NuTCRacker / README.md
TruptiG's picture
Update README.md
9fd9900 verified
|
raw
history blame
6.65 kB
---
# For reference on model card metadata, see the spec: https://github.com/huggingface/hub-docs/blob/main/modelcard.md?plain=1
# Doc / guide: https://huggingface.co/docs/hub/model-cards
{}
---
# nuTCRacker model (pre-trained)
<!-- Provide a quick summary of what the model is/does. -->
This modelcard aims to be a base template for new models. It has been generated using [this raw template](https://github.com/huggingface/huggingface_hub/blob/main/src/huggingface_hub/templates/modelcard_template.md?plain=1).
## Model Details
### Model Description
The model is a pre-trained model.This model can be used for finetuning a sequence classificatin model for a binary classification task of predicting
paired TCR-petide-HLA-I binding based on amino acid sequence inputs. It is a transformer model that is built on DeBERTa architecture.
<!-- Provide a longer summary of what this model is. -->
- **Developed by:** Justin Barton and Trupti Gore
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** DeBERTa Transformer
- **Language(s) (NLP):** Python
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### How to Use
```
from transformers import (DebertaForSequenceClassification,DebertaTokenizerFast)
model = DebertaForSequenceClassification.from_pretrained(f'shepherdgroup/nuTCRacker', num_labels=2)
tokenizer=DebertaTokenizerFast.from_pretrained('shepherdgroup/nuTCRacker')
example="'[cdra1]SSVPPY[cdra2]YTSAATLV[cdra3]CAVSAGDYKLSF[cdrb1]KGHDR[cdrb2]SFDVKD[cdrb3]CATSDSVAGNQPQHF','[peptide]ATDALMTGF[mhc]YFAMYQENMAHTDANTLYIIYRDYTWVARVYRGY'"
encoded_example=tokenizer(example,return_tensors='pt')
output=model(**encoded_example)
output
```
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
## Training hyperparameters
```
vocab_size=len(tokenizer),
num_attention_heads=8,
num_hidden_layers=16,
hidden_size=512,
intermediate_size=2048,
hidden_act='gelu',
hidden_dropout_prob=0.15,
relative_attention=True,
pos_att_type='c2p|p2c',
max_relative_positions=-1,
position_biased_input=False,
attention_probs_dropout_prob=0.15,
initializer_range=0.02,
layer_norm_eps=1e-7,
````
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed]