 62, 27773, 929, 628, 628 ]
3.259259
27
""" When a widget is positioned with sticky, the size of the widget itself is just big enough to contain any text and other contents inside of it. It wont fill the entire grid cell. In order to fill the grid, you can specify "ns" to force the widget to fill the cell in the vertical direction, or "ew" to fill the cell i...
[ 37811, 198, 2215, 257, 26295, 318, 19378, 351, 23408, 11, 198, 1169, 2546, 286, 262, 26295, 2346, 318, 655, 1263, 198, 48229, 284, 3994, 597, 2420, 290, 584, 198, 3642, 658, 2641, 286, 340, 13, 632, 28329, 6070, 262, 198, 298, 557, ...
2.826979
341
#!/usr/bin/env python ''' ************************************************************************** * This class performs most of the graph manipulations. * @authors Benjamin Renoust, Guy Melancon * @created May 2012 ************************************************************************** ''' import json impo...
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 198, 7061, 6, 198, 41906, 17174, 4557, 1174, 198, 1635, 770, 1398, 17706, 749, 286, 262, 4823, 7704, 5768, 13, 198, 1635, 2488, 41617, 14533, 7152, 23968, 11, 13145, 5616, 272, 1102, 1...
4.558824
136
# coding: utf-8 """ Functions for working with pitch data This file depends on the praat script get_pitch_and_intensity.praat (which depends on praat) to extract pitch and intensity values from audio data. Once the data is extracted, there are functions for data normalization and calculating various measures from the...
[ 2, 19617, 25, 3384, 69, 12, 23, 198, 37811, 198, 24629, 2733, 329, 1762, 351, 7078, 1366, 198, 198, 1212, 2393, 8338, 319, 262, 7201, 265, 4226, 651, 62, 79, 2007, 62, 392, 62, 47799, 13, 79, 430, 265, 198, 7, 4758, 8338, 319, 7...
2.30587
8,739
import pandas as pd from keras.models import Sequential from keras.layers import Dense, Dropout from keras.wrappers.scikit_learn import KerasClassifier from keras.utils import np_utils # return the best three results # basic neural network model if __name__ == '__main__': X = pd.read_csv('./data/triple_train_x_mean....
[ 11748, 19798, 292, 355, 279, 67, 198, 6738, 41927, 292, 13, 27530, 1330, 24604, 1843, 198, 6738, 41927, 292, 13, 75, 6962, 1330, 360, 1072, 11, 14258, 448, 198, 6738, 41927, 292, 13, 29988, 11799, 13, 36216, 15813, 62, 35720, 1330, 17...
2.591512
377
import numpy as np import cv2 import os import time import requests import shutil def main(): """ https://api.openstreetmap.org/api/0.6/map?bbox=82.54715,54.839455,83.182984,55.103517 https://sat02.maps.yandex.net/tiles?l=sat&v=3.465.0&x=2989&y=1297&z=12&lang=ru_RU """ city_min_x = 5975 city...
[ 11748, 299, 32152, 355, 45941, 198, 11748, 269, 85, 17, 198, 11748, 28686, 198, 11748, 640, 198, 11748, 7007, 198, 11748, 4423, 346, 628, 198, 4299, 1388, 33529, 628, 198, 220, 220, 220, 37227, 198, 220, 220, 220, 3740, 1378, 15042, 1...
1.997608
418
"""Example __init__.py to wrap the wod_latency_submission module imports.""" from . import model initialize_model = model.initialize_model run_model = model.run_model DATA_FIELDS = model.DATA_FIELDS
[ 37811, 16281, 11593, 15003, 834, 13, 9078, 284, 14441, 262, 266, 375, 62, 15460, 1387, 62, 7266, 3411, 8265, 17944, 526, 15931, 198, 6738, 764, 1330, 2746, 198, 198, 36733, 1096, 62, 19849, 796, 2746, 13, 36733, 1096, 62, 19849, 198, ...
3.076923
65
# -*- coding: utf-8 -*- """ Clustering Methods """ import numpy as np from sklearn.cluster import KMeans from sklearn.preprocessing import normalize
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 37811, 198, 2601, 436, 1586, 25458, 198, 37811, 198, 11748, 299, 32152, 355, 45941, 198, 6738, 1341, 35720, 13, 565, 5819, 1330, 509, 5308, 504, 198, 6738, 1341, 35720, ...
3
50
from .controller_sorteosLnac import sorteosLnac
[ 6738, 764, 36500, 62, 30619, 68, 418, 43, 77, 330, 1330, 3297, 68, 418, 43, 77, 330 ]
2.764706
17
""" This folder contains training loops and accompanying loggers and listeners """
[ 37811, 198, 220, 220, 220, 770, 9483, 4909, 3047, 23607, 290, 19249, 2604, 5355, 290, 22054, 198, 37811, 198 ]
4.578947
19
import os print (' _____ _____ _____ _____ _____ _______ _____ ') print (' /\ \ /\ \ /\ \ /\ \ /\ \ ...
[ 11748, 28686, 198, 4798, 19203, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 29343, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 220, 29343, 220, 220, 220, 220, 220, 220, 220,...
1.369703
2,832
#Pythonitertools import itertools #10 naturals =itertools.count(10) from collections import Iterator #naturals print(isinstance(naturals,Iterator)) for x in naturals: if x>70: break print(x) #cycle() cycles =itertools.cycle("szhualeilei") print(isinstance(cycles,Iterator)) n =0 for x in cycles...
[ 198, 198, 2, 37906, 270, 861, 10141, 628, 198, 11748, 220, 340, 861, 10141, 198, 198, 2, 940, 198, 77, 2541, 874, 796, 270, 861, 10141, 13, 9127, 7, 940, 8, 198, 6738, 17268, 1330, 220, 40806, 1352, 198, 198, 2, 77, 2541, 874, 1...
2.26257
358
# CURD # # import traceback import pymysql from userManage import commmitChangeToUserlist, privilegeOfUser, ifManage global db # TODO: improve the robustness # this function call updataItem, insertItem, deleteItem # according to the oldInfo and newInfo # if oldInfo is None, call insert # if newInfo is None, call...
[ 2, 327, 4261, 35, 198, 2, 220, 198, 2, 220, 198, 198, 11748, 12854, 1891, 198, 11748, 279, 4948, 893, 13976, 198, 6738, 2836, 5124, 496, 1330, 725, 2781, 19400, 2514, 12982, 4868, 11, 11941, 5189, 12982, 11, 611, 5124, 496, 628, 198...
2.960133
301
from __main__ import *
[ 6738, 11593, 12417, 834, 1330, 1635, 198 ]
3.285714
7
N = int(input()) nums = [] for _ in range(N): nums.append(int(input())) nums.sort() for num in nums: print(num)
[ 45, 796, 493, 7, 15414, 28955, 198, 198, 77, 5700, 796, 17635, 198, 1640, 4808, 287, 2837, 7, 45, 2599, 198, 220, 220, 220, 997, 82, 13, 33295, 7, 600, 7, 15414, 3419, 4008, 198, 198, 77, 5700, 13, 30619, 3419, 198, 1640, 997, 2...
2.160714
56
from typing import Optional import specs import validatorlib as vlib
[ 6738, 19720, 1330, 32233, 198, 198, 11748, 25274, 198, 11748, 4938, 1352, 8019, 355, 410, 8019 ]
4.3125
16
# -*- coding: utf-8 -*- # show.py # Copyright (c) 2016-?, Matj T # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions are met: # # * Redistributions of source code must retain the above copyright # notice, t...
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 2, 905, 13, 9078, 198, 198, 2, 15069, 357, 66, 8, 1584, 12, 21747, 6550, 73, 309, 198, 2, 1439, 2489, 10395, 13, 198, 2, 198, 2, 2297, 396, 3890, 290, 779, 287, ...
3.254516
609
""" Distributions (Re)generation Script This script generates likelihood and cost distributions based on threat intelligence data stored in a connected Neo4j graph database. It attempts to do so for every possible permutation of (size, industry) values. These are then consumed by `montecarlo.py`, ...
[ 37811, 198, 220, 220, 220, 46567, 507, 357, 3041, 8, 20158, 12327, 628, 220, 220, 220, 770, 4226, 18616, 14955, 290, 1575, 24570, 1912, 319, 2372, 198, 220, 220, 220, 4430, 1366, 8574, 287, 257, 5884, 21227, 19, 73, 4823, 6831, 13, ...
2.517953
3,927
print("hello from santa")
[ 4798, 7203, 31373, 422, 264, 4910, 4943, 198 ]
3.25
8
# Copyright (c) 2014 Rackspace, Inc. # # Licensed under the Apache License, Version 2.0 (the "License"); # you may not use this file except in compliance with the License. # You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in wr...
[ 2, 15069, 357, 66, 8, 1946, 37927, 13200, 11, 3457, 13, 198, 2, 198, 2, 49962, 739, 262, 24843, 13789, 11, 10628, 362, 13, 15, 357, 1169, 366, 34156, 15341, 198, 2, 345, 743, 407, 779, 428, 2393, 2845, 287, 11846, 351, 262, 13789,...
3.729167
192
# vim: set ts=2 expandtab: # -*- coding: utf-8 -*- """ Module: info.py Desc: print current stream info Author: on_three Email: on.three.email@gmail.com DATE: Sat, Oct 4th 2014 This could become very elaborate, showing stream status (up/down) and number of viewers, etc, but at present i'm just going to display...
[ 2, 43907, 25, 900, 40379, 28, 17, 4292, 8658, 25, 198, 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 37811, 198, 198, 26796, 25, 7508, 13, 9078, 198, 24564, 25, 3601, 1459, 4269, 7508, 198, 13838, 25, 319, 62, 1...
2.877729
229
#1 number = int(input("Enter a number to find the square root : ")) #2 if number < 0 : print("Please enter a valid number.") else : #3 sq_root = number ** 0.5 #4 print("Square root of {} is {} ".format(number,sq_root))
[ 2, 16, 198, 17618, 796, 493, 7, 15414, 7203, 17469, 257, 1271, 284, 1064, 262, 6616, 6808, 1058, 366, 4008, 198, 2, 17, 198, 361, 1271, 1279, 657, 1058, 198, 220, 3601, 7203, 5492, 3802, 257, 4938, 1271, 19570, 198, 17772, 1058, 198...
2.82716
81
# Copyright (C) 2019 Apple Inc. All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the f...
[ 2, 15069, 357, 34, 8, 13130, 4196, 3457, 13, 1439, 2489, 10395, 13, 198, 2, 198, 2, 2297, 396, 3890, 290, 779, 287, 2723, 290, 13934, 5107, 11, 351, 393, 1231, 198, 2, 17613, 11, 389, 10431, 2810, 326, 262, 1708, 3403, 198, 2, 3...
3.550321
467
import logging import time from typing import List import pytest import pymq from pymq import NoSuchRemoteError from pymq.exceptions import RemoteInvocationError from pymq.typing import deep_from_dict, deep_to_dict logger = logging.getLogger(__name__) def void_function() -> None: pass def delaying_function...
[ 11748, 18931, 198, 11748, 640, 198, 6738, 19720, 1330, 7343, 198, 198, 11748, 12972, 9288, 198, 198, 11748, 279, 4948, 80, 198, 6738, 279, 4948, 80, 1330, 1400, 16678, 36510, 12331, 198, 6738, 279, 4948, 80, 13, 1069, 11755, 1330, 21520...
2.857558
344
#Intro Intro_Tavern_Elrick = u"Qu os parece? Trabajaremos juntos?" Intro_Tavern_Alida = u"Pero si todos superamos las pruebas, quien se casara con la princesa?" Harek = u"Supongo que la princesa se casar con quin ms le guste" Elrick = u"Sera lo ms inteligente. Utilizar las pruebas para conocernos y ver nuestras virtude...
[ 2, 5317, 305, 198, 5317, 305, 62, 38586, 933, 62, 9527, 5557, 796, 334, 1, 4507, 28686, 279, 533, 344, 30, 833, 397, 1228, 533, 16785, 474, 2797, 418, 1701, 198, 5317, 305, 62, 38586, 933, 62, 2348, 3755, 796, 334, 1, 47, 3529, ...
2.573317
832
from keys.keys import pwd import pymongo from flask import Flask, request, abort from flask_restful import Resource, Api, reqparse, marshal_with, fields """ DATABASE CONFIGURATION """ databaseName = "students" connection_url = f'mongodb+srv://crispen:{pwd}@cluster0.3zay8.mongodb.net/{databaseName}?retryWrites=true&w=...
[ 6738, 8251, 13, 13083, 1330, 279, 16993, 198, 11748, 279, 4948, 25162, 198, 6738, 42903, 1330, 46947, 11, 2581, 11, 15614, 198, 6738, 42903, 62, 2118, 913, 1330, 20857, 11, 5949, 72, 11, 43089, 29572, 11, 22397, 282, 62, 4480, 11, 703...
2.958416
505
import csv import math import datetime
[ 11748, 269, 21370, 198, 11748, 10688, 198, 11748, 4818, 8079, 628, 628, 198 ]
3.307692
13
from directory_constants import urls from django.conf import settings from django.utils import translation from directory_components import helpers
[ 6738, 8619, 62, 9979, 1187, 1330, 2956, 7278, 198, 198, 6738, 42625, 14208, 13, 10414, 1330, 6460, 198, 6738, 42625, 14208, 13, 26791, 1330, 11059, 198, 198, 6738, 8619, 62, 5589, 3906, 1330, 49385, 628, 628, 628, 628, 198 ]
4.051282
39
# encoding='utf-8' ''' /** * This is the solution of No.316 problem in the LeetCode, * the website of the problem is as follow: * https://leetcode-cn.com/problems/smallest-subsequence-of-distinct-characters * <p> * The description of problem is as follow: * =======================================================...
[ 2, 21004, 11639, 40477, 12, 23, 6, 198, 198, 7061, 6, 198, 35343, 198, 1635, 770, 318, 262, 4610, 286, 1400, 13, 33400, 1917, 287, 262, 1004, 316, 10669, 11, 198, 1635, 262, 3052, 286, 262, 1917, 318, 355, 1061, 25, 198, 1635, 374...
3.153571
280
# -*- coding: utf-8 -*- import os from setuptools import setup current_directory = os.path.abspath(os.path.dirname(__file__)) with open(os.path.join(current_directory, "VERSION"), "r", encoding="utf-8") as f: version = f.read() with open(os.path.join(current_directory, "README.rst"), "r", encoding="utf-8") as f:...
[ 2, 532, 9, 12, 19617, 25, 3384, 69, 12, 23, 532, 9, 12, 198, 11748, 28686, 198, 6738, 900, 37623, 10141, 1330, 9058, 198, 198, 14421, 62, 34945, 796, 28686, 13, 6978, 13, 397, 2777, 776, 7, 418, 13, 6978, 13, 15908, 3672, 7, 834...
2.726098
387
#!/usr/bin/env python """ generate the planet market """ from spacetrading.create_svg.svg_commands import Svg from spacetrading.create_svg import generate_svg_symbols def draw_planet(svg, planet, name, fill_colour): """ actually draw the planet market """ x_shift = 30 y_shift = [0, 30, 80] x_...
[ 2, 48443, 14629, 14, 8800, 14, 24330, 21015, 198, 37811, 198, 8612, 378, 262, 5440, 1910, 198, 37811, 198, 198, 6738, 34752, 21879, 4980, 13, 17953, 62, 21370, 70, 13, 21370, 70, 62, 9503, 1746, 1330, 44343, 70, 198, 6738, 34752, 2187...
1.934972
1,953
import subprocess import sys import os while True: line = input('> ') exec = line.strip().split(' ') status = subprocess.run(exec)
[ 11748, 850, 14681, 198, 11748, 25064, 198, 11748, 28686, 628, 198, 4514, 6407, 25, 198, 220, 220, 220, 1627, 796, 5128, 10786, 29, 705, 8, 198, 220, 220, 220, 2452, 796, 1627, 13, 36311, 22446, 35312, 10786, 705, 8, 198, 220, 220, 2...
2.754717
53
from sly import Lexer, Parser import vm
[ 6738, 49822, 1330, 17210, 263, 11, 23042, 263, 198, 11748, 45887, 628, 198 ]
3.230769
13