metadata
base_model:
- facebook/esm2_t36_3B_UR50D
- facebook/esm2_t33_650M_UR50D
- facebook/esm2_t30_150M_UR50D
- facebook/esm2_t12_35M_UR50D
- facebook/esm2_t6_8M_UR50D
license: mit
pipeline_tag: feature-extraction
PLM Reverse Distillation
This repository contains the weights for the protein language models presented in the paper Reverse Distillation: Consistently Scaling Protein Language Model Representations.
Reverse Distillation is a principled framework that decomposes large Protein Language Model (PLM) representations into orthogonal subspaces guided by smaller models of the same family. The resulting embeddings have a Matryoshka-style nested structure, ensuring that larger reverse-distilled models consistently outperform smaller ones.
- GitHub Repository: rohitsinghlab/plm_reverse_distillation
Quick Start
Reverse Distilled ESM-2 models are designed to be a drop-in replacement for ESM-2 for most embedding-generation tasks.
import esm
import torch
import reverse_distillation
# Load ESM-2 model and the reverse distillation version
esm2_model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
rd_model, alphabet = reverse_distillation.pretrained.esm2_rd_650M()
batch_converter = alphabet.get_batch_converter()
esm2_model.eval() # disables dropout for deterministic results
rd_model.eval() # disables dropout for deterministic results
# Prepare data
data = [
("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"),
("protein2", "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"),
]
batch_labels, batch_strs, batch_tokens = batch_converter(data)
batch_lens = (batch_tokens != alphabet.padding_idx).sum(1)
# Extract per-residue representations
with torch.no_grad():
results_esm = esm2_model(batch_tokens, repr_layers=[33], return_contacts=True)
results_rd = rd_model(batch_tokens)
esm_token_representations = results_esm["representations"][33]
rd_token_representations = results_rd["representations"]["650M"]
# Generate per-sequence representations via averaging
for i, tokens_len in enumerate(batch_lens):
print(f"esm representation size: {esm_token_representations[i, 1 : tokens_len - 1].size()}")
print(f"rd representation size: {rd_token_representations[i, 1 : tokens_len - 1].size()}")
Citation
If you use reverse distillation, please cite:
@inproceedings{catrina2026reverse,
title = {Reverse Distillation: Consistently Scaling Protein Language Model Representations},
author = {Catrina, Darius and Bepler, Christian and Sledzieski, Samuel and Singh, Rohit},
booktitle = {International Conference on Learning Representations},
year = {2026}
}