Model Card for viral-sequence-prediction
This model was a part of the University of Virginia's NLP course final project: NLP for social good. Using publically available data from the NCBI virus data portal, we designed an LSTM-based classifier that can predict the virus of origin for any arbitrary protein sequence.
Specifically, we were interested in classifying COVID v Flu.
Using the model
Code for the model can be found at: https://github.com/nleroy917/CS6501-final
You can use the train.ipynb notebook, or use the code directly:
from dna_classification.models import DNASequenceClassifier
model = DNASequenceClassifier("nleroy917/viral-sequence-prediction")
virus = model.predict("MGYINVFAFPFTIYSLLLCRMNFRNYIAQVDVVNFNLT")
>>> COVID
- Downloads last month
- 1
Inference Providers NEW
This model isn't deployed by any Inference Provider. 🙋 Ask for provider support