|
|
--- |
|
|
license: apache-2.0 |
|
|
language: |
|
|
- en |
|
|
tags: |
|
|
- Protein_Language_Model |
|
|
- MSA Generation |
|
|
--- |
|
|
# MSAGPT |
|
|
|
|
|
<table> |
|
|
<tr> |
|
|
<td> |
|
|
<h2>MSAGPT</h2> |
|
|
<p>📖 Paper: <a href="xxx">MSAGPT: Neural Prompting Protein Structure Prediction via MSA Generative Pre-Training</a></p> |
|
|
<p><b>MSAGPT</b> is a powerful protein language model (PLM). MSAGPT has 3 billion parameters with three versions of the model, MSAGPT, MSAGPT-Sft, and MSAGPT-Dpo, <b>supporting zero-shot and few-shot MSA generation</b>.</p> |
|
|
<p><b>MSAGPT achieves state-of-the-art structural prediction performance on natural MSA-scarce scenarios</b>.</p> |
|
|
</td> |
|
|
</tr> |
|
|
</table> |
|
|
|
|
|
|
|
|
## Overall Framework |
|
|
<p align="center"> |
|
|
<img src="resources/overall_frame.png" alt="描述文字" style="display: block; margin: auto; width: 90%;"> |
|
|
</p> |
|
|
|
|
|
## Visualized Cases |
|
|
Visualization of improved structure prediction compared with nature MSA. |
|
|
<font color=orange>Yellow</font>: Ground truth; |
|
|
<font color=purple>Purple</font>: Predictions based on MSA generated by MSAGPT; |
|
|
<font color=cyan>Cyan</font>: Predictions from MSA generated by natural MSA. |
|
|
|
|
|
<p align="center"> |
|
|
<img src="resources/app_case.png" alt="描述文字" style="display: block; margin: auto; width: 90%;"> |
|
|
</p> |
|
|
|
|
|
|
|
|
## Get Started: |
|
|
|
|
|
### Option 1:Deploy MSAGPT by yourself |
|
|
|
|
|
We support GUI for model inference. |
|
|
|
|
|
First, we need to install the dependencies. |
|
|
|
|
|
```bash |
|
|
# CUDA >= 11.8 |
|
|
pip install -r requirements.txt |
|
|
``` |
|
|
|
|
|
#### Model List |
|
|
You can choose to manually download the necessary weights. Then UNZIP it and put it into the **checkpoints** folder. |
|
|
|
|
|
| Model | Type | Seq Length | Download | |
|
|
|------------------|------|------------|-----------------------------------------------------------------------------------------------------------------------------------------| |
|
|
| MSAGPT | Base | 16K | [🤗 Huggingface](https://huggingface.co/THUDM/MSAGPT) [🔨 SwissArmyTransformer](https://cloud.tsinghua.edu.cn/f/ebfc954a4cd24cef9243/?dl=1) | |
|
|
| MSAGPT-SFT | Sft | 16K | [🤗 Huggingface](https://huggingface.co/THUDM/MSAGPT) [🔨 SwissArmyTransformer](https://cloud.tsinghua.edu.cn/f/32da3eadf6e042aab2fa/?dl=1) | |
|
|
| MSAGPT-DPO | Rlhf | 16K | [🤗 Huggingface](https://huggingface.co/THUDM/MSAGPT) [🔨 SwissArmyTransformer](https://cloud.tsinghua.edu.cn/f/ebfc954a4cd24cef9243/?dl=1) | | | |
|
|
|
|
|
|
|
|
#### Situation 1.1 CLI (SAT version) |
|
|
|
|
|
Run CLI demo via: |
|
|
|
|
|
```bash |
|
|
# Online Chat |
|
|
bash scripts/cli_sat.sh --from_pretrained ./checkpoints/MSAGPT-DPO --input-source chat --stream_chat --max-gen-length 1024 |
|
|
``` |
|
|
|
|
|
The program will automatically interact in the command line. You can generate replies entering the protein sequence you need to generate virtual MSAs (or add a few MSAs as a prompt, connected by "\<M\>"), for example: "PEGKQGDPGIPGEPGPPGPPGPQGARGPPG\<M\>VTVEFVNSCLIGDMGVDGPPGQQGQPGPPG", where "PEGKQGDPGIPGEPGPPGPPGPQGARGPPG" is the main sequence, and "VTVEFVNSCLIGDMGVDGPPGQQGQPGPPG" are MSA prompts, and pressing enter. Enter `stop` to stop the program. The chat CLI looks like: |
|
|
<p align="center"> |
|
|
<img src="resources/demo.gif" alt="描述文字" style="display: block; margin: auto; width: 90%;"> |
|
|
</p> |
|
|
|
|
|
|
|
|
You can also enable the offline generation by set the **--input-source \<your input file\>** and **--output-path \<your output path\>**. |
|
|
We set an input file example: *msa_input*. |
|
|
```bash |
|
|
# Offline Generation |
|
|
bash scripts/cli_sat.sh --from_pretrained ./checkpoints/MSAGPT-DPO --input-source <your input file> --output-path <your output path> --max-gen-length 1024 |
|
|
``` |
|
|
|
|
|
#### Situation 1.2 CLI (Huggingface version) |
|
|
(TODO) |
|
|
|
|
|
#### Situation 1.3 Web Demo |
|
|
(TODO) |
|
|
|
|
|
### Option 2:Finetuning MSAGPT |
|
|
|
|
|
(TODO) |
|
|
|
|
|
### Hardware requirement |
|
|
|
|
|
* Model Inference: |
|
|
For BF16: 1 * A100(80G) |
|
|
|
|
|
* Finetuning: |
|
|
|
|
|
For BF16: 4 * A100(80G) *[Recommend]*. |
|
|
|
|
|
|
|
|
## License |
|
|
|
|
|
The code in this repository is open source under the [Apache-2.0 license](./LICENSE). |
|
|
|
|
|
If you find our work helpful, please consider citing the our paper |
|
|
|
|
|
``` |
|
|
@article{chen2024msagpt, |
|
|
title={MSAGPT: Neural Prompting Protein Structure Prediction via MSA Generative Pre-Training}, |
|
|
author={Chen, Bo and Bei, Zhilei and Cheng, Xingyi and Li, Pan and Tang, Jie and Song, Le}, |
|
|
journal={arXiv preprint arXiv:2406.05347}, |
|
|
year={2024} |
|
|
} |
|
|
``` |