FlowFinal / README.md
esunAI's picture
Add comprehensive model card
e37da79 verified
|
raw
history blame
3.64 kB
---
license: mit
tags:
- protein-generation
- antimicrobial-peptides
- flow-matching
- protein-design
- esm
- amp
library_name: pytorch
---
# FlowFinal: AMP Flow Matching Model
FlowFinal is a state-of-the-art flow matching model for generating antimicrobial peptides (AMPs). The model uses continuous normalizing flows to generate protein sequences in the ESM-2 embedding space.
## Model Description
- **Model Type**: Flow Matching for Protein Generation
- **Domain**: Antimicrobial Peptide (AMP) Generation
- **Base Model**: ESM-2 (650M parameters)
- **Architecture**: Transformer-based flow matching with classifier-free guidance (CFG)
- **Training Data**: Curated AMP dataset with ~7K sequences
## Key Features
- **Classifier-Free Guidance (CFG)**: Enables controlled generation with different conditioning strengths
- **ESM-2 Integration**: Leverages pre-trained protein language model embeddings
- **Compression Architecture**: Efficient 16x compression of ESM-2 embeddings (1280 β†’ 80 dimensions)
- **Multiple CFG Scales**: Support for no conditioning (0.0), weak (3.0), strong (7.5), and very strong (15.0) guidance
## Model Components
### Core Architecture
- `final_flow_model.py`: Main flow matching model implementation
- `compressor_with_embeddings.py`: Embedding compression/decompression modules
- `final_sequence_decoder.py`: ESM-2 embedding to sequence decoder
### Trained Weights
- `final_compressor_model.pth`: Trained compressor (315MB)
- `final_decompressor_model.pth`: Trained decompressor (158MB)
- `amp_flow_model_final_optimized.pth`: Main flow model checkpoint
### Generated Samples (Today's Results)
- Generated AMP sequences with different CFG scales
- HMD-AMP validation results showing 8.8% AMP prediction rate
## Performance Results
### HMD-AMP Validation (80 sequences tested)
- **Total AMPs Predicted**: 7/80 (8.8%)
- **By CFG Configuration**:
- No CFG: 1/20 (5.0%)
- Weak CFG: 2/20 (10.0%)
- Strong CFG: 4/20 (20.0%) ← Best performance
- Very Strong CFG: 0/20 (0.0%)
### Best Performing Sequences
1. `ILVLVLARRIVGVIVAKVVLYAIVRSVVAAAKSISAVTVAKVTVFFQTTA` (No CFG)
2. `EDLSKAKAELQRYLLLSEIVSAFTALTRFYVVLTKIFQIRVKLIAVGQIL` (Weak CFG)
3. `IKLSRIAGIIVKRIRVASGDAQRLITASIGFTLSVVLAARFITIILGIVI` (Strong CFG)
## Usage
```python
from generate_amps import AMPGenerator
# Initialize generator
generator = AMPGenerator(
model_path="amp_flow_model_final_optimized.pth",
device='cuda'
)
# Generate AMP samples
samples = generator.generate_amps(
num_samples=20,
num_steps=25,
cfg_scale=7.5 # Strong CFG recommended
)
```
## Training Details
- **Optimizer**: AdamW with cosine annealing
- **Learning Rate**: 4e-4 (final)
- **Epochs**: 2000
- **Final Loss**: 1.318
- **Training Time**: 2.3 hours on H100
- **Dataset Size**: 6,983 samples
## Files Structure
```
FlowFinal/
β”œβ”€β”€ models/
β”‚ β”œβ”€β”€ final_compressor_model.pth
β”‚ β”œβ”€β”€ final_decompressor_model.pth
β”‚ └── amp_flow_model_final_optimized.pth
β”œβ”€β”€ generated_samples/
β”‚ β”œβ”€β”€ generated_sequences_20250829.fasta
β”‚ └── hmd_amp_detailed_results.csv
β”œβ”€β”€ src/
β”‚ β”œβ”€β”€ final_flow_model.py
β”‚ β”œβ”€β”€ compressor_with_embeddings.py
β”‚ β”œβ”€β”€ final_sequence_decoder.py
β”‚ └── generate_amps.py
└── README.md
```
## Citation
If you use FlowFinal in your research, please cite:
```bibtex
@misc{flowfinal2025,
title={FlowFinal: Flow Matching for Antimicrobial Peptide Generation},
author={Edward Sun},
year={2025},
url={https://huggingface.co/esunAI/FlowFinal}
}
```
## License
This model is released under the MIT License.