| | --- |
| | datasets: |
| | - multimolecule/uniref |
| | - multimolecule/bfd |
| | - multimolecule/oas |
| | library_name: multimolecule |
| | license: agpl-3.0 |
| | pipeline_tag: text-generation |
| | tags: |
| | - Biology |
| | - Protein |
| | widget: |
| | - example_title: prion protein (Kanno blood group) |
| | expected_suffix: G |
| | output: |
| | text: MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIV |
| | S V J P V V E |
| | pipeline_tag: text-generation |
| | sequence_type: Protein |
| | task: text-generation |
| | text: MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIV |
| | - example_title: interleukin 10 |
| | expected_suffix: N |
| | output: |
| | text: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIR |
| | L L F F - S - L F F L S F L F F L S L L S S L L F F L S F L F L S S L L F F |
| | L S F L S L L S S L L S |
| | pipeline_tag: text-generation |
| | sequence_type: Protein |
| | task: text-generation |
| | text: MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIR |
| | - example_title: Zaire ebolavirus |
| | expected_suffix: Y |
| | output: |
| | text: NVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQC |
| | K J - L K E S S V N V F S G - I L - A - T C L A L I A T Y W J Y S L Q V V S |
| | T S S E L I S G G I - Y |
| | pipeline_tag: text-generation |
| | sequence_type: Protein |
| | task: text-generation |
| | text: NVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQC |
| | - example_title: SARS coronavirus |
| | expected_suffix: S |
| | output: |
| | text: MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFDNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFKCTFEYI |
| | R W J Q M I L T E J L D S J L V C D L V M N J A J V G J L M J T L D G L N L |
| | V V R - I P G G T - K |
| | pipeline_tag: text-generation |
| | sequence_type: Protein |
| | task: text-generation |
| | text: MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFDNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFKCTFEYI |
| | --- |
| | |
| | # ProGen2 |
| |
|
| | Pre-trained model on protein sequences using a causal language modeling (CLM) objective. |
| |
|
| | ## Disclaimer |
| |
|
| | This is an UNOFFICIAL implementation of the [ProGen2: Exploring the Boundaries of Protein Language Models](https://doi.org/10.1016/j.cels.2023.10.002) by Erik Nijkamp, Jeffrey A. Ruffolo, et al. |
| |
|
| | The OFFICIAL repository of ProGen2 is at [enijkamp/progen](https://github.com/enijkamp/progen2). |
| |
|
| | > [!TIP] |
| | > The MultiMolecule team has confirmed that the provided model and checkpoints are producing the same intermediate representations as the original implementation. |
| |
|
| | **The team releasing ProGen2 did not write this model card for this model so this model card has been written by the MultiMolecule team.** |
| |
|
| | ## Model Details |
| |
|
| | ProGen2 is a [GPT-J](https://huggingface.co/EleutherAI/gpt-j-6b)-style model pre-trained on a large corpus of protein sequences in a self-supervised fashion. This means that the model was trained on the raw amino acids of protein sequences only, with an automatic process to generate inputs and labels from those sequences. Please refer to the [Training Details](#training-details) section for more information on the training process. |
| |
|
| | ### Variants |
| |
|
| | - **[multimolecule/progen2-xlarge](https://huggingface.co/multimolecule/progen2-xlarge)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 6.4 billion parameters. |
| | - **[multimolecule/progen2-large](https://huggingface.co/multimolecule/progen2-large)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 2.7 billion parameters. |
| | - **[multimolecule/progen2-bfd90](https://huggingface.co/multimolecule/progen2-bfd90)**: The ProGen2 model pre-trained on Uniref90 and BFD90 with 2.7 billion parameters. |
| | - **[multimolecule/progen2-bfd90](https://huggingface.co/multimolecule/progen2-bfd90)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 764 million parameters. |
| | - **[multimolecule/progen2-oas](https://huggingface.co/multimolecule/progen2-oas)**: The ProGen2 model pre-trained on OAS with 764 million parameters. |
| | - **[multimolecule/progen2-medium](https://huggingface.co/multimolecule/progen2-medium)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 764 million parameters. |
| | - **[multimolecule/progen2-small](https://huggingface.co/multimolecule/progen2-small)**: The ProGen2 model pre-trained on Uniref90 and BFD30 with 151 million parameters. |
| |
|
| | ### Model Specification |
| |
|
| | <table> |
| | <thead> |
| | <tr> |
| | <th>Variants</th> |
| | <th>Num Layers</th> |
| | <th>Hidden Size</th> |
| | <th>Num Heads</th> |
| | <th>Intermediate Size</th> |
| | <th>Num Parameters (M)</th> |
| | <th>FLOPs (G)</th> |
| | <th>MACs (G)</th> |
| | <th>Context Length</th> |
| | </tr> |
| | </thead> |
| | <tbody> |
| | <tr> |
| | <td>ProGen2-xlarge</td> |
| | <td rowspan="3">32</td> |
| | <td>4096</td> |
| | <td>16</td> |
| | <td>16384</td> |
| | <td>6443.66</td> |
| | <td>6735.76</td> |
| | <td>3367.27</td> |
| | <td rowspan="3">1024</td> |
| | </tr> |
| | <tr> |
| | <td>ProGen2-large</td> |
| | <td rowspan="2">2560</td> |
| | <td rowspan="2">32</td> |
| | <td rowspan="2">10240</td> |
| | <td rowspan="2">2517.34</td> |
| | <td rowspan="2">2664.21</td> |
| | <td rowspan="2">1331.45</td> |
| | </tr> |
| | <tr> |
| | <td><b>ProGen2-bfd90</b></td> |
| | </tr> |
| | <tr> |
| | <td>ProGen2-base</td> |
| | <td rowspan="3">27</td> |
| | <td rowspan="3">1536</td> |
| | <td rowspan="4">16</td> |
| | <td rowspan="3">6144</td> |
| | <td rowspan="3">764.81</td> |
| | <td rowspan="3">826.85</td> |
| | <td rowspan="3">413.12</td> |
| | <td>2048</td> |
| | </tr> |
| | <tr> |
| | <td>ProGen2-oas</td> |
| | <td rowspan="3">1024</td> |
| | </tr> |
| | <tr> |
| | <td>ProGen2-medium</td> |
| | </tr> |
| | <tr> |
| | <td>ProGen2-small</td> |
| | <td>12</td> |
| | <td>1024</td> |
| | <td>4096</td> |
| | <td>151.15</td> |
| | <td>167.74</td> |
| | <td>83.75</td> |
| | </tr> |
| | </tbody> |
| | </table> |
| | |
| | ### Links |
| |
|
| | - **Code**: [multimolecule.progen2](https://github.com/DLS5-Omics/multimolecule/tree/master/multimolecule/models/progen2) |
| | - **Weights**: [multimolecule/progen2](https://huggingface.co/multimolecule/progen2-bfd90) |
| | - **Data**: [UniRef](https://www.uniprot.org/uniref), [BFD](https://bfd.mmseqs.com) |
| | - **Paper**: [ProGen2: Exploring the Boundaries of Protein Language Models](https://doi.org/10.1016/j.cels.2023.10.002) |
| | - **Developed by**: Erik Nijkamp, Jeffrey A. Ruffolo, Eli N. Weinstein, Nikhil Naik, Ali Madani |
| | - **Model type**: [GPT-J](https://huggingface.co/EleutherAI/gpt-j-6b) |
| | - **Original Repository**: [enijkamp/progen2](https://github.com/enijkamp/progen2) |
| |
|
| | ## Usage |
| |
|
| | The model file depends on the [`multimolecule`](https://multimolecule.danling.org) library. You can install it using pip: |
| |
|
| | ```bash |
| | pip install multimolecule |
| | ``` |
| |
|
| | ### Direct Use |
| |
|
| | #### Text Generation |
| |
|
| | You can use this model directly with a pipeline for text generation: |
| |
|
| | ```python |
| | import multimolecule # you must import multimolecule to register models |
| | from transformers import pipeline |
| | |
| | generator = pipeline("text-generation", model="multimolecule/progen2-bfd90") |
| | output = generator("MGHGVSRPPVVTLR", max_new_tokens=50) |
| | ``` |
| |
|
| | ### Downstream Use |
| |
|
| | #### Extract Features |
| |
|
| | Here is how to use this model to get the features of a given sequence in PyTorch: |
| |
|
| | ```python |
| | from multimolecule import ProteinTokenizer, ProGen2Model |
| | |
| | |
| | tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-bfd90") |
| | model = ProGen2Model.from_pretrained("multimolecule/progen2-bfd90") |
| | |
| | text = "MGHGVSRPPVVTLRPAVLDDCPVLWR" |
| | input = tokenizer(text, return_tensors="pt") |
| | |
| | output = model(**input) |
| | ``` |
| |
|
| | #### Sequence Classification / Regression |
| |
|
| | > [!NOTE] |
| | > This model is not fine-tuned for any specific task. You will need to fine-tune the model on a downstream task to use it for sequence classification or regression. |
| |
|
| | Here is how to use this model as backbone to fine-tune for a sequence-level task in PyTorch: |
| |
|
| | ```python |
| | import torch |
| | from multimolecule import ProteinTokenizer, ProGen2ForSequencePrediction |
| | |
| | |
| | tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-bfd90") |
| | model = ProGen2ForSequencePrediction.from_pretrained("multimolecule/progen2-bfd90") |
| | |
| | text = "MGHGVSRPPVVTLRPAVLDDCPVLWR" |
| | input = tokenizer(text, return_tensors="pt") |
| | label = torch.tensor([1]) |
| | |
| | output = model(**input, labels=label) |
| | ``` |
| |
|
| | #### Token Classification / Regression |
| |
|
| | > [!NOTE] |
| | > This model is not fine-tuned for any specific task. You will need to fine-tune the model on a downstream task to use it for token classification or regression. |
| |
|
| | Here is how to use this model as backbone to fine-tune for a residue-level task in PyTorch: |
| |
|
| | ```python |
| | import torch |
| | from multimolecule import ProteinTokenizer, ProGen2ForTokenPrediction |
| | |
| | |
| | tokenizer = ProteinTokenizer.from_pretrained("multimolecule/progen2-bfd90") |
| | model = ProGen2ForTokenPrediction.from_pretrained("multimolecule/progen2-bfd90") |
| | |
| | text = "MGHGVSRPPVVTLRPAVLDDCPVLWR" |
| | input = tokenizer(text, return_tensors="pt") |
| | label = torch.randint(2, (len(text), )) |
| | |
| | output = model(**input, labels=label) |
| | ``` |
| |
|
| | ## Training Details |
| |
|
| | ProGen2 used Causal Language Modeling (CLM) as the pre-training objective: given a protein sequence, the model is trained to predict the next amino acid token autoregressively. |
| |
|
| | ### Training Data |
| |
|
| | The ProGen2 models were pre-trained on protein sequence databases: |
| |
|
| | - **Uniref90**: A clustered version of the UniProt database at 90% sequence identity, containing approximately 135 million sequences. |
| | - **BFD30**: The Big Fantastic Database clustered at 30% sequence identity, approximately one-third the size of Uniref90. |
| | - **BFD90**: The Big Fantastic Database clustered at 90% sequence identity, approximately twice the size of Uniref90. |
| | - **OAS**: The Observed Antibody Space database, clustered at 85% sequence identity. |
| |
|
| | Different model variants were trained on different combinations: |
| |
|
| | - **progen2-small, progen2-medium, progen2-base, progen2-large, progen2-xlarge**: Trained on Uniref90 and BFD30. |
| | - **progen2-bfd90**: Trained on Uniref90 and BFD90. |
| | - **progen2-oas**: Trained on the OAS database. |
| |
|
| | ### Training Procedure |
| |
|
| | ProGen2 used causal language modeling (CLM) as the pre-training objective. |
| |
|
| | #### Pre-training |
| |
|
| | The model was trained on Google TPU-v3 pods using JAX. |
| |
|
| | - Batch size: 500,000 -- 1,000,000 |
| | - Steps: 350,000 -- 400,000 |
| | - Optimizer: Adam(β1=0.9, β2=0.999, ε=1e-8) |
| | - Learning rate: 1e-5 -- 6e-4 |
| | - Learning rate scheduler: Cosine |
| | - Learning rate warm-up: 3,000 -- 10,000 steps |
| | - Weight decay: 0.1 |
| | - Maximum Gradient Norm: 0.8 -- 1.0 |
| |
|
| | ## Citation |
| |
|
| | **BibTeX**: |
| |
|
| | ```bibtex |
| | @ARTICLE{Nijkamp2023-jz, |
| | title = "{ProGen2}: Exploring the boundaries of protein language models", |
| | author = "Nijkamp, Erik and Ruffolo, Jeffrey A and Weinstein, Eli N and |
| | Naik, Nikhil and Madani, Ali", |
| | abstract = "Attention-based models trained on protein sequences have |
| | demonstrated incredible success at classification and generation |
| | tasks relevant for artificial-intelligence-driven protein |
| | design. However, we lack a sufficient understanding of how very |
| | large-scale models and data play a role in effective protein |
| | model development. We introduce a suite of protein language |
| | models, named ProGen2, that are scaled up to 6.4B parameters and |
| | trained on different sequence datasets drawn from over a billion |
| | proteins from genomic, metagenomic, and immune repertoire |
| | databases. ProGen2 models show state-of-the-art performance in |
| | capturing the distribution of observed evolutionary sequences, |
| | generating novel viable sequences, and predicting protein |
| | fitness without additional fine-tuning. As large model sizes and |
| | raw numbers of protein sequences continue to become more widely |
| | accessible, our results suggest that a growing emphasis needs to |
| | be placed on the data distribution provided to a protein |
| | sequence model. Our models and code are open sourced for |
| | widespread adoption in protein engineering. A record of this |
| | paper's Transparent Peer Review process is included in the |
| | supplemental information.", |
| | journal = "Cell Syst.", |
| | publisher = "Elsevier BV", |
| | volume = 14, |
| | number = 11, |
| | pages = "968--978.e3", |
| | month = nov, |
| | year = 2023, |
| | keywords = "fitness prediction; language modeling; protein design", |
| | copyright = "http://www.elsevier.com/open-access/userlicense/1.0/", |
| | language = "en" |
| | } |
| | ``` |
| |
|
| | > [!NOTE] |
| | > The artifacts distributed in this repository are part of the MultiMolecule project. |
| | > If you use MultiMolecule in your research, you must cite the MultiMolecule project as follows: |
| |
|
| | ```bibtex |
| | @software{chen_2024_12638419, |
| | author = {Chen, Zhiyuan and Zhu, Sophia Y.}, |
| | title = {MultiMolecule}, |
| | doi = {10.5281/zenodo.12638419}, |
| | publisher = {Zenodo}, |
| | url = {https://doi.org/10.5281/zenodo.12638419}, |
| | year = 2024, |
| | month = may, |
| | day = 4 |
| | } |
| | ``` |
| |
|
| | ## Contact |
| |
|
| | Please use GitHub issues of [MultiMolecule](https://github.com/DLS5-Omics/multimolecule/issues) for any questions or comments on the model card. |
| |
|
| | Please contact the authors of the [ProGen2 paper](https://doi.org/10.1016/j.cels.2023.10.002) for questions or comments on the paper/model. |
| |
|
| | ## License |
| |
|
| | This model is licensed under the [GNU Affero General Public License](license.md). |
| |
|
| | For additional terms and clarifications, please refer to our [License FAQ](license-faq.md). |
| |
|
| | ```spdx |
| | SPDX-License-Identifier: AGPL-3.0-or-later |
| | ``` |