File size: 5,084 Bytes
271c905 e6ff2b5 271c905 e6ff2b5 271c905 d40173d 271c905 d46d7ec 271c905 d46d7ec |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 |
---
license: apache-2.0
datasets:
- jheuschkel/clustered-cds-dataset
language:
- en
pipeline_tag: fill-mask
tags:
- codon
- Codon
- biology
- synthetic
- dna
- mrna
- optimization
- codon-optimization
- codon-embedding
- codon-representation
- codon-language-model
- codon-language
misc:
- codon
---
# Model Card for SynCodonLM
- This repository contains code to utilize the model, and reproduce results of the preprint [**Advancing Codon Language Modeling with Synonymous Codon Constrained Masking**](https://doi.org/10.1101/2025.08.19.671089).
- Unlike other Codon Language Models, SynCodonLM was trained with logit-level control, masking logits for non-synonymous codons. This allowed the model to learn codon-specific patterns disentangled from protein-level semantics.
- [Pre-training dataset of 43 Million CDS is available on Hugging Face here.](https://huggingface.co/datasets/jheuschkel/clustered-cds-dataset)
---
## Installation
```python
git clone https://github.com/Boehringer-Ingelheim/SynCodonLM.git
cd SynCodonLM
pip install -r requirements.txt #maybe not neccesary depending on your env :)
```
---
# Usage
#### SynCodonLM uses token-type ID's to add species-specific codon sontext to it's thinking.
###### Before use, find the token type ID (species_token_type) for your species of interest [here](https://github.com/Boehringer-Ingelheim/SynCodonLM/blob/master/SynCodonLM/species_token_type.py)!
###### Or use our list of model organisms [below]()
---
## Embedding a Coding DNA Sequence
```python
from SynCodonLM import CodonEmbeddings
model = CodonEmbeddings() #this loads the model & tokenizer using our built-in functions
seq = 'ATGTCCACCGGGCGGTGA'
mean_pooled_embedding = model.get_mean_embedding(seq, species_token_type=30) #E. coli
#returns --> tensor of shape [768]
raw_output = model.get_raw_embeddings(seq, species_token_type=67) #E. coli
raw_embedding_final_layer = raw_output.hidden_states[-1] #treat this like a typical Hugging Face model dictionary based output!
#returns --> tensor of shape [batch size (1), sequence length, 768]
```
## Codon Optimizing a Protein Sequence
###### This has not yet been rigourosly evaluated, although we can confidently say it will generate 'natural looking' coding-DNA sequences.
```python
from SynCodonLM import CodonOptimizer
optimizer = CodonOptimizer() #this loads the model & tokenizer using our built-in functions
result = optimizer.optimize(
protein_sequence="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK", #GFP
species_token_type=30, #E. coli
deterministic=True #true by default
)
codon_optimized_sequence = result.sequence
```
## Citation
If you use this work, please cite:
```bibtex
@article {Heuschkel2025.08.19.671089,
author = {Heuschkel, James and Kingsley, Laura and Pefaur, Noah and Nixon, Andrew and Cramer, Steven},
title = {Advancing Codon Language Modeling with Synonymous Codon Constrained Masking},
elocation-id = {2025.08.19.671089},
year = {2025},
doi = {10.1101/2025.08.19.671089},
publisher = {Cold Spring Harbor Laboratory},
abstract = {Codon language models offer a promising framework for modeling protein-coding DNA sequences, yet current approaches often conflate codon usage with amino acid semantics, limiting their ability to capture DNA-level biology. We introduce SynCodonLM, a codon language model that enforces a biologically grounded constraint: masked codons are only predicted from synonymous options, guided by the known protein sequence. This design disentangles codon-level from protein-level semantics, enabling the model to learn nucleotide-specific patterns. The constraint is implemented by masking non-synonymous codons from the prediction space prior to softmax. Unlike existing models, which cluster codons by amino acid identity, SynCodonLM clusters by nucleotide properties, revealing structure aligned with DNA-level biology. Furthermore, SynCodonLM outperforms existing models on 6 of 7 benchmarks sensitive to DNA-level features, including mRNA and protein expression. Our approach advances domain-specific representation learning and opens avenues for sequence design in synthetic biology, as well as deeper insights into diverse bioprocesses.Competing Interest StatementThe authors have declared no competing interest.},
URL = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089},
eprint = {https://www.biorxiv.org/content/early/2025/08/24/2025.08.19.671089.full.pdf},
journal = {bioRxiv}
}
```
----
#### Model Organisms Species Token Type IDs
| Organism | Token-Type ID |
|-------------------------|----------------|
| *E. coli* | 30 |
| *S. cerevisiae* | 118 |
| *C. elegans*| 212 |
| *D. melanogaster*| 190 |
| *D. rerio* |428 |
| *M. musculus* | 368 |
| *A. thaliana* | 258 |
| *H. sapiens* | 373 |
| *C. griseus* | 345 | |