id
int32
0
252k
repo
stringlengths
7
55
path
stringlengths
4
127
func_name
stringlengths
1
88
original_string
stringlengths
75
19.8k
language
stringclasses
1 value
code
stringlengths
51
19.8k
code_tokens
list
docstring
stringlengths
3
17.3k
docstring_tokens
list
sha
stringlengths
40
40
url
stringlengths
87
242
24,500
casacore/python-casacore
casacore/tables/table.py
table.putkeyword
def putkeyword(self, keyword, value, makesubrecord=False): """Put the value of a table keyword. The value of a keyword can be a: - scalar which can be given a normal python scalar or numpy scalar. - an array which can be given as a numpy array. A 1-dimensional array can also be given as a sequence (tuple or list). - a reference to a table which can be given as a table object or as a string containing its name prefixed by 'Table :'. - a struct which can be given as a dict. A struct is fully nestable, thus each field in the dict can be one of the values described here. The only exception is that a table value can only be given by the string. If the keyword already exists, the type of the new value should match the existing one (e.g. a scalar cannot be replaced by an array). Similar to method :func:`getkeyword` a keyword name can be given consisting of multiple parts separated by dots. This represents nested structs, thus puts the value into a field in a struct (in a struct, etc.). If `makesubrecord=True` structs will be created for the keyword name parts that do not exist. Instead of a keyword name an index can be given which returns the value of the i-th keyword. """ val = value if isinstance(val, table): val = _add_prefix(val.name()) if isinstance(keyword, str): return self._putkeyword('', keyword, -1, makesubrecord, val) else: return self._putkeyword('', '', keyword, makesubrecord, val)
python
def putkeyword(self, keyword, value, makesubrecord=False): val = value if isinstance(val, table): val = _add_prefix(val.name()) if isinstance(keyword, str): return self._putkeyword('', keyword, -1, makesubrecord, val) else: return self._putkeyword('', '', keyword, makesubrecord, val)
[ "def", "putkeyword", "(", "self", ",", "keyword", ",", "value", ",", "makesubrecord", "=", "False", ")", ":", "val", "=", "value", "if", "isinstance", "(", "val", ",", "table", ")", ":", "val", "=", "_add_prefix", "(", "val", ".", "name", "(", ")", ...
Put the value of a table keyword. The value of a keyword can be a: - scalar which can be given a normal python scalar or numpy scalar. - an array which can be given as a numpy array. A 1-dimensional array can also be given as a sequence (tuple or list). - a reference to a table which can be given as a table object or as a string containing its name prefixed by 'Table :'. - a struct which can be given as a dict. A struct is fully nestable, thus each field in the dict can be one of the values described here. The only exception is that a table value can only be given by the string. If the keyword already exists, the type of the new value should match the existing one (e.g. a scalar cannot be replaced by an array). Similar to method :func:`getkeyword` a keyword name can be given consisting of multiple parts separated by dots. This represents nested structs, thus puts the value into a field in a struct (in a struct, etc.). If `makesubrecord=True` structs will be created for the keyword name parts that do not exist. Instead of a keyword name an index can be given which returns the value of the i-th keyword.
[ "Put", "the", "value", "of", "a", "table", "keyword", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1373-L1408
24,501
casacore/python-casacore
casacore/tables/table.py
table.removekeyword
def removekeyword(self, keyword): """Remove a table keyword. Similar to :func:`getkeyword` the name can consist of multiple parts. In that case a field in a struct will be removed. Instead of a keyword name an index can be given which removes the i-th keyword. """ if isinstance(keyword, str): self._removekeyword('', keyword, -1) else: self._removekeyword('', '', keyword)
python
def removekeyword(self, keyword): if isinstance(keyword, str): self._removekeyword('', keyword, -1) else: self._removekeyword('', '', keyword)
[ "def", "removekeyword", "(", "self", ",", "keyword", ")", ":", "if", "isinstance", "(", "keyword", ",", "str", ")", ":", "self", ".", "_removekeyword", "(", "''", ",", "keyword", ",", "-", "1", ")", "else", ":", "self", ".", "_removekeyword", "(", "'...
Remove a table keyword. Similar to :func:`getkeyword` the name can consist of multiple parts. In that case a field in a struct will be removed. Instead of a keyword name an index can be given which removes the i-th keyword.
[ "Remove", "a", "table", "keyword", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1444-L1457
24,502
casacore/python-casacore
casacore/tables/table.py
table.removecolkeyword
def removecolkeyword(self, columnname, keyword): """Remove a column keyword. It is similar to :func:`removekeyword`. """ if isinstance(keyword, str): self._removekeyword(columnname, keyword, -1) else: self._removekeyword(columnname, '', keyword)
python
def removecolkeyword(self, columnname, keyword): if isinstance(keyword, str): self._removekeyword(columnname, keyword, -1) else: self._removekeyword(columnname, '', keyword)
[ "def", "removecolkeyword", "(", "self", ",", "columnname", ",", "keyword", ")", ":", "if", "isinstance", "(", "keyword", ",", "str", ")", ":", "self", ".", "_removekeyword", "(", "columnname", ",", "keyword", ",", "-", "1", ")", "else", ":", "self", "....
Remove a column keyword. It is similar to :func:`removekeyword`.
[ "Remove", "a", "column", "keyword", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1459-L1468
24,503
casacore/python-casacore
casacore/tables/table.py
table.getdesc
def getdesc(self, actual=True): """Get the table description. By default it returns the actual description (thus telling the actual array shapes and data managers used). `actual=False` means that the original description as made by :func:`maketabdesc` is returned. """ tabledesc = self._getdesc(actual, True) # Strip out 0 length "HCcoordnames" and "HCidnames" # as these aren't valid. (See tabledefinehypercolumn) hcdefs = tabledesc.get('_define_hypercolumn_', {}) for c, hcdef in hcdefs.iteritems(): if "HCcoordnames" in hcdef and len(hcdef["HCcoordnames"]) == 0: del hcdef["HCcoordnames"] if "HCidnames" in hcdef and len(hcdef["HCidnames"]) == 0: del hcdef["HCidnames"] return tabledesc
python
def getdesc(self, actual=True): tabledesc = self._getdesc(actual, True) # Strip out 0 length "HCcoordnames" and "HCidnames" # as these aren't valid. (See tabledefinehypercolumn) hcdefs = tabledesc.get('_define_hypercolumn_', {}) for c, hcdef in hcdefs.iteritems(): if "HCcoordnames" in hcdef and len(hcdef["HCcoordnames"]) == 0: del hcdef["HCcoordnames"] if "HCidnames" in hcdef and len(hcdef["HCidnames"]) == 0: del hcdef["HCidnames"] return tabledesc
[ "def", "getdesc", "(", "self", ",", "actual", "=", "True", ")", ":", "tabledesc", "=", "self", ".", "_getdesc", "(", "actual", ",", "True", ")", "# Strip out 0 length \"HCcoordnames\" and \"HCidnames\"", "# as these aren't valid. (See tabledefinehypercolumn)", "hcdefs", ...
Get the table description. By default it returns the actual description (thus telling the actual array shapes and data managers used). `actual=False` means that the original description as made by :func:`maketabdesc` is returned.
[ "Get", "the", "table", "description", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1470-L1491
24,504
casacore/python-casacore
casacore/tables/table.py
table.getcoldesc
def getcoldesc(self, columnname, actual=True): """Get the description of a column. By default it returns the actual description (thus telling the actual array shapes and data managers used). `actual=False` means that the original description as made by :func:`makescacoldesc` or :func:`makearrcoldesc` is returned. """ return self._getcoldesc(columnname, actual, True)
python
def getcoldesc(self, columnname, actual=True): return self._getcoldesc(columnname, actual, True)
[ "def", "getcoldesc", "(", "self", ",", "columnname", ",", "actual", "=", "True", ")", ":", "return", "self", ".", "_getcoldesc", "(", "columnname", ",", "actual", ",", "True", ")" ]
Get the description of a column. By default it returns the actual description (thus telling the actual array shapes and data managers used). `actual=False` means that the original description as made by :func:`makescacoldesc` or :func:`makearrcoldesc` is returned.
[ "Get", "the", "description", "of", "a", "column", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1493-L1502
24,505
casacore/python-casacore
casacore/tables/table.py
table.coldesc
def coldesc(self, columnname, actual=True): """Make the description of a column. Make the description object of the given column as :func:`makecoldesc` is doing with the description given by :func:`getcoldesc`. """ import casacore.tables.tableutil as pt return pt.makecoldesc(columnname, self.getcoldesc(columnname, actual))
python
def coldesc(self, columnname, actual=True): import casacore.tables.tableutil as pt return pt.makecoldesc(columnname, self.getcoldesc(columnname, actual))
[ "def", "coldesc", "(", "self", ",", "columnname", ",", "actual", "=", "True", ")", ":", "import", "casacore", ".", "tables", ".", "tableutil", "as", "pt", "return", "pt", ".", "makecoldesc", "(", "columnname", ",", "self", ".", "getcoldesc", "(", "column...
Make the description of a column. Make the description object of the given column as :func:`makecoldesc` is doing with the description given by :func:`getcoldesc`.
[ "Make", "the", "description", "of", "a", "column", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1504-L1513
24,506
casacore/python-casacore
casacore/tables/table.py
table.getdminfo
def getdminfo(self, columnname=None): """Get data manager info. Each column in a table is stored using a data manager. A storage manager is a data manager storing the physically in a file. A virtual column engine is a data manager that does not store data but calculates it on the fly (e.g. scaling floats to short to reduce storage needs). By default this method returns a dict telling the data managers used. Each field in the dict is a dict containing: - NAME telling the (unique) name of the data manager - TYPE telling the type of data manager (e.g. TiledShapeStMan) - SEQNR telling the sequence number of the data manager (is ''i'' in table.f<i> for storage managers) - SPEC is a dict holding the data manager specification - COLUMNS is a list giving the columns stored by this data manager When giving a column name the data manager info of that particular column is returned (without the COLUMNS field). It can, for instance, be used when adding a column using :func:`addcols` that should use the same data manager type as an existing column. However, when doing that care should be taken to change the NAME because each data manager name has to be unique. """ dminfo = self._getdminfo() if columnname is None: return dminfo # Find the info for the given column for fld in dminfo.values(): if columnname in fld["COLUMNS"]: fldc = fld.copy() del fldc['COLUMNS'] # remove COLUMNS field return fldc raise KeyError("Column " + columnname + " does not exist")
python
def getdminfo(self, columnname=None): dminfo = self._getdminfo() if columnname is None: return dminfo # Find the info for the given column for fld in dminfo.values(): if columnname in fld["COLUMNS"]: fldc = fld.copy() del fldc['COLUMNS'] # remove COLUMNS field return fldc raise KeyError("Column " + columnname + " does not exist")
[ "def", "getdminfo", "(", "self", ",", "columnname", "=", "None", ")", ":", "dminfo", "=", "self", ".", "_getdminfo", "(", ")", "if", "columnname", "is", "None", ":", "return", "dminfo", "# Find the info for the given column", "for", "fld", "in", "dminfo", "....
Get data manager info. Each column in a table is stored using a data manager. A storage manager is a data manager storing the physically in a file. A virtual column engine is a data manager that does not store data but calculates it on the fly (e.g. scaling floats to short to reduce storage needs). By default this method returns a dict telling the data managers used. Each field in the dict is a dict containing: - NAME telling the (unique) name of the data manager - TYPE telling the type of data manager (e.g. TiledShapeStMan) - SEQNR telling the sequence number of the data manager (is ''i'' in table.f<i> for storage managers) - SPEC is a dict holding the data manager specification - COLUMNS is a list giving the columns stored by this data manager When giving a column name the data manager info of that particular column is returned (without the COLUMNS field). It can, for instance, be used when adding a column using :func:`addcols` that should use the same data manager type as an existing column. However, when doing that care should be taken to change the NAME because each data manager name has to be unique.
[ "Get", "data", "manager", "info", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1515-L1551
24,507
casacore/python-casacore
casacore/tables/table.py
table.setdmprop
def setdmprop(self, name, properties, bycolumn=True): """Set properties of a data manager. Properties (e.g. cachesize) of a data manager can be changed by defining them appropriately in the properties argument (a dict). Current values can be obtained using function :func:`getdmprop` which also serves as a template. The dict can contain more fields; only the fields with the names as returned by getdmprop are handled. The data manager can be specified in two ways: by data manager name or by the name of a column using the data manager. The argument `bycolumn` defines which way is used (default is by column name). """ return self._setdmprop(name, properties, bycolumn)
python
def setdmprop(self, name, properties, bycolumn=True): return self._setdmprop(name, properties, bycolumn)
[ "def", "setdmprop", "(", "self", ",", "name", ",", "properties", ",", "bycolumn", "=", "True", ")", ":", "return", "self", ".", "_setdmprop", "(", "name", ",", "properties", ",", "bycolumn", ")" ]
Set properties of a data manager. Properties (e.g. cachesize) of a data manager can be changed by defining them appropriately in the properties argument (a dict). Current values can be obtained using function :func:`getdmprop` which also serves as a template. The dict can contain more fields; only the fields with the names as returned by getdmprop are handled. The data manager can be specified in two ways: by data manager name or by the name of a column using the data manager. The argument `bycolumn` defines which way is used (default is by column name).
[ "Set", "properties", "of", "a", "data", "manager", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1575-L1589
24,508
casacore/python-casacore
casacore/tables/table.py
table.showstructure
def showstructure(self, dataman=True, column=True, subtable=False, sort=False): """Show table structure in a formatted string. The structure of this table and optionally its subtables is shown. It shows the data manager info and column descriptions. Optionally the columns are sorted in alphabetical order. `dataman` Show data manager info? If False, only column info is shown. If True, data manager info and columns per data manager are shown. `column` Show column description per data manager? Only takes effect if dataman=True. `subtable` Show the structure of all subtables (recursively). The names of subtables are always shown. 'sort' Sort the columns in alphabetical order? """ return self._showstructure(dataman, column, subtable, sort)
python
def showstructure(self, dataman=True, column=True, subtable=False, sort=False): return self._showstructure(dataman, column, subtable, sort)
[ "def", "showstructure", "(", "self", ",", "dataman", "=", "True", ",", "column", "=", "True", ",", "subtable", "=", "False", ",", "sort", "=", "False", ")", ":", "return", "self", ".", "_showstructure", "(", "dataman", ",", "column", ",", "subtable", "...
Show table structure in a formatted string. The structure of this table and optionally its subtables is shown. It shows the data manager info and column descriptions. Optionally the columns are sorted in alphabetical order. `dataman` Show data manager info? If False, only column info is shown. If True, data manager info and columns per data manager are shown. `column` Show column description per data manager? Only takes effect if dataman=True. `subtable` Show the structure of all subtables (recursively). The names of subtables are always shown. 'sort' Sort the columns in alphabetical order?
[ "Show", "table", "structure", "in", "a", "formatted", "string", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1591-L1612
24,509
casacore/python-casacore
casacore/tables/table.py
table.summary
def summary(self, recurse=False): """Print a summary of the table. It prints the number of columns and rows, column names, and table and column keywords. If `recurse=True` it also prints the summary of all subtables, i.e. tables referenced by table keywords. """ six.print_('Table summary:', self.name()) six.print_('Shape:', self.ncols(), 'columns by', self.nrows(), 'rows') six.print_('Info:', self.info()) tkeys = self.getkeywords() if (len(tkeys) > 0): six.print_('Table keywords:', tkeys) columns = self.colnames() if (len(columns) > 0): six.print_('Columns:', columns) for column in columns: ckeys = self.getcolkeywords(column) if (len(ckeys) > 0): six.print_(column, 'keywords:', ckeys) if (recurse): for key, value in tkeys.items(): tabname = _remove_prefix(value) six.print_('Summarizing subtable:', tabname) lt = table(tabname) if (not lt.summary(recurse)): break return True
python
def summary(self, recurse=False): six.print_('Table summary:', self.name()) six.print_('Shape:', self.ncols(), 'columns by', self.nrows(), 'rows') six.print_('Info:', self.info()) tkeys = self.getkeywords() if (len(tkeys) > 0): six.print_('Table keywords:', tkeys) columns = self.colnames() if (len(columns) > 0): six.print_('Columns:', columns) for column in columns: ckeys = self.getcolkeywords(column) if (len(ckeys) > 0): six.print_(column, 'keywords:', ckeys) if (recurse): for key, value in tkeys.items(): tabname = _remove_prefix(value) six.print_('Summarizing subtable:', tabname) lt = table(tabname) if (not lt.summary(recurse)): break return True
[ "def", "summary", "(", "self", ",", "recurse", "=", "False", ")", ":", "six", ".", "print_", "(", "'Table summary:'", ",", "self", ".", "name", "(", ")", ")", "six", ".", "print_", "(", "'Shape:'", ",", "self", ".", "ncols", "(", ")", ",", "'column...
Print a summary of the table. It prints the number of columns and rows, column names, and table and column keywords. If `recurse=True` it also prints the summary of all subtables, i.e. tables referenced by table keywords.
[ "Print", "a", "summary", "of", "the", "table", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1614-L1643
24,510
casacore/python-casacore
casacore/tables/table.py
table.selectrows
def selectrows(self, rownrs): """Return a reference table containing the given rows.""" t = self._selectrows(rownrs, name='') # selectrows returns a Table object, so turn that into table. return table(t, _oper=3)
python
def selectrows(self, rownrs): t = self._selectrows(rownrs, name='') # selectrows returns a Table object, so turn that into table. return table(t, _oper=3)
[ "def", "selectrows", "(", "self", ",", "rownrs", ")", ":", "t", "=", "self", ".", "_selectrows", "(", "rownrs", ",", "name", "=", "''", ")", "# selectrows returns a Table object, so turn that into table.", "return", "table", "(", "t", ",", "_oper", "=", "3", ...
Return a reference table containing the given rows.
[ "Return", "a", "reference", "table", "containing", "the", "given", "rows", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1645-L1649
24,511
casacore/python-casacore
casacore/tables/table.py
table.query
def query(self, query='', name='', sortlist='', columns='', limit=0, offset=0, style='Python'): """Query the table and return the result as a reference table. This method queries the table. It forms a `TaQL <../../doc/199.html>`_ command from the given arguments and executes it using the :func:`taql` function. The result is returned in a so-called reference table which references the selected columns and rows in the original table. Usually a reference table is temporary, but it can be made persistent by giving it a name. Note that a reference table is handled as any table, thus can be queried again. All arguments are optional, but at least one of `query`, `name`, `sortlist`, and `columns` should be used. See the `TaQL note <../../doc/199.html>`_ for the detailed description of the the arguments representing the various parts of a TaQL command. `query` The WHERE part of a TaQL command. `name` The name of the reference table if it is to be made persistent. `sortlist` The ORDERBY part of a TaQL command. It is a single string in which commas have to be used to separate sort keys. `columns` The columns to be selected (projection in data base terms). It is a single string in which commas have to be used to separate column names. Apart from column names, expressions can be given as well. `limit` If > 0, maximum number of rows to be selected. `offset` If > 0, ignore the first N matches. `style` The TaQL syntax style to be used (defaults to Python). """ if not query and not sortlist and not columns and \ limit <= 0 and offset <= 0: raise ValueError('No selection done (arguments query, ' + 'sortlist, columns, limit, and offset are empty)') command = 'select ' if columns: command += columns command += ' from $1' if query: command += ' where ' + query if sortlist: command += ' orderby ' + sortlist if limit > 0: command += ' limit %d' % limit if offset > 0: command += ' offset %d' % offset if name: command += ' giving ' + name return tablecommand(command, style, [self])
python
def query(self, query='', name='', sortlist='', columns='', limit=0, offset=0, style='Python'): if not query and not sortlist and not columns and \ limit <= 0 and offset <= 0: raise ValueError('No selection done (arguments query, ' + 'sortlist, columns, limit, and offset are empty)') command = 'select ' if columns: command += columns command += ' from $1' if query: command += ' where ' + query if sortlist: command += ' orderby ' + sortlist if limit > 0: command += ' limit %d' % limit if offset > 0: command += ' offset %d' % offset if name: command += ' giving ' + name return tablecommand(command, style, [self])
[ "def", "query", "(", "self", ",", "query", "=", "''", ",", "name", "=", "''", ",", "sortlist", "=", "''", ",", "columns", "=", "''", ",", "limit", "=", "0", ",", "offset", "=", "0", ",", "style", "=", "'Python'", ")", ":", "if", "not", "query",...
Query the table and return the result as a reference table. This method queries the table. It forms a `TaQL <../../doc/199.html>`_ command from the given arguments and executes it using the :func:`taql` function. The result is returned in a so-called reference table which references the selected columns and rows in the original table. Usually a reference table is temporary, but it can be made persistent by giving it a name. Note that a reference table is handled as any table, thus can be queried again. All arguments are optional, but at least one of `query`, `name`, `sortlist`, and `columns` should be used. See the `TaQL note <../../doc/199.html>`_ for the detailed description of the the arguments representing the various parts of a TaQL command. `query` The WHERE part of a TaQL command. `name` The name of the reference table if it is to be made persistent. `sortlist` The ORDERBY part of a TaQL command. It is a single string in which commas have to be used to separate sort keys. `columns` The columns to be selected (projection in data base terms). It is a single string in which commas have to be used to separate column names. Apart from column names, expressions can be given as well. `limit` If > 0, maximum number of rows to be selected. `offset` If > 0, ignore the first N matches. `style` The TaQL syntax style to be used (defaults to Python).
[ "Query", "the", "table", "and", "return", "the", "result", "as", "a", "reference", "table", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1651-L1709
24,512
casacore/python-casacore
casacore/tables/table.py
table.sort
def sort(self, sortlist, name='', limit=0, offset=0, style='Python'): """Sort the table and return the result as a reference table. This method sorts the table. It forms a `TaQL <../../doc/199.html>`_ command from the given arguments and executes it using the :func:`taql` function. The result is returned in a so-called reference table which references the columns and rows in the original table. Usually a reference table is temporary, but it can be made persistent by giving it a name. Note that a reference table is handled as any table, thus can be queried again. `sortlist` The ORDERBY part of a TaQL command. It is a single string in which commas have to be used to separate sort keys. A sort key can be the name of a column, but it can be an expression as well. `name` The name of the reference table if it is to be made persistent. `limit` If > 0, maximum number of rows to be selected after the sort step. It can, for instance, be used to select the N highest values. `offset` If > 0, ignore the first `offset` matches after the sort step. `style` The TaQL syntax style to be used (defaults to Python). """ command = 'select from $1 orderby ' + sortlist if limit > 0: command += ' limit %d' % limit if offset > 0: command += ' offset %d' % offset if name: command += ' giving ' + name return tablecommand(command, style, [self])
python
def sort(self, sortlist, name='', limit=0, offset=0, style='Python'): command = 'select from $1 orderby ' + sortlist if limit > 0: command += ' limit %d' % limit if offset > 0: command += ' offset %d' % offset if name: command += ' giving ' + name return tablecommand(command, style, [self])
[ "def", "sort", "(", "self", ",", "sortlist", ",", "name", "=", "''", ",", "limit", "=", "0", ",", "offset", "=", "0", ",", "style", "=", "'Python'", ")", ":", "command", "=", "'select from $1 orderby '", "+", "sortlist", "if", "limit", ">", "0", ":",...
Sort the table and return the result as a reference table. This method sorts the table. It forms a `TaQL <../../doc/199.html>`_ command from the given arguments and executes it using the :func:`taql` function. The result is returned in a so-called reference table which references the columns and rows in the original table. Usually a reference table is temporary, but it can be made persistent by giving it a name. Note that a reference table is handled as any table, thus can be queried again. `sortlist` The ORDERBY part of a TaQL command. It is a single string in which commas have to be used to separate sort keys. A sort key can be the name of a column, but it can be an expression as well. `name` The name of the reference table if it is to be made persistent. `limit` If > 0, maximum number of rows to be selected after the sort step. It can, for instance, be used to select the N highest values. `offset` If > 0, ignore the first `offset` matches after the sort step. `style` The TaQL syntax style to be used (defaults to Python).
[ "Sort", "the", "table", "and", "return", "the", "result", "as", "a", "reference", "table", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1711-L1747
24,513
casacore/python-casacore
casacore/tables/table.py
table.select
def select(self, columns, name='', style='Python'): """Select columns and return the result as a reference table. This method represents the SELECT part of a TaQL command using the given columns (or column expressions). It forms a `TaQL <../../doc/199.html>`_ command from the given arguments and executes it using the :func:`taql` function. The result is returned in a so-called reference table which references the columns and rows in the original table. Usually a reference table is temporary, but it can be made persistent by giving it a name. Note that a reference table is handled as any table, thus can be queried again. `columns` The columns to be selected (projection in data base terms). It is a single string in which commas have to be used to separate column names. Apart from column names, expressions can be given as well. `name` The name of the reference table if it is to be made persistent. `style` The TaQL syntax style to be used (defaults to Python). """ command = 'select ' + columns + ' from $1' if name: command += ' giving ' + name return tablecommand(command, style, [self])
python
def select(self, columns, name='', style='Python'): command = 'select ' + columns + ' from $1' if name: command += ' giving ' + name return tablecommand(command, style, [self])
[ "def", "select", "(", "self", ",", "columns", ",", "name", "=", "''", ",", "style", "=", "'Python'", ")", ":", "command", "=", "'select '", "+", "columns", "+", "' from $1'", "if", "name", ":", "command", "+=", "' giving '", "+", "name", "return", "tab...
Select columns and return the result as a reference table. This method represents the SELECT part of a TaQL command using the given columns (or column expressions). It forms a `TaQL <../../doc/199.html>`_ command from the given arguments and executes it using the :func:`taql` function. The result is returned in a so-called reference table which references the columns and rows in the original table. Usually a reference table is temporary, but it can be made persistent by giving it a name. Note that a reference table is handled as any table, thus can be queried again. `columns` The columns to be selected (projection in data base terms). It is a single string in which commas have to be used to separate column names. Apart from column names, expressions can be given as well. `name` The name of the reference table if it is to be made persistent. `style` The TaQL syntax style to be used (defaults to Python).
[ "Select", "columns", "and", "return", "the", "result", "as", "a", "reference", "table", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1749-L1776
24,514
casacore/python-casacore
casacore/tables/table.py
table.browse
def browse(self, wait=True, tempname="/tmp/seltable"): """ Browse a table using casabrowser or a simple wxwidget based browser. By default the casabrowser is used if it can be found (in your PATH). Otherwise the wxwidget one is used if wx can be loaded. The casabrowser can only browse tables that are persistent on disk. This gives problems for tables resulting from a query because they are held in memory only (unless an output table name was given). To make browsing of such tables possible, the argument `tempname` can be used to specify a table name that will be used to form a persistent table that can be browsed. Note that such a table is very small as it does not contain data, but only references to rows in the original table. The default for `tempname` is '/tmp/seltable'. If needed, the table can be deleted using the :func:`tabledelete` function. If `wait=False`, the casabrowser is started in the background. In that case the user should delete a possibly created copy of a temporary table. """ import os # Test if casabrowser can be found. # On OS-X 'which' always returns 0, so use test on top of it. # Nothing is written on stdout if not found. if os.system('test `which casabrowser`x != x') == 0: waitstr1 = "" waitstr2 = "foreground ..." if not wait: waitstr1 = " &" waitstr2 = "background ..." if self.iswritable(): six.print_("Flushing data and starting casabrowser in the " + waitstr2) else: six.print_("Starting casabrowser in the " + waitstr2) self.flush() self.unlock() if os.system('test -e ' + self.name() + '/table.dat') == 0: os.system('casabrowser ' + self.name() + waitstr1) elif len(tempname) > 0: six.print_(" making a persistent copy in table " + tempname) self.copy(tempname) os.system('casabrowser ' + tempname + waitstr1) if wait: from casacore.tables import tabledelete six.print_(" finished browsing") tabledelete(tempname) else: six.print_(" after browsing use tabledelete('" + tempname + "') to delete the copy") else: six.print_("Cannot browse because the table is in memory only") six.print_("You can browse a (shallow) persistent copy " + "of the table like: ") six.print_(" t.browse(True, '/tmp/tab1')") else: try: import wxPython except ImportError: six.print_('casabrowser nor wxPython can be found') return from wxPython.wx import wxPySimpleApp import sys app = wxPySimpleApp() from wxtablebrowser import CasaTestFrame frame = CasaTestFrame(None, sys.stdout, self) frame.Show(True) app.MainLoop()
python
def browse(self, wait=True, tempname="/tmp/seltable"): import os # Test if casabrowser can be found. # On OS-X 'which' always returns 0, so use test on top of it. # Nothing is written on stdout if not found. if os.system('test `which casabrowser`x != x') == 0: waitstr1 = "" waitstr2 = "foreground ..." if not wait: waitstr1 = " &" waitstr2 = "background ..." if self.iswritable(): six.print_("Flushing data and starting casabrowser in the " + waitstr2) else: six.print_("Starting casabrowser in the " + waitstr2) self.flush() self.unlock() if os.system('test -e ' + self.name() + '/table.dat') == 0: os.system('casabrowser ' + self.name() + waitstr1) elif len(tempname) > 0: six.print_(" making a persistent copy in table " + tempname) self.copy(tempname) os.system('casabrowser ' + tempname + waitstr1) if wait: from casacore.tables import tabledelete six.print_(" finished browsing") tabledelete(tempname) else: six.print_(" after browsing use tabledelete('" + tempname + "') to delete the copy") else: six.print_("Cannot browse because the table is in memory only") six.print_("You can browse a (shallow) persistent copy " + "of the table like: ") six.print_(" t.browse(True, '/tmp/tab1')") else: try: import wxPython except ImportError: six.print_('casabrowser nor wxPython can be found') return from wxPython.wx import wxPySimpleApp import sys app = wxPySimpleApp() from wxtablebrowser import CasaTestFrame frame = CasaTestFrame(None, sys.stdout, self) frame.Show(True) app.MainLoop()
[ "def", "browse", "(", "self", ",", "wait", "=", "True", ",", "tempname", "=", "\"/tmp/seltable\"", ")", ":", "import", "os", "# Test if casabrowser can be found.", "# On OS-X 'which' always returns 0, so use test on top of it.", "# Nothing is written on stdout if not found.", "...
Browse a table using casabrowser or a simple wxwidget based browser. By default the casabrowser is used if it can be found (in your PATH). Otherwise the wxwidget one is used if wx can be loaded. The casabrowser can only browse tables that are persistent on disk. This gives problems for tables resulting from a query because they are held in memory only (unless an output table name was given). To make browsing of such tables possible, the argument `tempname` can be used to specify a table name that will be used to form a persistent table that can be browsed. Note that such a table is very small as it does not contain data, but only references to rows in the original table. The default for `tempname` is '/tmp/seltable'. If needed, the table can be deleted using the :func:`tabledelete` function. If `wait=False`, the casabrowser is started in the background. In that case the user should delete a possibly created copy of a temporary table.
[ "Browse", "a", "table", "using", "casabrowser", "or", "a", "simple", "wxwidget", "based", "browser", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1797-L1871
24,515
casacore/python-casacore
casacore/tables/table.py
table.view
def view(self, wait=True, tempname="/tmp/seltable"): """ View a table using casaviewer, casabrowser, or wxwidget based browser. The table is viewed depending on the type: MeasurementSet is viewed using casaviewer. Image is viewed using casaviewer. other are browsed using the :func:`browse` function. If the casaviewer cannot be found, all tables are browsed. The casaviewer can only display tables that are persistent on disk. This gives problems for tables resulting from a query because they are held in memory only (unless an output table name was given). To make viewing of such tables possible, the argument `tempname` can be used to specify a table name that will be used to form a persistent table that can be browsed. Note that such a table is very small as it does not contain data, but only references to rows in the original table. The default for `tempname` is '/tmp/seltable'. If needed, the table can be deleted using the :func:`tabledelete` function. If `wait=False`, the casaviewer is started in the background. In that case the user should delete a possibly created copy of a temporary table. """ import os # Determine the table type. # Test if casaviewer can be found. # On OS-X 'which' always returns 0, so use test on top of it. viewed = False type = self.info()["type"] if type == "Measurement Set" or type == "Image": if os.system('test -x `which casaviewer` > /dev/null 2>&1') == 0: waitstr1 = "" waitstr2 = "foreground ..." if not wait: waitstr1 = " &" waitstr2 = "background ..." if self.iswritable(): six.print_("Flushing data and starting casaviewer " + "in the " + waitstr2) else: six.print_("Starting casaviewer in the " + waitstr2) self.flush() self.unlock() if os.system('test -e ' + self.name() + '/table.dat') == 0: os.system('casaviewer ' + self.name() + waitstr1) viewed = True elif len(tempname) > 0: six.print_(" making a persistent copy in table " + tempname) self.copy(tempname) os.system('casaviewer ' + tempname + waitstr1) viewed = True if wait: from casacore.tables import tabledelete six.print_(" finished viewing") tabledelete(tempname) else: six.print_(" after viewing use tabledelete('" + tempname + "') to delete the copy") else: six.print_("Cannot browse because the table is " + "in memory only.") six.print_("You can browse a (shallow) persistent " + "copy of the table like:") six.print_(" t.view(True, '/tmp/tab1')") # Could not view the table, so browse it. if not viewed: self.browse(wait, tempname)
python
def view(self, wait=True, tempname="/tmp/seltable"): import os # Determine the table type. # Test if casaviewer can be found. # On OS-X 'which' always returns 0, so use test on top of it. viewed = False type = self.info()["type"] if type == "Measurement Set" or type == "Image": if os.system('test -x `which casaviewer` > /dev/null 2>&1') == 0: waitstr1 = "" waitstr2 = "foreground ..." if not wait: waitstr1 = " &" waitstr2 = "background ..." if self.iswritable(): six.print_("Flushing data and starting casaviewer " + "in the " + waitstr2) else: six.print_("Starting casaviewer in the " + waitstr2) self.flush() self.unlock() if os.system('test -e ' + self.name() + '/table.dat') == 0: os.system('casaviewer ' + self.name() + waitstr1) viewed = True elif len(tempname) > 0: six.print_(" making a persistent copy in table " + tempname) self.copy(tempname) os.system('casaviewer ' + tempname + waitstr1) viewed = True if wait: from casacore.tables import tabledelete six.print_(" finished viewing") tabledelete(tempname) else: six.print_(" after viewing use tabledelete('" + tempname + "') to delete the copy") else: six.print_("Cannot browse because the table is " + "in memory only.") six.print_("You can browse a (shallow) persistent " + "copy of the table like:") six.print_(" t.view(True, '/tmp/tab1')") # Could not view the table, so browse it. if not viewed: self.browse(wait, tempname)
[ "def", "view", "(", "self", ",", "wait", "=", "True", ",", "tempname", "=", "\"/tmp/seltable\"", ")", ":", "import", "os", "# Determine the table type.", "# Test if casaviewer can be found.", "# On OS-X 'which' always returns 0, so use test on top of it.", "viewed", "=", "F...
View a table using casaviewer, casabrowser, or wxwidget based browser. The table is viewed depending on the type: MeasurementSet is viewed using casaviewer. Image is viewed using casaviewer. other are browsed using the :func:`browse` function. If the casaviewer cannot be found, all tables are browsed. The casaviewer can only display tables that are persistent on disk. This gives problems for tables resulting from a query because they are held in memory only (unless an output table name was given). To make viewing of such tables possible, the argument `tempname` can be used to specify a table name that will be used to form a persistent table that can be browsed. Note that such a table is very small as it does not contain data, but only references to rows in the original table. The default for `tempname` is '/tmp/seltable'. If needed, the table can be deleted using the :func:`tabledelete` function. If `wait=False`, the casaviewer is started in the background. In that case the user should delete a possibly created copy of a temporary table.
[ "View", "a", "table", "using", "casaviewer", "casabrowser", "or", "wxwidget", "based", "browser", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1873-L1950
24,516
casacore/python-casacore
casacore/tables/table.py
table._repr_html_
def _repr_html_(self): """Give a nice representation of tables in notebooks.""" out = "<table class='taqltable' style='overflow-x:auto'>\n" # Print column names (not if they are all auto-generated) if not(all([colname[:4] == "Col_" for colname in self.colnames()])): out += "<tr>" for colname in self.colnames(): out += "<th><b>"+colname+"</b></th>" out += "</tr>" cropped = False rowcount = 0 for row in self: rowout = _format_row(row, self.colnames(), self) rowcount += 1 out += rowout if "\n" in rowout: # Double space after multiline rows out += "\n" out += "\n" if rowcount >= 20: cropped = True break if out[-2:] == "\n\n": out = out[:-1] out += "</table>" if cropped: out += ("<p style='text-align:center'>(" + str(self.nrows()-20)+" more rows)</p>\n") return out
python
def _repr_html_(self): out = "<table class='taqltable' style='overflow-x:auto'>\n" # Print column names (not if they are all auto-generated) if not(all([colname[:4] == "Col_" for colname in self.colnames()])): out += "<tr>" for colname in self.colnames(): out += "<th><b>"+colname+"</b></th>" out += "</tr>" cropped = False rowcount = 0 for row in self: rowout = _format_row(row, self.colnames(), self) rowcount += 1 out += rowout if "\n" in rowout: # Double space after multiline rows out += "\n" out += "\n" if rowcount >= 20: cropped = True break if out[-2:] == "\n\n": out = out[:-1] out += "</table>" if cropped: out += ("<p style='text-align:center'>(" + str(self.nrows()-20)+" more rows)</p>\n") return out
[ "def", "_repr_html_", "(", "self", ")", ":", "out", "=", "\"<table class='taqltable' style='overflow-x:auto'>\\n\"", "# Print column names (not if they are all auto-generated)", "if", "not", "(", "all", "(", "[", "colname", "[", ":", "4", "]", "==", "\"Col_\"", "for", ...
Give a nice representation of tables in notebooks.
[ "Give", "a", "nice", "representation", "of", "tables", "in", "notebooks", "." ]
975510861ea005f7919dd9e438b5f98a1682eebe
https://github.com/casacore/python-casacore/blob/975510861ea005f7919dd9e438b5f98a1682eebe/casacore/tables/table.py#L1952-L1985
24,517
Kronuz/pyScss
scss/extension/core.py
nth
def nth(lst, n): """Return the nth item in the list.""" expect_type(n, (String, Number), unit=None) if isinstance(n, String): if n.value.lower() == 'first': i = 0 elif n.value.lower() == 'last': i = -1 else: raise ValueError("Invalid index %r" % (n,)) else: # DEVIATION: nth treats lists as circular lists i = n.to_python_index(len(lst), circular=True) return lst[i]
python
def nth(lst, n): expect_type(n, (String, Number), unit=None) if isinstance(n, String): if n.value.lower() == 'first': i = 0 elif n.value.lower() == 'last': i = -1 else: raise ValueError("Invalid index %r" % (n,)) else: # DEVIATION: nth treats lists as circular lists i = n.to_python_index(len(lst), circular=True) return lst[i]
[ "def", "nth", "(", "lst", ",", "n", ")", ":", "expect_type", "(", "n", ",", "(", "String", ",", "Number", ")", ",", "unit", "=", "None", ")", "if", "isinstance", "(", "n", ",", "String", ")", ":", "if", "n", ".", "value", ".", "lower", "(", "...
Return the nth item in the list.
[ "Return", "the", "nth", "item", "in", "the", "list", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/extension/core.py#L657-L672
24,518
Kronuz/pyScss
scss/extension/core.py
CoreExtension.handle_import
def handle_import(self, name, compilation, rule): """Implementation of the core Sass import mechanism, which just looks for files on disk. """ # TODO this is all not terribly well-specified by Sass. at worst, # it's unclear how far "upwards" we should be allowed to go. but i'm # also a little fuzzy on e.g. how relative imports work from within a # file that's not actually in the search path. # TODO i think with the new origin semantics, i've made it possible to # import relative to the current file even if the current file isn't # anywhere in the search path. is that right? path = PurePosixPath(name) search_exts = list(compilation.compiler.dynamic_extensions) if path.suffix and path.suffix in search_exts: basename = path.stem else: basename = path.name relative_to = path.parent search_path = [] # tuple of (origin, start_from) if relative_to.is_absolute(): relative_to = PurePosixPath(*relative_to.parts[1:]) elif rule.source_file.origin: # Search relative to the current file first, only if not doing an # absolute import search_path.append(( rule.source_file.origin, rule.source_file.relpath.parent / relative_to, )) search_path.extend( (origin, relative_to) for origin in compilation.compiler.search_path ) for prefix, suffix in product(('_', ''), search_exts): filename = prefix + basename + suffix for origin, relative_to in search_path: relpath = relative_to / filename # Lexically (ignoring symlinks!) eliminate .. from the part # of the path that exists within Sass-space. pathlib # deliberately doesn't do this, but os.path does. relpath = PurePosixPath(os.path.normpath(str(relpath))) if rule.source_file.key == (origin, relpath): # Avoid self-import # TODO is this what ruby does? continue path = origin / relpath if not path.exists(): continue # All good! # TODO if this file has already been imported, we'll do the # source preparation twice. make it lazy. return SourceFile.read(origin, relpath)
python
def handle_import(self, name, compilation, rule): # TODO this is all not terribly well-specified by Sass. at worst, # it's unclear how far "upwards" we should be allowed to go. but i'm # also a little fuzzy on e.g. how relative imports work from within a # file that's not actually in the search path. # TODO i think with the new origin semantics, i've made it possible to # import relative to the current file even if the current file isn't # anywhere in the search path. is that right? path = PurePosixPath(name) search_exts = list(compilation.compiler.dynamic_extensions) if path.suffix and path.suffix in search_exts: basename = path.stem else: basename = path.name relative_to = path.parent search_path = [] # tuple of (origin, start_from) if relative_to.is_absolute(): relative_to = PurePosixPath(*relative_to.parts[1:]) elif rule.source_file.origin: # Search relative to the current file first, only if not doing an # absolute import search_path.append(( rule.source_file.origin, rule.source_file.relpath.parent / relative_to, )) search_path.extend( (origin, relative_to) for origin in compilation.compiler.search_path ) for prefix, suffix in product(('_', ''), search_exts): filename = prefix + basename + suffix for origin, relative_to in search_path: relpath = relative_to / filename # Lexically (ignoring symlinks!) eliminate .. from the part # of the path that exists within Sass-space. pathlib # deliberately doesn't do this, but os.path does. relpath = PurePosixPath(os.path.normpath(str(relpath))) if rule.source_file.key == (origin, relpath): # Avoid self-import # TODO is this what ruby does? continue path = origin / relpath if not path.exists(): continue # All good! # TODO if this file has already been imported, we'll do the # source preparation twice. make it lazy. return SourceFile.read(origin, relpath)
[ "def", "handle_import", "(", "self", ",", "name", ",", "compilation", ",", "rule", ")", ":", "# TODO this is all not terribly well-specified by Sass. at worst,", "# it's unclear how far \"upwards\" we should be allowed to go. but i'm", "# also a little fuzzy on e.g. how relative import...
Implementation of the core Sass import mechanism, which just looks for files on disk.
[ "Implementation", "of", "the", "core", "Sass", "import", "mechanism", "which", "just", "looks", "for", "files", "on", "disk", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/extension/core.py#L25-L80
24,519
Kronuz/pyScss
yapps2.py
print_error
def print_error(input, err, scanner): """This is a really dumb long function to print error messages nicely.""" p = err.pos # Figure out the line number line = input[:p].count('\n') print err.msg + " on line " + repr(line + 1) + ":" # Now try printing part of the line text = input[max(p - 80, 0): p + 80] p = p - max(p - 80, 0) # Strip to the left i = text[:p].rfind('\n') j = text[:p].rfind('\r') if i < 0 or (0 <= j < i): i = j if 0 <= i < p: p = p - i - 1 text = text[i + 1:] # Strip to the right i = text.find('\n', p) j = text.find('\r', p) if i < 0 or (0 <= j < i): i = j if i >= 0: text = text[:i] # Now shorten the text while len(text) > 70 and p > 60: # Cut off 10 chars text = "..." + text[10:] p = p - 7 # Now print the string, along with an indicator print '> ', text print '> ', ' ' * p + '^' print 'List of nearby tokens:', scanner
python
def print_error(input, err, scanner): p = err.pos # Figure out the line number line = input[:p].count('\n') print err.msg + " on line " + repr(line + 1) + ":" # Now try printing part of the line text = input[max(p - 80, 0): p + 80] p = p - max(p - 80, 0) # Strip to the left i = text[:p].rfind('\n') j = text[:p].rfind('\r') if i < 0 or (0 <= j < i): i = j if 0 <= i < p: p = p - i - 1 text = text[i + 1:] # Strip to the right i = text.find('\n', p) j = text.find('\r', p) if i < 0 or (0 <= j < i): i = j if i >= 0: text = text[:i] # Now shorten the text while len(text) > 70 and p > 60: # Cut off 10 chars text = "..." + text[10:] p = p - 7 # Now print the string, along with an indicator print '> ', text print '> ', ' ' * p + '^' print 'List of nearby tokens:', scanner
[ "def", "print_error", "(", "input", ",", "err", ",", "scanner", ")", ":", "p", "=", "err", ".", "pos", "# Figure out the line number", "line", "=", "input", "[", ":", "p", "]", ".", "count", "(", "'\\n'", ")", "print", "err", ".", "msg", "+", "\" on ...
This is a really dumb long function to print error messages nicely.
[ "This", "is", "a", "really", "dumb", "long", "function", "to", "print", "error", "messages", "nicely", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/yapps2.py#L892-L929
24,520
Kronuz/pyScss
yapps2.py
Generator.equal_set
def equal_set(self, a, b): "See if a and b have the same elements" if len(a) != len(b): return 0 if a == b: return 1 return self.subset(a, b) and self.subset(b, a)
python
def equal_set(self, a, b): "See if a and b have the same elements" if len(a) != len(b): return 0 if a == b: return 1 return self.subset(a, b) and self.subset(b, a)
[ "def", "equal_set", "(", "self", ",", "a", ",", "b", ")", ":", "if", "len", "(", "a", ")", "!=", "len", "(", "b", ")", ":", "return", "0", "if", "a", "==", "b", ":", "return", "1", "return", "self", ".", "subset", "(", "a", ",", "b", ")", ...
See if a and b have the same elements
[ "See", "if", "a", "and", "b", "have", "the", "same", "elements" ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/yapps2.py#L111-L117
24,521
Kronuz/pyScss
yapps2.py
Generator.add_to
def add_to(self, parent, additions): "Modify parent to include all elements in additions" for x in additions: if x not in parent: parent.append(x) self.changed()
python
def add_to(self, parent, additions): "Modify parent to include all elements in additions" for x in additions: if x not in parent: parent.append(x) self.changed()
[ "def", "add_to", "(", "self", ",", "parent", ",", "additions", ")", ":", "for", "x", "in", "additions", ":", "if", "x", "not", "in", "parent", ":", "parent", ".", "append", "(", "x", ")", "self", ".", "changed", "(", ")" ]
Modify parent to include all elements in additions
[ "Modify", "parent", "to", "include", "all", "elements", "in", "additions" ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/yapps2.py#L119-L124
24,522
Kronuz/pyScss
scss/namespace.py
Namespace.declare_alias
def declare_alias(self, name): """Insert a Python function into this Namespace with an explicitly-given name, but detect its argument count automatically. """ def decorator(f): self._auto_register_function(f, name) return f return decorator
python
def declare_alias(self, name): def decorator(f): self._auto_register_function(f, name) return f return decorator
[ "def", "declare_alias", "(", "self", ",", "name", ")", ":", "def", "decorator", "(", "f", ")", ":", "self", ".", "_auto_register_function", "(", "f", ",", "name", ")", "return", "f", "return", "decorator" ]
Insert a Python function into this Namespace with an explicitly-given name, but detect its argument count automatically.
[ "Insert", "a", "Python", "function", "into", "this", "Namespace", "with", "an", "explicitly", "-", "given", "name", "but", "detect", "its", "argument", "count", "automatically", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/namespace.py#L150-L158
24,523
Kronuz/pyScss
scss/util.py
tmemoize.collect
def collect(self): """Clear cache of results which have timed out""" for func in self._caches: cache = {} for key in self._caches[func]: if (time.time() - self._caches[func][key][1]) < self._timeouts[func]: cache[key] = self._caches[func][key] self._caches[func] = cache
python
def collect(self): for func in self._caches: cache = {} for key in self._caches[func]: if (time.time() - self._caches[func][key][1]) < self._timeouts[func]: cache[key] = self._caches[func][key] self._caches[func] = cache
[ "def", "collect", "(", "self", ")", ":", "for", "func", "in", "self", ".", "_caches", ":", "cache", "=", "{", "}", "for", "key", "in", "self", ".", "_caches", "[", "func", "]", ":", "if", "(", "time", ".", "time", "(", ")", "-", "self", ".", ...
Clear cache of results which have timed out
[ "Clear", "cache", "of", "results", "which", "have", "timed", "out" ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/util.py#L206-L213
24,524
Kronuz/pyScss
scss/rule.py
extend_unique
def extend_unique(seq, more): """Return a new sequence containing the items in `seq` plus any items in `more` that aren't already in `seq`, preserving the order of both. """ seen = set(seq) new = [] for item in more: if item not in seen: seen.add(item) new.append(item) return seq + type(seq)(new)
python
def extend_unique(seq, more): seen = set(seq) new = [] for item in more: if item not in seen: seen.add(item) new.append(item) return seq + type(seq)(new)
[ "def", "extend_unique", "(", "seq", ",", "more", ")", ":", "seen", "=", "set", "(", "seq", ")", "new", "=", "[", "]", "for", "item", "in", "more", ":", "if", "item", "not", "in", "seen", ":", "seen", ".", "add", "(", "item", ")", "new", ".", ...
Return a new sequence containing the items in `seq` plus any items in `more` that aren't already in `seq`, preserving the order of both.
[ "Return", "a", "new", "sequence", "containing", "the", "items", "in", "seq", "plus", "any", "items", "in", "more", "that", "aren", "t", "already", "in", "seq", "preserving", "the", "order", "of", "both", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/rule.py#L17-L28
24,525
Kronuz/pyScss
scss/rule.py
RuleAncestry.with_more_selectors
def with_more_selectors(self, selectors): """Return a new ancestry that also matches the given selectors. No nesting is done. """ if self.headers and self.headers[-1].is_selector: new_selectors = extend_unique( self.headers[-1].selectors, selectors) new_headers = self.headers[:-1] + ( BlockSelectorHeader(new_selectors),) return RuleAncestry(new_headers) else: new_headers = self.headers + (BlockSelectorHeader(selectors),) return RuleAncestry(new_headers)
python
def with_more_selectors(self, selectors): if self.headers and self.headers[-1].is_selector: new_selectors = extend_unique( self.headers[-1].selectors, selectors) new_headers = self.headers[:-1] + ( BlockSelectorHeader(new_selectors),) return RuleAncestry(new_headers) else: new_headers = self.headers + (BlockSelectorHeader(selectors),) return RuleAncestry(new_headers)
[ "def", "with_more_selectors", "(", "self", ",", "selectors", ")", ":", "if", "self", ".", "headers", "and", "self", ".", "headers", "[", "-", "1", "]", ".", "is_selector", ":", "new_selectors", "=", "extend_unique", "(", "self", ".", "headers", "[", "-",...
Return a new ancestry that also matches the given selectors. No nesting is done.
[ "Return", "a", "new", "ancestry", "that", "also", "matches", "the", "given", "selectors", ".", "No", "nesting", "is", "done", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/rule.py#L194-L207
24,526
Kronuz/pyScss
scss/calculator.py
Calculator.parse_interpolations
def parse_interpolations(self, string): """Parse a string for interpolations, but don't treat anything else as Sass syntax. Returns an AST node. """ # Shortcut: if there are no #s in the string in the first place, it # must not have any interpolations, right? if '#' not in string: return Literal(String.unquoted(string)) return self.parse_expression(string, 'goal_interpolated_literal')
python
def parse_interpolations(self, string): # Shortcut: if there are no #s in the string in the first place, it # must not have any interpolations, right? if '#' not in string: return Literal(String.unquoted(string)) return self.parse_expression(string, 'goal_interpolated_literal')
[ "def", "parse_interpolations", "(", "self", ",", "string", ")", ":", "# Shortcut: if there are no #s in the string in the first place, it", "# must not have any interpolations, right?", "if", "'#'", "not", "in", "string", ":", "return", "Literal", "(", "String", ".", "unquo...
Parse a string for interpolations, but don't treat anything else as Sass syntax. Returns an AST node.
[ "Parse", "a", "string", "for", "interpolations", "but", "don", "t", "treat", "anything", "else", "as", "Sass", "syntax", ".", "Returns", "an", "AST", "node", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/calculator.py#L174-L182
24,527
Kronuz/pyScss
scss/calculator.py
Calculator.parse_vars_and_interpolations
def parse_vars_and_interpolations(self, string): """Parse a string for variables and interpolations, but don't treat anything else as Sass syntax. Returns an AST node. """ # Shortcut: if there are no #s or $s in the string in the first place, # it must not have anything of interest. if '#' not in string and '$' not in string: return Literal(String.unquoted(string)) return self.parse_expression( string, 'goal_interpolated_literal_with_vars')
python
def parse_vars_and_interpolations(self, string): # Shortcut: if there are no #s or $s in the string in the first place, # it must not have anything of interest. if '#' not in string and '$' not in string: return Literal(String.unquoted(string)) return self.parse_expression( string, 'goal_interpolated_literal_with_vars')
[ "def", "parse_vars_and_interpolations", "(", "self", ",", "string", ")", ":", "# Shortcut: if there are no #s or $s in the string in the first place,", "# it must not have anything of interest.", "if", "'#'", "not", "in", "string", "and", "'$'", "not", "in", "string", ":", ...
Parse a string for variables and interpolations, but don't treat anything else as Sass syntax. Returns an AST node.
[ "Parse", "a", "string", "for", "variables", "and", "interpolations", "but", "don", "t", "treat", "anything", "else", "as", "Sass", "syntax", ".", "Returns", "an", "AST", "node", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/calculator.py#L184-L193
24,528
Kronuz/pyScss
scss/extension/compass/helpers.py
reject
def reject(lst, *values): """Removes the given values from the list""" lst = List.from_maybe(lst) values = frozenset(List.from_maybe_starargs(values)) ret = [] for item in lst: if item not in values: ret.append(item) return List(ret, use_comma=lst.use_comma)
python
def reject(lst, *values): lst = List.from_maybe(lst) values = frozenset(List.from_maybe_starargs(values)) ret = [] for item in lst: if item not in values: ret.append(item) return List(ret, use_comma=lst.use_comma)
[ "def", "reject", "(", "lst", ",", "*", "values", ")", ":", "lst", "=", "List", ".", "from_maybe", "(", "lst", ")", "values", "=", "frozenset", "(", "List", ".", "from_maybe_starargs", "(", "values", ")", ")", "ret", "=", "[", "]", "for", "item", "i...
Removes the given values from the list
[ "Removes", "the", "given", "values", "from", "the", "list" ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/extension/compass/helpers.py#L87-L96
24,529
Kronuz/pyScss
scss/errors.py
add_error_marker
def add_error_marker(text, position, start_line=1): """Add a caret marking a given position in a string of input. Returns (new_text, caret_line). """ indent = " " lines = [] caret_line = start_line for line in text.split("\n"): lines.append(indent + line) if 0 <= position <= len(line): lines.append(indent + (" " * position) + "^") caret_line = start_line position -= len(line) position -= 1 # for the newline start_line += 1 return "\n".join(lines), caret_line
python
def add_error_marker(text, position, start_line=1): indent = " " lines = [] caret_line = start_line for line in text.split("\n"): lines.append(indent + line) if 0 <= position <= len(line): lines.append(indent + (" " * position) + "^") caret_line = start_line position -= len(line) position -= 1 # for the newline start_line += 1 return "\n".join(lines), caret_line
[ "def", "add_error_marker", "(", "text", ",", "position", ",", "start_line", "=", "1", ")", ":", "indent", "=", "\" \"", "lines", "=", "[", "]", "caret_line", "=", "start_line", "for", "line", "in", "text", ".", "split", "(", "\"\\n\"", ")", ":", "li...
Add a caret marking a given position in a string of input. Returns (new_text, caret_line).
[ "Add", "a", "caret", "marking", "a", "given", "position", "in", "a", "string", "of", "input", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/errors.py#L34-L53
24,530
Kronuz/pyScss
scss/errors.py
SassBaseError.format_sass_stack
def format_sass_stack(self): """Return a "traceback" of Sass imports.""" if not self.rule_stack: return "" ret = ["on ", self.format_file_and_line(self.rule_stack[0]), "\n"] last_file = self.rule_stack[0].source_file # TODO this could go away if rules knew their import chains... # TODO this doesn't mention mixins or function calls. really need to # track the call stack better. atm we skip other calls in the same # file because most of them are just nesting, but they might not be! # TODO the line number is wrong here for @imports, because we don't # have access to the UnparsedBlock representing the import! # TODO @content is completely broken; it's basically textual inclusion for rule in self.rule_stack[1:]: if rule.source_file is not last_file: ret.extend(( "imported from ", self.format_file_and_line(rule), "\n")) last_file = rule.source_file return "".join(ret)
python
def format_sass_stack(self): if not self.rule_stack: return "" ret = ["on ", self.format_file_and_line(self.rule_stack[0]), "\n"] last_file = self.rule_stack[0].source_file # TODO this could go away if rules knew their import chains... # TODO this doesn't mention mixins or function calls. really need to # track the call stack better. atm we skip other calls in the same # file because most of them are just nesting, but they might not be! # TODO the line number is wrong here for @imports, because we don't # have access to the UnparsedBlock representing the import! # TODO @content is completely broken; it's basically textual inclusion for rule in self.rule_stack[1:]: if rule.source_file is not last_file: ret.extend(( "imported from ", self.format_file_and_line(rule), "\n")) last_file = rule.source_file return "".join(ret)
[ "def", "format_sass_stack", "(", "self", ")", ":", "if", "not", "self", ".", "rule_stack", ":", "return", "\"\"", "ret", "=", "[", "\"on \"", ",", "self", ".", "format_file_and_line", "(", "self", ".", "rule_stack", "[", "0", "]", ")", ",", "\"\\n\"", ...
Return a "traceback" of Sass imports.
[ "Return", "a", "traceback", "of", "Sass", "imports", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/errors.py#L80-L101
24,531
Kronuz/pyScss
scss/errors.py
SassError.format_python_stack
def format_python_stack(self): """Return a traceback of Python frames, from where the error occurred to where it was first caught and wrapped. """ ret = ["Traceback:\n"] ret.extend(traceback.format_tb(self.original_traceback)) return "".join(ret)
python
def format_python_stack(self): ret = ["Traceback:\n"] ret.extend(traceback.format_tb(self.original_traceback)) return "".join(ret)
[ "def", "format_python_stack", "(", "self", ")", ":", "ret", "=", "[", "\"Traceback:\\n\"", "]", "ret", ".", "extend", "(", "traceback", ".", "format_tb", "(", "self", ".", "original_traceback", ")", ")", "return", "\"\"", ".", "join", "(", "ret", ")" ]
Return a traceback of Python frames, from where the error occurred to where it was first caught and wrapped.
[ "Return", "a", "traceback", "of", "Python", "frames", "from", "where", "the", "error", "occurred", "to", "where", "it", "was", "first", "caught", "and", "wrapped", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/errors.py#L217-L223
24,532
Kronuz/pyScss
scss/errors.py
SassError.to_css
def to_css(self): """Return a stylesheet that will show the wrapped error at the top of the browser window. """ # TODO should this include the traceback? any security concerns? prefix = self.format_prefix() original_error = self.format_original_error() sass_stack = self.format_sass_stack() message = prefix + "\n" + sass_stack + original_error # Super simple escaping: only quotes and newlines are illegal in css # strings message = message.replace('\\', '\\\\') message = message.replace('"', '\\"') # use the maximum six digits here so it doesn't eat any following # characters that happen to look like hex message = message.replace('\n', '\\00000A') return BROWSER_ERROR_TEMPLATE.format('"' + message + '"')
python
def to_css(self): # TODO should this include the traceback? any security concerns? prefix = self.format_prefix() original_error = self.format_original_error() sass_stack = self.format_sass_stack() message = prefix + "\n" + sass_stack + original_error # Super simple escaping: only quotes and newlines are illegal in css # strings message = message.replace('\\', '\\\\') message = message.replace('"', '\\"') # use the maximum six digits here so it doesn't eat any following # characters that happen to look like hex message = message.replace('\n', '\\00000A') return BROWSER_ERROR_TEMPLATE.format('"' + message + '"')
[ "def", "to_css", "(", "self", ")", ":", "# TODO should this include the traceback? any security concerns?", "prefix", "=", "self", ".", "format_prefix", "(", ")", "original_error", "=", "self", ".", "format_original_error", "(", ")", "sass_stack", "=", "self", ".", ...
Return a stylesheet that will show the wrapped error at the top of the browser window.
[ "Return", "a", "stylesheet", "that", "will", "show", "the", "wrapped", "error", "at", "the", "top", "of", "the", "browser", "window", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/errors.py#L249-L268
24,533
Kronuz/pyScss
scss/compiler.py
compile_string
def compile_string(string, compiler_class=Compiler, **kwargs): """Compile a single string, and return a string of CSS. Keyword arguments are passed along to the underlying `Compiler`. """ compiler = compiler_class(**kwargs) return compiler.compile_string(string)
python
def compile_string(string, compiler_class=Compiler, **kwargs): compiler = compiler_class(**kwargs) return compiler.compile_string(string)
[ "def", "compile_string", "(", "string", ",", "compiler_class", "=", "Compiler", ",", "*", "*", "kwargs", ")", ":", "compiler", "=", "compiler_class", "(", "*", "*", "kwargs", ")", "return", "compiler", ".", "compile_string", "(", "string", ")" ]
Compile a single string, and return a string of CSS. Keyword arguments are passed along to the underlying `Compiler`.
[ "Compile", "a", "single", "string", "and", "return", "a", "string", "of", "CSS", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/compiler.py#L240-L246
24,534
Kronuz/pyScss
scss/compiler.py
Compilation.parse_selectors
def parse_selectors(self, raw_selectors): """ Parses out the old xCSS "foo extends bar" syntax. Returns a 2-tuple: a set of selectors, and a set of extended selectors. """ # Fix tabs and spaces in selectors raw_selectors = _spaces_re.sub(' ', raw_selectors) parts = _xcss_extends_re.split(raw_selectors, 1) # handle old xCSS extends if len(parts) > 1: unparsed_selectors, unsplit_parents = parts # Multiple `extends` are delimited by `&` unparsed_parents = unsplit_parents.split('&') else: unparsed_selectors, = parts unparsed_parents = () selectors = Selector.parse_many(unparsed_selectors) parents = [Selector.parse_one(parent) for parent in unparsed_parents] return selectors, parents
python
def parse_selectors(self, raw_selectors): # Fix tabs and spaces in selectors raw_selectors = _spaces_re.sub(' ', raw_selectors) parts = _xcss_extends_re.split(raw_selectors, 1) # handle old xCSS extends if len(parts) > 1: unparsed_selectors, unsplit_parents = parts # Multiple `extends` are delimited by `&` unparsed_parents = unsplit_parents.split('&') else: unparsed_selectors, = parts unparsed_parents = () selectors = Selector.parse_many(unparsed_selectors) parents = [Selector.parse_one(parent) for parent in unparsed_parents] return selectors, parents
[ "def", "parse_selectors", "(", "self", ",", "raw_selectors", ")", ":", "# Fix tabs and spaces in selectors", "raw_selectors", "=", "_spaces_re", ".", "sub", "(", "' '", ",", "raw_selectors", ")", "parts", "=", "_xcss_extends_re", ".", "split", "(", "raw_selectors", ...
Parses out the old xCSS "foo extends bar" syntax. Returns a 2-tuple: a set of selectors, and a set of extended selectors.
[ "Parses", "out", "the", "old", "xCSS", "foo", "extends", "bar", "syntax", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/compiler.py#L308-L329
24,535
Kronuz/pyScss
scss/compiler.py
Compilation._get_properties
def _get_properties(self, rule, scope, block): """ Implements properties and variables extraction and assignment """ prop, raw_value = (_prop_split_re.split(block.prop, 1) + [None])[:2] if raw_value is not None: raw_value = raw_value.strip() try: is_var = (block.prop[len(prop)] == '=') except IndexError: is_var = False if is_var: warn_deprecated(rule, "Assignment with = is deprecated; use : instead.") calculator = self._make_calculator(rule.namespace) prop = prop.strip() prop = calculator.do_glob_math(prop) if not prop: return _prop = (scope or '') + prop if is_var or prop.startswith('$') and raw_value is not None: # Pop off any flags: !default, !global is_default = False is_global = True # eventually sass will default this to false while True: splits = raw_value.rsplit(None, 1) if len(splits) < 2 or not splits[1].startswith('!'): break raw_value, flag = splits if flag == '!default': is_default = True elif flag == '!global': is_global = True else: raise ValueError("Unrecognized flag: {0}".format(flag)) # Variable assignment _prop = normalize_var(_prop) try: existing_value = rule.namespace.variable(_prop) except KeyError: existing_value = None is_defined = existing_value is not None and not existing_value.is_null if is_default and is_defined: pass else: if is_defined and prop.startswith('$') and prop[1].isupper(): log.warn("Constant %r redefined", prop) # Variable assignment is an expression, so it always performs # real division value = calculator.calculate(raw_value, divide=True) rule.namespace.set_variable( _prop, value, local_only=not is_global) else: # Regular property destined for output _prop = calculator.apply_vars(_prop) if raw_value is None: value = None else: value = calculator.calculate(raw_value) if value is None: pass elif isinstance(value, six.string_types): # TODO kill this branch pass else: if value.is_null: return style = rule.legacy_compiler_options.get( 'style', self.compiler.output_style) compress = style == 'compressed' value = value.render(compress=compress) rule.properties.append((_prop, value))
python
def _get_properties(self, rule, scope, block): prop, raw_value = (_prop_split_re.split(block.prop, 1) + [None])[:2] if raw_value is not None: raw_value = raw_value.strip() try: is_var = (block.prop[len(prop)] == '=') except IndexError: is_var = False if is_var: warn_deprecated(rule, "Assignment with = is deprecated; use : instead.") calculator = self._make_calculator(rule.namespace) prop = prop.strip() prop = calculator.do_glob_math(prop) if not prop: return _prop = (scope or '') + prop if is_var or prop.startswith('$') and raw_value is not None: # Pop off any flags: !default, !global is_default = False is_global = True # eventually sass will default this to false while True: splits = raw_value.rsplit(None, 1) if len(splits) < 2 or not splits[1].startswith('!'): break raw_value, flag = splits if flag == '!default': is_default = True elif flag == '!global': is_global = True else: raise ValueError("Unrecognized flag: {0}".format(flag)) # Variable assignment _prop = normalize_var(_prop) try: existing_value = rule.namespace.variable(_prop) except KeyError: existing_value = None is_defined = existing_value is not None and not existing_value.is_null if is_default and is_defined: pass else: if is_defined and prop.startswith('$') and prop[1].isupper(): log.warn("Constant %r redefined", prop) # Variable assignment is an expression, so it always performs # real division value = calculator.calculate(raw_value, divide=True) rule.namespace.set_variable( _prop, value, local_only=not is_global) else: # Regular property destined for output _prop = calculator.apply_vars(_prop) if raw_value is None: value = None else: value = calculator.calculate(raw_value) if value is None: pass elif isinstance(value, six.string_types): # TODO kill this branch pass else: if value.is_null: return style = rule.legacy_compiler_options.get( 'style', self.compiler.output_style) compress = style == 'compressed' value = value.render(compress=compress) rule.properties.append((_prop, value))
[ "def", "_get_properties", "(", "self", ",", "rule", ",", "scope", ",", "block", ")", ":", "prop", ",", "raw_value", "=", "(", "_prop_split_re", ".", "split", "(", "block", ".", "prop", ",", "1", ")", "+", "[", "None", "]", ")", "[", ":", "2", "]"...
Implements properties and variables extraction and assignment
[ "Implements", "properties", "and", "variables", "extraction", "and", "assignment" ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/compiler.py#L1027-L1105
24,536
Kronuz/pyScss
scss/types.py
_constrain
def _constrain(value, lb=0, ub=1): """Helper for Color constructors. Constrains a value to a range.""" if value < lb: return lb elif value > ub: return ub else: return value
python
def _constrain(value, lb=0, ub=1): if value < lb: return lb elif value > ub: return ub else: return value
[ "def", "_constrain", "(", "value", ",", "lb", "=", "0", ",", "ub", "=", "1", ")", ":", "if", "value", "<", "lb", ":", "return", "lb", "elif", "value", ">", "ub", ":", "return", "ub", "else", ":", "return", "value" ]
Helper for Color constructors. Constrains a value to a range.
[ "Helper", "for", "Color", "constructors", ".", "Constrains", "a", "value", "to", "a", "range", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L808-L815
24,537
Kronuz/pyScss
scss/types.py
Number._add_sub
def _add_sub(self, other, op): """Implements both addition and subtraction.""" if not isinstance(other, Number): return NotImplemented # If either side is unitless, inherit the other side's units. Skip all # the rest of the conversion math, too. if self.is_unitless or other.is_unitless: return Number( op(self.value, other.value), unit_numer=self.unit_numer or other.unit_numer, unit_denom=self.unit_denom or other.unit_denom, ) # Likewise, if either side is zero, it can auto-cast to any units if self.value == 0: return Number( op(self.value, other.value), unit_numer=other.unit_numer, unit_denom=other.unit_denom, ) elif other.value == 0: return Number( op(self.value, other.value), unit_numer=self.unit_numer, unit_denom=self.unit_denom, ) # Reduce both operands to the same units left = self.to_base_units() right = other.to_base_units() if left.unit_numer != right.unit_numer or left.unit_denom != right.unit_denom: raise ValueError("Can't reconcile units: %r and %r" % (self, other)) new_amount = op(left.value, right.value) # Convert back to the left side's units if left.value != 0: new_amount = new_amount * self.value / left.value return Number(new_amount, unit_numer=self.unit_numer, unit_denom=self.unit_denom)
python
def _add_sub(self, other, op): if not isinstance(other, Number): return NotImplemented # If either side is unitless, inherit the other side's units. Skip all # the rest of the conversion math, too. if self.is_unitless or other.is_unitless: return Number( op(self.value, other.value), unit_numer=self.unit_numer or other.unit_numer, unit_denom=self.unit_denom or other.unit_denom, ) # Likewise, if either side is zero, it can auto-cast to any units if self.value == 0: return Number( op(self.value, other.value), unit_numer=other.unit_numer, unit_denom=other.unit_denom, ) elif other.value == 0: return Number( op(self.value, other.value), unit_numer=self.unit_numer, unit_denom=self.unit_denom, ) # Reduce both operands to the same units left = self.to_base_units() right = other.to_base_units() if left.unit_numer != right.unit_numer or left.unit_denom != right.unit_denom: raise ValueError("Can't reconcile units: %r and %r" % (self, other)) new_amount = op(left.value, right.value) # Convert back to the left side's units if left.value != 0: new_amount = new_amount * self.value / left.value return Number(new_amount, unit_numer=self.unit_numer, unit_denom=self.unit_denom)
[ "def", "_add_sub", "(", "self", ",", "other", ",", "op", ")", ":", "if", "not", "isinstance", "(", "other", ",", "Number", ")", ":", "return", "NotImplemented", "# If either side is unitless, inherit the other side's units. Skip all", "# the rest of the conversion math, ...
Implements both addition and subtraction.
[ "Implements", "both", "addition", "and", "subtraction", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L442-L483
24,538
Kronuz/pyScss
scss/types.py
Number.to_base_units
def to_base_units(self): """Convert to a fixed set of "base" units. The particular units are arbitrary; what's important is that they're consistent. Used for addition and comparisons. """ # Convert to "standard" units, as defined by the conversions dict above amount = self.value numer_factor, numer_units = convert_units_to_base_units(self.unit_numer) denom_factor, denom_units = convert_units_to_base_units(self.unit_denom) return Number( amount * numer_factor / denom_factor, unit_numer=numer_units, unit_denom=denom_units, )
python
def to_base_units(self): # Convert to "standard" units, as defined by the conversions dict above amount = self.value numer_factor, numer_units = convert_units_to_base_units(self.unit_numer) denom_factor, denom_units = convert_units_to_base_units(self.unit_denom) return Number( amount * numer_factor / denom_factor, unit_numer=numer_units, unit_denom=denom_units, )
[ "def", "to_base_units", "(", "self", ")", ":", "# Convert to \"standard\" units, as defined by the conversions dict above", "amount", "=", "self", ".", "value", "numer_factor", ",", "numer_units", "=", "convert_units_to_base_units", "(", "self", ".", "unit_numer", ")", "d...
Convert to a fixed set of "base" units. The particular units are arbitrary; what's important is that they're consistent. Used for addition and comparisons.
[ "Convert", "to", "a", "fixed", "set", "of", "base", "units", ".", "The", "particular", "units", "are", "arbitrary", ";", "what", "s", "important", "is", "that", "they", "re", "consistent", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L487-L503
24,539
Kronuz/pyScss
scss/types.py
Number.wrap_python_function
def wrap_python_function(cls, fn): """Wraps an unary Python math function, translating the argument from Sass to Python on the way in, and vice versa for the return value. Used to wrap simple Python functions like `ceil`, `floor`, etc. """ def wrapped(sass_arg): # TODO enforce no units for trig? python_arg = sass_arg.value python_ret = fn(python_arg) sass_ret = cls( python_ret, unit_numer=sass_arg.unit_numer, unit_denom=sass_arg.unit_denom) return sass_ret return wrapped
python
def wrap_python_function(cls, fn): def wrapped(sass_arg): # TODO enforce no units for trig? python_arg = sass_arg.value python_ret = fn(python_arg) sass_ret = cls( python_ret, unit_numer=sass_arg.unit_numer, unit_denom=sass_arg.unit_denom) return sass_ret return wrapped
[ "def", "wrap_python_function", "(", "cls", ",", "fn", ")", ":", "def", "wrapped", "(", "sass_arg", ")", ":", "# TODO enforce no units for trig?", "python_arg", "=", "sass_arg", ".", "value", "python_ret", "=", "fn", "(", "python_arg", ")", "sass_ret", "=", "cl...
Wraps an unary Python math function, translating the argument from Sass to Python on the way in, and vice versa for the return value. Used to wrap simple Python functions like `ceil`, `floor`, etc.
[ "Wraps", "an", "unary", "Python", "math", "function", "translating", "the", "argument", "from", "Sass", "to", "Python", "on", "the", "way", "in", "and", "vice", "versa", "for", "the", "return", "value", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L508-L524
24,540
Kronuz/pyScss
scss/types.py
Number.to_python_index
def to_python_index(self, length, check_bounds=True, circular=False): """Return a plain Python integer appropriate for indexing a sequence of the given length. Raise if this is impossible for any reason whatsoever. """ if not self.is_unitless: raise ValueError("Index cannot have units: {0!r}".format(self)) ret = int(self.value) if ret != self.value: raise ValueError("Index must be an integer: {0!r}".format(ret)) if ret == 0: raise ValueError("Index cannot be zero") if check_bounds and not circular and abs(ret) > length: raise ValueError("Index {0!r} out of bounds for length {1}".format(ret, length)) if ret > 0: ret -= 1 if circular: ret = ret % length return ret
python
def to_python_index(self, length, check_bounds=True, circular=False): if not self.is_unitless: raise ValueError("Index cannot have units: {0!r}".format(self)) ret = int(self.value) if ret != self.value: raise ValueError("Index must be an integer: {0!r}".format(ret)) if ret == 0: raise ValueError("Index cannot be zero") if check_bounds and not circular and abs(ret) > length: raise ValueError("Index {0!r} out of bounds for length {1}".format(ret, length)) if ret > 0: ret -= 1 if circular: ret = ret % length return ret
[ "def", "to_python_index", "(", "self", ",", "length", ",", "check_bounds", "=", "True", ",", "circular", "=", "False", ")", ":", "if", "not", "self", ".", "is_unitless", ":", "raise", "ValueError", "(", "\"Index cannot have units: {0!r}\"", ".", "format", "(",...
Return a plain Python integer appropriate for indexing a sequence of the given length. Raise if this is impossible for any reason whatsoever.
[ "Return", "a", "plain", "Python", "integer", "appropriate", "for", "indexing", "a", "sequence", "of", "the", "given", "length", ".", "Raise", "if", "this", "is", "impossible", "for", "any", "reason", "whatsoever", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L526-L550
24,541
Kronuz/pyScss
scss/types.py
List.maybe_new
def maybe_new(cls, values, use_comma=True): """If `values` contains only one item, return that item. Otherwise, return a List as normal. """ if len(values) == 1: return values[0] else: return cls(values, use_comma=use_comma)
python
def maybe_new(cls, values, use_comma=True): if len(values) == 1: return values[0] else: return cls(values, use_comma=use_comma)
[ "def", "maybe_new", "(", "cls", ",", "values", ",", "use_comma", "=", "True", ")", ":", "if", "len", "(", "values", ")", "==", "1", ":", "return", "values", "[", "0", "]", "else", ":", "return", "cls", "(", "values", ",", "use_comma", "=", "use_com...
If `values` contains only one item, return that item. Otherwise, return a List as normal.
[ "If", "values", "contains", "only", "one", "item", "return", "that", "item", ".", "Otherwise", "return", "a", "List", "as", "normal", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L636-L643
24,542
Kronuz/pyScss
scss/types.py
List.from_maybe_starargs
def from_maybe_starargs(cls, args, use_comma=True): """If `args` has one element which appears to be a list, return it. Otherwise, return a list as normal. Mainly used by Sass function implementations that predate `...` support, so they can accept both a list of arguments and a single list stored in a variable. """ if len(args) == 1: if isinstance(args[0], cls): return args[0] elif isinstance(args[0], (list, tuple)): return cls(args[0], use_comma=use_comma) return cls(args, use_comma=use_comma)
python
def from_maybe_starargs(cls, args, use_comma=True): if len(args) == 1: if isinstance(args[0], cls): return args[0] elif isinstance(args[0], (list, tuple)): return cls(args[0], use_comma=use_comma) return cls(args, use_comma=use_comma)
[ "def", "from_maybe_starargs", "(", "cls", ",", "args", ",", "use_comma", "=", "True", ")", ":", "if", "len", "(", "args", ")", "==", "1", ":", "if", "isinstance", "(", "args", "[", "0", "]", ",", "cls", ")", ":", "return", "args", "[", "0", "]", ...
If `args` has one element which appears to be a list, return it. Otherwise, return a list as normal. Mainly used by Sass function implementations that predate `...` support, so they can accept both a list of arguments and a single list stored in a variable.
[ "If", "args", "has", "one", "element", "which", "appears", "to", "be", "a", "list", "return", "it", ".", "Otherwise", "return", "a", "list", "as", "normal", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L664-L678
24,543
Kronuz/pyScss
scss/types.py
Color.from_name
def from_name(cls, name): """Build a Color from a CSS color name.""" self = cls.__new__(cls) # TODO self.original_literal = name r, g, b, a = COLOR_NAMES[name] self.value = r, g, b, a return self
python
def from_name(cls, name): self = cls.__new__(cls) # TODO self.original_literal = name r, g, b, a = COLOR_NAMES[name] self.value = r, g, b, a return self
[ "def", "from_name", "(", "cls", ",", "name", ")", ":", "self", "=", "cls", ".", "__new__", "(", "cls", ")", "# TODO", "self", ".", "original_literal", "=", "name", "r", ",", "g", ",", "b", ",", "a", "=", "COLOR_NAMES", "[", "name", "]", "self", "...
Build a Color from a CSS color name.
[ "Build", "a", "Color", "from", "a", "CSS", "color", "name", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L893-L901
24,544
Kronuz/pyScss
scss/types.py
String.unquoted
def unquoted(cls, value, literal=False): """Helper to create a string with no quotes.""" return cls(value, quotes=None, literal=literal)
python
def unquoted(cls, value, literal=False): return cls(value, quotes=None, literal=literal)
[ "def", "unquoted", "(", "cls", ",", "value", ",", "literal", "=", "False", ")", ":", "return", "cls", "(", "value", ",", "quotes", "=", "None", ",", "literal", "=", "literal", ")" ]
Helper to create a string with no quotes.
[ "Helper", "to", "create", "a", "string", "with", "no", "quotes", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/types.py#L1096-L1098
24,545
Kronuz/pyScss
scss/selector.py
_is_combinator_subset_of
def _is_combinator_subset_of(specific, general, is_first=True): """Return whether `specific` matches a non-strict subset of what `general` matches. """ if is_first and general == ' ': # First selector always has a space to mean "descendent of root", which # still holds if any other selector appears above it return True if specific == general: return True if specific == '>' and general == ' ': return True if specific == '+' and general == '~': return True return False
python
def _is_combinator_subset_of(specific, general, is_first=True): if is_first and general == ' ': # First selector always has a space to mean "descendent of root", which # still holds if any other selector appears above it return True if specific == general: return True if specific == '>' and general == ' ': return True if specific == '+' and general == '~': return True return False
[ "def", "_is_combinator_subset_of", "(", "specific", ",", "general", ",", "is_first", "=", "True", ")", ":", "if", "is_first", "and", "general", "==", "' '", ":", "# First selector always has a space to mean \"descendent of root\", which", "# still holds if any other selector ...
Return whether `specific` matches a non-strict subset of what `general` matches.
[ "Return", "whether", "specific", "matches", "a", "non", "-", "strict", "subset", "of", "what", "general", "matches", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/selector.py#L62-L80
24,546
Kronuz/pyScss
scss/selector.py
_weave_conflicting_selectors
def _weave_conflicting_selectors(prefixes, a, b, suffix=()): """Part of the selector merge algorithm above. Not useful on its own. Pay no attention to the man behind the curtain. """ # OK, what this actually does: given a list of selector chains, two # "conflicting" selector chains, and an optional suffix, return a new list # of chains like this: # prefix[0] + a + b + suffix, # prefix[0] + b + a + suffix, # prefix[1] + a + b + suffix, # ... # In other words, this just appends a new chain to each of a list of given # chains, except that the new chain might be the superposition of two # other incompatible chains. both = a and b for prefix in prefixes: yield prefix + a + b + suffix if both: # Only use both orderings if there's an actual conflict! yield prefix + b + a + suffix
python
def _weave_conflicting_selectors(prefixes, a, b, suffix=()): # OK, what this actually does: given a list of selector chains, two # "conflicting" selector chains, and an optional suffix, return a new list # of chains like this: # prefix[0] + a + b + suffix, # prefix[0] + b + a + suffix, # prefix[1] + a + b + suffix, # ... # In other words, this just appends a new chain to each of a list of given # chains, except that the new chain might be the superposition of two # other incompatible chains. both = a and b for prefix in prefixes: yield prefix + a + b + suffix if both: # Only use both orderings if there's an actual conflict! yield prefix + b + a + suffix
[ "def", "_weave_conflicting_selectors", "(", "prefixes", ",", "a", ",", "b", ",", "suffix", "=", "(", ")", ")", ":", "# OK, what this actually does: given a list of selector chains, two", "# \"conflicting\" selector chains, and an optional suffix, return a new list", "# of chains li...
Part of the selector merge algorithm above. Not useful on its own. Pay no attention to the man behind the curtain.
[ "Part", "of", "the", "selector", "merge", "algorithm", "above", ".", "Not", "useful", "on", "its", "own", ".", "Pay", "no", "attention", "to", "the", "man", "behind", "the", "curtain", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/selector.py#L550-L569
24,547
Kronuz/pyScss
scss/selector.py
_merge_simple_selectors
def _merge_simple_selectors(a, b): """Merge two simple selectors, for the purposes of the LCS algorithm below. In practice this returns the more specific selector if one is a subset of the other, else it returns None. """ # TODO what about combinators if a.is_superset_of(b): return b elif b.is_superset_of(a): return a else: return None
python
def _merge_simple_selectors(a, b): # TODO what about combinators if a.is_superset_of(b): return b elif b.is_superset_of(a): return a else: return None
[ "def", "_merge_simple_selectors", "(", "a", ",", "b", ")", ":", "# TODO what about combinators", "if", "a", ".", "is_superset_of", "(", "b", ")", ":", "return", "b", "elif", "b", ".", "is_superset_of", "(", "a", ")", ":", "return", "a", "else", ":", "ret...
Merge two simple selectors, for the purposes of the LCS algorithm below. In practice this returns the more specific selector if one is a subset of the other, else it returns None.
[ "Merge", "two", "simple", "selectors", "for", "the", "purposes", "of", "the", "LCS", "algorithm", "below", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/selector.py#L572-L584
24,548
Kronuz/pyScss
scss/selector.py
longest_common_subsequence
def longest_common_subsequence(a, b, mergefunc=None): """Find the longest common subsequence between two iterables. The longest common subsequence is the core of any diff algorithm: it's the longest sequence of elements that appears in both parent sequences in the same order, but NOT necessarily consecutively. Original algorithm borrowed from Wikipedia: http://en.wikipedia.org/wiki/Longest_common_subsequence_problem#Code_for_the_dynamic_programming_solution This function is used only to implement @extend, largely because that's what the Ruby implementation does. Thus it's been extended slightly from the simple diff-friendly algorithm given above. What @extend wants to know is whether two simple selectors are compatible, not just equal. To that end, you must pass in a "merge" function to compare a pair of elements manually. It should return `None` if they are incompatible, and a MERGED element if they are compatible -- in the case of selectors, this is whichever one is more specific. Because of this fuzzier notion of equality, the return value is a list of ``(a_index, b_index, value)`` tuples rather than items alone. """ if mergefunc is None: # Stupid default, just in case def mergefunc(a, b): if a == b: return a return None # Precalculate equality, since it can be a tad expensive and every pair is # compared at least once eq = {} for ai, aval in enumerate(a): for bi, bval in enumerate(b): eq[ai, bi] = mergefunc(aval, bval) # Build the "length" matrix, which provides the length of the LCS for # arbitrary-length prefixes. -1 exists only to support the base case prefix_lcs_length = {} for ai in range(-1, len(a)): for bi in range(-1, len(b)): if ai == -1 or bi == -1: l = 0 elif eq[ai, bi]: l = prefix_lcs_length[ai - 1, bi - 1] + 1 else: l = max( prefix_lcs_length[ai, bi - 1], prefix_lcs_length[ai - 1, bi]) prefix_lcs_length[ai, bi] = l # The interesting part. The key insight is that the bottom-right value in # the length matrix must be the length of the LCS because of how the matrix # is defined, so all that's left to do is backtrack from the ends of both # sequences in whatever way keeps the LCS as long as possible, and keep # track of the equal pairs of elements we see along the way. # Wikipedia does this with recursion, but the algorithm is trivial to # rewrite as a loop, as below. ai = len(a) - 1 bi = len(b) - 1 ret = [] while ai >= 0 and bi >= 0: merged = eq[ai, bi] if merged is not None: ret.append((ai, bi, merged)) ai -= 1 bi -= 1 elif prefix_lcs_length[ai, bi - 1] > prefix_lcs_length[ai - 1, bi]: bi -= 1 else: ai -= 1 # ret has the latest items first, which is backwards ret.reverse() return ret
python
def longest_common_subsequence(a, b, mergefunc=None): if mergefunc is None: # Stupid default, just in case def mergefunc(a, b): if a == b: return a return None # Precalculate equality, since it can be a tad expensive and every pair is # compared at least once eq = {} for ai, aval in enumerate(a): for bi, bval in enumerate(b): eq[ai, bi] = mergefunc(aval, bval) # Build the "length" matrix, which provides the length of the LCS for # arbitrary-length prefixes. -1 exists only to support the base case prefix_lcs_length = {} for ai in range(-1, len(a)): for bi in range(-1, len(b)): if ai == -1 or bi == -1: l = 0 elif eq[ai, bi]: l = prefix_lcs_length[ai - 1, bi - 1] + 1 else: l = max( prefix_lcs_length[ai, bi - 1], prefix_lcs_length[ai - 1, bi]) prefix_lcs_length[ai, bi] = l # The interesting part. The key insight is that the bottom-right value in # the length matrix must be the length of the LCS because of how the matrix # is defined, so all that's left to do is backtrack from the ends of both # sequences in whatever way keeps the LCS as long as possible, and keep # track of the equal pairs of elements we see along the way. # Wikipedia does this with recursion, but the algorithm is trivial to # rewrite as a loop, as below. ai = len(a) - 1 bi = len(b) - 1 ret = [] while ai >= 0 and bi >= 0: merged = eq[ai, bi] if merged is not None: ret.append((ai, bi, merged)) ai -= 1 bi -= 1 elif prefix_lcs_length[ai, bi - 1] > prefix_lcs_length[ai - 1, bi]: bi -= 1 else: ai -= 1 # ret has the latest items first, which is backwards ret.reverse() return ret
[ "def", "longest_common_subsequence", "(", "a", ",", "b", ",", "mergefunc", "=", "None", ")", ":", "if", "mergefunc", "is", "None", ":", "# Stupid default, just in case", "def", "mergefunc", "(", "a", ",", "b", ")", ":", "if", "a", "==", "b", ":", "return...
Find the longest common subsequence between two iterables. The longest common subsequence is the core of any diff algorithm: it's the longest sequence of elements that appears in both parent sequences in the same order, but NOT necessarily consecutively. Original algorithm borrowed from Wikipedia: http://en.wikipedia.org/wiki/Longest_common_subsequence_problem#Code_for_the_dynamic_programming_solution This function is used only to implement @extend, largely because that's what the Ruby implementation does. Thus it's been extended slightly from the simple diff-friendly algorithm given above. What @extend wants to know is whether two simple selectors are compatible, not just equal. To that end, you must pass in a "merge" function to compare a pair of elements manually. It should return `None` if they are incompatible, and a MERGED element if they are compatible -- in the case of selectors, this is whichever one is more specific. Because of this fuzzier notion of equality, the return value is a list of ``(a_index, b_index, value)`` tuples rather than items alone.
[ "Find", "the", "longest", "common", "subsequence", "between", "two", "iterables", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/selector.py#L587-L664
24,549
Kronuz/pyScss
scss/selector.py
SimpleSelector.is_superset_of
def is_superset_of(self, other, soft_combinator=False): """Return True iff this selector matches the same elements as `other`, and perhaps others. That is, ``.foo`` is a superset of ``.foo.bar``, because the latter is more specific. Set `soft_combinator` true to ignore the specific case of this selector having a descendent combinator and `other` having anything else. This is for superset checking for ``@extend``, where a space combinator really means "none". """ # Combinators must match, OR be compatible -- space is a superset of >, # ~ is a superset of + if soft_combinator and self.combinator == ' ': combinator_superset = True else: combinator_superset = ( self.combinator == other.combinator or (self.combinator == ' ' and other.combinator == '>') or (self.combinator == '~' and other.combinator == '+')) return ( combinator_superset and set(self.tokens) <= set(other.tokens))
python
def is_superset_of(self, other, soft_combinator=False): # Combinators must match, OR be compatible -- space is a superset of >, # ~ is a superset of + if soft_combinator and self.combinator == ' ': combinator_superset = True else: combinator_superset = ( self.combinator == other.combinator or (self.combinator == ' ' and other.combinator == '>') or (self.combinator == '~' and other.combinator == '+')) return ( combinator_superset and set(self.tokens) <= set(other.tokens))
[ "def", "is_superset_of", "(", "self", ",", "other", ",", "soft_combinator", "=", "False", ")", ":", "# Combinators must match, OR be compatible -- space is a superset of >,", "# ~ is a superset of +", "if", "soft_combinator", "and", "self", ".", "combinator", "==", "' '", ...
Return True iff this selector matches the same elements as `other`, and perhaps others. That is, ``.foo`` is a superset of ``.foo.bar``, because the latter is more specific. Set `soft_combinator` true to ignore the specific case of this selector having a descendent combinator and `other` having anything else. This is for superset checking for ``@extend``, where a space combinator really means "none".
[ "Return", "True", "iff", "this", "selector", "matches", "the", "same", "elements", "as", "other", "and", "perhaps", "others", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/selector.py#L136-L160
24,550
Kronuz/pyScss
scss/selector.py
Selector.substitute
def substitute(self, target, replacement): """Return a list of selectors obtained by replacing the `target` selector with `replacement`. Herein lie the guts of the Sass @extend directive. In general, for a selector ``a X b Y c``, a target ``X Y``, and a replacement ``q Z``, return the selectors ``a q X b Z c`` and ``q a X b Z c``. Note in particular that no more than two selectors will be returned, and the permutation of ancestors will never insert new simple selectors "inside" the target selector. """ # Find the target in the parent selector, and split it into # before/after p_before, p_extras, p_after = self.break_around(target.simple_selectors) # The replacement has no hinge; it only has the most specific simple # selector (which is the part that replaces "self" in the parent) and # whatever preceding simple selectors there may be r_trail = replacement.simple_selectors[:-1] r_extras = replacement.simple_selectors[-1] # TODO what if the prefix doesn't match? who wins? should we even get # this far? focal_nodes = (p_extras.merge_into(r_extras),) befores = _merge_selectors(p_before, r_trail) cls = type(self) return [ cls(before + focal_nodes + p_after) for before in befores]
python
def substitute(self, target, replacement): # Find the target in the parent selector, and split it into # before/after p_before, p_extras, p_after = self.break_around(target.simple_selectors) # The replacement has no hinge; it only has the most specific simple # selector (which is the part that replaces "self" in the parent) and # whatever preceding simple selectors there may be r_trail = replacement.simple_selectors[:-1] r_extras = replacement.simple_selectors[-1] # TODO what if the prefix doesn't match? who wins? should we even get # this far? focal_nodes = (p_extras.merge_into(r_extras),) befores = _merge_selectors(p_before, r_trail) cls = type(self) return [ cls(before + focal_nodes + p_after) for before in befores]
[ "def", "substitute", "(", "self", ",", "target", ",", "replacement", ")", ":", "# Find the target in the parent selector, and split it into", "# before/after", "p_before", ",", "p_extras", ",", "p_after", "=", "self", ".", "break_around", "(", "target", ".", "simple_s...
Return a list of selectors obtained by replacing the `target` selector with `replacement`. Herein lie the guts of the Sass @extend directive. In general, for a selector ``a X b Y c``, a target ``X Y``, and a replacement ``q Z``, return the selectors ``a q X b Z c`` and ``q a X b Z c``. Note in particular that no more than two selectors will be returned, and the permutation of ancestors will never insert new simple selectors "inside" the target selector.
[ "Return", "a", "list", "of", "selectors", "obtained", "by", "replacing", "the", "target", "selector", "with", "replacement", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/selector.py#L428-L459
24,551
Kronuz/pyScss
scss/cssdefs.py
convert_units_to_base_units
def convert_units_to_base_units(units): """Convert a set of units into a set of "base" units. Returns a 2-tuple of `factor, new_units`. """ total_factor = 1 new_units = [] for unit in units: if unit not in BASE_UNIT_CONVERSIONS: continue factor, new_unit = BASE_UNIT_CONVERSIONS[unit] total_factor *= factor new_units.append(new_unit) new_units.sort() return total_factor, tuple(new_units)
python
def convert_units_to_base_units(units): total_factor = 1 new_units = [] for unit in units: if unit not in BASE_UNIT_CONVERSIONS: continue factor, new_unit = BASE_UNIT_CONVERSIONS[unit] total_factor *= factor new_units.append(new_unit) new_units.sort() return total_factor, tuple(new_units)
[ "def", "convert_units_to_base_units", "(", "units", ")", ":", "total_factor", "=", "1", "new_units", "=", "[", "]", "for", "unit", "in", "units", ":", "if", "unit", "not", "in", "BASE_UNIT_CONVERSIONS", ":", "continue", "factor", ",", "new_unit", "=", "BASE_...
Convert a set of units into a set of "base" units. Returns a 2-tuple of `factor, new_units`.
[ "Convert", "a", "set", "of", "units", "into", "a", "set", "of", "base", "units", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/cssdefs.py#L208-L224
24,552
Kronuz/pyScss
scss/cssdefs.py
count_base_units
def count_base_units(units): """Returns a dict mapping names of base units to how many times they appear in the given iterable of units. Effectively this counts how many length units you have, how many time units, and so forth. """ ret = {} for unit in units: factor, base_unit = get_conversion_factor(unit) ret.setdefault(base_unit, 0) ret[base_unit] += 1 return ret
python
def count_base_units(units): ret = {} for unit in units: factor, base_unit = get_conversion_factor(unit) ret.setdefault(base_unit, 0) ret[base_unit] += 1 return ret
[ "def", "count_base_units", "(", "units", ")", ":", "ret", "=", "{", "}", "for", "unit", "in", "units", ":", "factor", ",", "base_unit", "=", "get_conversion_factor", "(", "unit", ")", "ret", ".", "setdefault", "(", "base_unit", ",", "0", ")", "ret", "[...
Returns a dict mapping names of base units to how many times they appear in the given iterable of units. Effectively this counts how many length units you have, how many time units, and so forth.
[ "Returns", "a", "dict", "mapping", "names", "of", "base", "units", "to", "how", "many", "times", "they", "appear", "in", "the", "given", "iterable", "of", "units", ".", "Effectively", "this", "counts", "how", "many", "length", "units", "you", "have", "how"...
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/cssdefs.py#L227-L239
24,553
Kronuz/pyScss
scss/cssdefs.py
cancel_base_units
def cancel_base_units(units, to_remove): """Given a list of units, remove a specified number of each base unit. Arguments: units: an iterable of units to_remove: a mapping of base_unit => count, such as that returned from count_base_units Returns a 2-tuple of (factor, remaining_units). """ # Copy the dict since we're about to mutate it to_remove = to_remove.copy() remaining_units = [] total_factor = Fraction(1) for unit in units: factor, base_unit = get_conversion_factor(unit) if not to_remove.get(base_unit, 0): remaining_units.append(unit) continue total_factor *= factor to_remove[base_unit] -= 1 return total_factor, remaining_units
python
def cancel_base_units(units, to_remove): # Copy the dict since we're about to mutate it to_remove = to_remove.copy() remaining_units = [] total_factor = Fraction(1) for unit in units: factor, base_unit = get_conversion_factor(unit) if not to_remove.get(base_unit, 0): remaining_units.append(unit) continue total_factor *= factor to_remove[base_unit] -= 1 return total_factor, remaining_units
[ "def", "cancel_base_units", "(", "units", ",", "to_remove", ")", ":", "# Copy the dict since we're about to mutate it", "to_remove", "=", "to_remove", ".", "copy", "(", ")", "remaining_units", "=", "[", "]", "total_factor", "=", "Fraction", "(", "1", ")", "for", ...
Given a list of units, remove a specified number of each base unit. Arguments: units: an iterable of units to_remove: a mapping of base_unit => count, such as that returned from count_base_units Returns a 2-tuple of (factor, remaining_units).
[ "Given", "a", "list", "of", "units", "remove", "a", "specified", "number", "of", "each", "base", "unit", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/cssdefs.py#L242-L267
24,554
Kronuz/pyScss
scss/cssdefs.py
is_builtin_css_function
def is_builtin_css_function(name): """Returns whether the given `name` looks like the name of a builtin CSS function. Unrecognized functions not in this list produce warnings. """ name = name.replace('_', '-') if name in BUILTIN_FUNCTIONS: return True # Vendor-specific functions (-foo-bar) are always okay if name[0] == '-' and '-' in name[1:]: return True return False
python
def is_builtin_css_function(name): name = name.replace('_', '-') if name in BUILTIN_FUNCTIONS: return True # Vendor-specific functions (-foo-bar) are always okay if name[0] == '-' and '-' in name[1:]: return True return False
[ "def", "is_builtin_css_function", "(", "name", ")", ":", "name", "=", "name", ".", "replace", "(", "'_'", ",", "'-'", ")", "if", "name", "in", "BUILTIN_FUNCTIONS", ":", "return", "True", "# Vendor-specific functions (-foo-bar) are always okay", "if", "name", "[", ...
Returns whether the given `name` looks like the name of a builtin CSS function. Unrecognized functions not in this list produce warnings.
[ "Returns", "whether", "the", "given", "name", "looks", "like", "the", "name", "of", "a", "builtin", "CSS", "function", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/cssdefs.py#L336-L351
24,555
Kronuz/pyScss
scss/cssdefs.py
determine_encoding
def determine_encoding(buf): """Return the appropriate encoding for the given CSS source, according to the CSS charset rules. `buf` may be either a string or bytes. """ # The ultimate default is utf8; bravo, W3C bom_encoding = 'UTF-8' if not buf: # What return bom_encoding if isinstance(buf, six.text_type): # We got a file that, for whatever reason, produces already-decoded # text. Check for the BOM (which is useless now) and believe # whatever's in the @charset. if buf[0] == '\ufeff': buf = buf[0:] # This is pretty similar to the code below, but without any encoding # double-checking. charset_start = '@charset "' charset_end = '";' if buf.startswith(charset_start): start = len(charset_start) end = buf.index(charset_end, start) return buf[start:end] else: return bom_encoding # BOMs if buf[:3] == b'\xef\xbb\xbf': bom_encoding = 'UTF-8' buf = buf[3:] if buf[:4] == b'\x00\x00\xfe\xff': bom_encoding = 'UTF-32BE' buf = buf[4:] elif buf[:4] == b'\xff\xfe\x00\x00': bom_encoding = 'UTF-32LE' buf = buf[4:] if buf[:4] == b'\x00\x00\xff\xfe': raise UnicodeError("UTF-32-2143 is not supported") elif buf[:4] == b'\xfe\xff\x00\x00': raise UnicodeError("UTF-32-2143 is not supported") elif buf[:2] == b'\xfe\xff': bom_encoding = 'UTF-16BE' buf = buf[2:] elif buf[:2] == b'\xff\xfe': bom_encoding = 'UTF-16LE' buf = buf[2:] # The spec requires exactly this syntax; no escapes or extra spaces or # other shenanigans, thank goodness. charset_start = '@charset "'.encode(bom_encoding) charset_end = '";'.encode(bom_encoding) if buf.startswith(charset_start): start = len(charset_start) end = buf.index(charset_end, start) encoded_encoding = buf[start:end] encoding = encoded_encoding.decode(bom_encoding) # Ensure that decoding with the specified encoding actually produces # the same @charset rule encoded_charset = buf[:end + len(charset_end)] if (encoded_charset.decode(encoding) != encoded_charset.decode(bom_encoding)): raise UnicodeError( "@charset {0} is incompatible with detected encoding {1}" .format(bom_encoding, encoding)) else: # With no @charset, believe the BOM encoding = bom_encoding return encoding
python
def determine_encoding(buf): # The ultimate default is utf8; bravo, W3C bom_encoding = 'UTF-8' if not buf: # What return bom_encoding if isinstance(buf, six.text_type): # We got a file that, for whatever reason, produces already-decoded # text. Check for the BOM (which is useless now) and believe # whatever's in the @charset. if buf[0] == '\ufeff': buf = buf[0:] # This is pretty similar to the code below, but without any encoding # double-checking. charset_start = '@charset "' charset_end = '";' if buf.startswith(charset_start): start = len(charset_start) end = buf.index(charset_end, start) return buf[start:end] else: return bom_encoding # BOMs if buf[:3] == b'\xef\xbb\xbf': bom_encoding = 'UTF-8' buf = buf[3:] if buf[:4] == b'\x00\x00\xfe\xff': bom_encoding = 'UTF-32BE' buf = buf[4:] elif buf[:4] == b'\xff\xfe\x00\x00': bom_encoding = 'UTF-32LE' buf = buf[4:] if buf[:4] == b'\x00\x00\xff\xfe': raise UnicodeError("UTF-32-2143 is not supported") elif buf[:4] == b'\xfe\xff\x00\x00': raise UnicodeError("UTF-32-2143 is not supported") elif buf[:2] == b'\xfe\xff': bom_encoding = 'UTF-16BE' buf = buf[2:] elif buf[:2] == b'\xff\xfe': bom_encoding = 'UTF-16LE' buf = buf[2:] # The spec requires exactly this syntax; no escapes or extra spaces or # other shenanigans, thank goodness. charset_start = '@charset "'.encode(bom_encoding) charset_end = '";'.encode(bom_encoding) if buf.startswith(charset_start): start = len(charset_start) end = buf.index(charset_end, start) encoded_encoding = buf[start:end] encoding = encoded_encoding.decode(bom_encoding) # Ensure that decoding with the specified encoding actually produces # the same @charset rule encoded_charset = buf[:end + len(charset_end)] if (encoded_charset.decode(encoding) != encoded_charset.decode(bom_encoding)): raise UnicodeError( "@charset {0} is incompatible with detected encoding {1}" .format(bom_encoding, encoding)) else: # With no @charset, believe the BOM encoding = bom_encoding return encoding
[ "def", "determine_encoding", "(", "buf", ")", ":", "# The ultimate default is utf8; bravo, W3C", "bom_encoding", "=", "'UTF-8'", "if", "not", "buf", ":", "# What", "return", "bom_encoding", "if", "isinstance", "(", "buf", ",", "six", ".", "text_type", ")", ":", ...
Return the appropriate encoding for the given CSS source, according to the CSS charset rules. `buf` may be either a string or bytes.
[ "Return", "the", "appropriate", "encoding", "for", "the", "given", "CSS", "source", "according", "to", "the", "CSS", "charset", "rules", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/cssdefs.py#L358-L432
24,556
Kronuz/pyScss
scss/ast.py
Interpolation.maybe
def maybe(cls, parts, quotes=None, type=String, **kwargs): """Returns an interpolation if there are multiple parts, otherwise a plain Literal. This keeps the AST somewhat simpler, but also is the only way `Literal.from_bareword` gets called. """ if len(parts) > 1: return cls(parts, quotes=quotes, type=type, **kwargs) if quotes is None and type is String: return Literal.from_bareword(parts[0]) return Literal(type(parts[0], quotes=quotes, **kwargs))
python
def maybe(cls, parts, quotes=None, type=String, **kwargs): if len(parts) > 1: return cls(parts, quotes=quotes, type=type, **kwargs) if quotes is None and type is String: return Literal.from_bareword(parts[0]) return Literal(type(parts[0], quotes=quotes, **kwargs))
[ "def", "maybe", "(", "cls", ",", "parts", ",", "quotes", "=", "None", ",", "type", "=", "String", ",", "*", "*", "kwargs", ")", ":", "if", "len", "(", "parts", ")", ">", "1", ":", "return", "cls", "(", "parts", ",", "quotes", "=", "quotes", ","...
Returns an interpolation if there are multiple parts, otherwise a plain Literal. This keeps the AST somewhat simpler, but also is the only way `Literal.from_bareword` gets called.
[ "Returns", "an", "interpolation", "if", "there", "are", "multiple", "parts", "otherwise", "a", "plain", "Literal", ".", "This", "keeps", "the", "AST", "somewhat", "simpler", "but", "also", "is", "the", "only", "way", "Literal", ".", "from_bareword", "gets", ...
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/ast.py#L274-L285
24,557
Kronuz/pyScss
scss/extension/compass/images.py
image_height
def image_height(image): """ Returns the height of the image found at the path supplied by `image` relative to your project's images directory. """ image_size_cache = _get_cache('image_size_cache') if not Image: raise SassMissingDependency('PIL', 'image manipulation') filepath = String.unquoted(image).value path = None try: height = image_size_cache[filepath][1] except KeyError: height = 0 IMAGES_ROOT = _images_root() if callable(IMAGES_ROOT): try: _file, _storage = list(IMAGES_ROOT(filepath))[0] except IndexError: pass else: path = _storage.open(_file) else: _path = os.path.join(IMAGES_ROOT, filepath.strip(os.sep)) if os.path.exists(_path): path = open(_path, 'rb') if path: image = Image.open(path) size = image.size height = size[1] image_size_cache[filepath] = size return Number(height, 'px')
python
def image_height(image): image_size_cache = _get_cache('image_size_cache') if not Image: raise SassMissingDependency('PIL', 'image manipulation') filepath = String.unquoted(image).value path = None try: height = image_size_cache[filepath][1] except KeyError: height = 0 IMAGES_ROOT = _images_root() if callable(IMAGES_ROOT): try: _file, _storage = list(IMAGES_ROOT(filepath))[0] except IndexError: pass else: path = _storage.open(_file) else: _path = os.path.join(IMAGES_ROOT, filepath.strip(os.sep)) if os.path.exists(_path): path = open(_path, 'rb') if path: image = Image.open(path) size = image.size height = size[1] image_size_cache[filepath] = size return Number(height, 'px')
[ "def", "image_height", "(", "image", ")", ":", "image_size_cache", "=", "_get_cache", "(", "'image_size_cache'", ")", "if", "not", "Image", ":", "raise", "SassMissingDependency", "(", "'PIL'", ",", "'image manipulation'", ")", "filepath", "=", "String", ".", "un...
Returns the height of the image found at the path supplied by `image` relative to your project's images directory.
[ "Returns", "the", "height", "of", "the", "image", "found", "at", "the", "path", "supplied", "by", "image", "relative", "to", "your", "project", "s", "images", "directory", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/extension/compass/images.py#L258-L289
24,558
Kronuz/pyScss
scss/source.py
SourceFile.path
def path(self): """Concatenation of ``origin`` and ``relpath``, as a string. Used in stack traces and other debugging places. """ if self.origin: return six.text_type(self.origin / self.relpath) else: return six.text_type(self.relpath)
python
def path(self): if self.origin: return six.text_type(self.origin / self.relpath) else: return six.text_type(self.relpath)
[ "def", "path", "(", "self", ")", ":", "if", "self", ".", "origin", ":", "return", "six", ".", "text_type", "(", "self", ".", "origin", "/", "self", ".", "relpath", ")", "else", ":", "return", "six", ".", "text_type", "(", "self", ".", "relpath", ")...
Concatenation of ``origin`` and ``relpath``, as a string. Used in stack traces and other debugging places.
[ "Concatenation", "of", "origin", "and", "relpath", "as", "a", "string", ".", "Used", "in", "stack", "traces", "and", "other", "debugging", "places", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/source.py#L125-L132
24,559
Kronuz/pyScss
scss/source.py
SourceFile.from_filename
def from_filename(cls, path_string, origin=MISSING, **kwargs): """ Read Sass source from a String specifying the path """ path = Path(path_string) return cls.from_path(path, origin, **kwargs)
python
def from_filename(cls, path_string, origin=MISSING, **kwargs): path = Path(path_string) return cls.from_path(path, origin, **kwargs)
[ "def", "from_filename", "(", "cls", ",", "path_string", ",", "origin", "=", "MISSING", ",", "*", "*", "kwargs", ")", ":", "path", "=", "Path", "(", "path_string", ")", "return", "cls", ".", "from_path", "(", "path", ",", "origin", ",", "*", "*", "kwa...
Read Sass source from a String specifying the path
[ "Read", "Sass", "source", "from", "a", "String", "specifying", "the", "path" ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/source.py#L194-L198
24,560
Kronuz/pyScss
scss/source.py
SourceFile.from_file
def from_file(cls, f, origin=MISSING, relpath=MISSING, **kwargs): """Read Sass source from a file or file-like object. If `origin` or `relpath` are missing, they are derived from the file's ``.name`` attribute as with `from_path`. If it doesn't have one, the origin becomes None and the relpath becomes the file's repr. """ contents = f.read() encoding = determine_encoding(contents) if isinstance(contents, six.binary_type): contents = contents.decode(encoding) if origin is MISSING or relpath is MISSING: filename = getattr(f, 'name', None) if filename is None: origin = None relpath = repr(f) else: origin, relpath = cls._key_from_path(Path(filename), origin) return cls(origin, relpath, contents, encoding=encoding, **kwargs)
python
def from_file(cls, f, origin=MISSING, relpath=MISSING, **kwargs): contents = f.read() encoding = determine_encoding(contents) if isinstance(contents, six.binary_type): contents = contents.decode(encoding) if origin is MISSING or relpath is MISSING: filename = getattr(f, 'name', None) if filename is None: origin = None relpath = repr(f) else: origin, relpath = cls._key_from_path(Path(filename), origin) return cls(origin, relpath, contents, encoding=encoding, **kwargs)
[ "def", "from_file", "(", "cls", ",", "f", ",", "origin", "=", "MISSING", ",", "relpath", "=", "MISSING", ",", "*", "*", "kwargs", ")", ":", "contents", "=", "f", ".", "read", "(", ")", "encoding", "=", "determine_encoding", "(", "contents", ")", "if"...
Read Sass source from a file or file-like object. If `origin` or `relpath` are missing, they are derived from the file's ``.name`` attribute as with `from_path`. If it doesn't have one, the origin becomes None and the relpath becomes the file's repr.
[ "Read", "Sass", "source", "from", "a", "file", "or", "file", "-", "like", "object", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/source.py#L201-L221
24,561
Kronuz/pyScss
scss/source.py
SourceFile.from_string
def from_string(cls, string, relpath=None, encoding=None, is_sass=None): """Read Sass source from the contents of a string. The origin is always None. `relpath` defaults to "string:...". """ if isinstance(string, six.text_type): # Already decoded; we don't know what encoding to use for output, # though, so still check for a @charset. # TODO what if the given encoding conflicts with the one in the # file? do we care? if encoding is None: encoding = determine_encoding(string) byte_contents = string.encode(encoding) text_contents = string elif isinstance(string, six.binary_type): encoding = determine_encoding(string) byte_contents = string text_contents = string.decode(encoding) else: raise TypeError("Expected text or bytes, got {0!r}".format(string)) origin = None if relpath is None: m = hashlib.sha256() m.update(byte_contents) relpath = repr("string:{0}:{1}".format( m.hexdigest()[:16], text_contents[:100])) return cls( origin, relpath, text_contents, encoding=encoding, is_sass=is_sass, )
python
def from_string(cls, string, relpath=None, encoding=None, is_sass=None): if isinstance(string, six.text_type): # Already decoded; we don't know what encoding to use for output, # though, so still check for a @charset. # TODO what if the given encoding conflicts with the one in the # file? do we care? if encoding is None: encoding = determine_encoding(string) byte_contents = string.encode(encoding) text_contents = string elif isinstance(string, six.binary_type): encoding = determine_encoding(string) byte_contents = string text_contents = string.decode(encoding) else: raise TypeError("Expected text or bytes, got {0!r}".format(string)) origin = None if relpath is None: m = hashlib.sha256() m.update(byte_contents) relpath = repr("string:{0}:{1}".format( m.hexdigest()[:16], text_contents[:100])) return cls( origin, relpath, text_contents, encoding=encoding, is_sass=is_sass, )
[ "def", "from_string", "(", "cls", ",", "string", ",", "relpath", "=", "None", ",", "encoding", "=", "None", ",", "is_sass", "=", "None", ")", ":", "if", "isinstance", "(", "string", ",", "six", ".", "text_type", ")", ":", "# Already decoded; we don't know ...
Read Sass source from the contents of a string. The origin is always None. `relpath` defaults to "string:...".
[ "Read", "Sass", "source", "from", "the", "contents", "of", "a", "string", "." ]
fb32b317f6e2b4b4aad2b86a74844658ac4aa11e
https://github.com/Kronuz/pyScss/blob/fb32b317f6e2b4b4aad2b86a74844658ac4aa11e/scss/source.py#L224-L256
24,562
bitcraft/pyscroll
pyscroll/quadtree.py
FastQuadTree.hit
def hit(self, rect): """Returns the items that overlap a bounding rectangle. Returns the set of all items in the quad-tree that overlap with a bounding rectangle. @param rect: The bounding rectangle being tested against the quad-tree. This must possess left, top, right and bottom attributes. """ # Find the hits at the current level. hits = {tuple(self.items[i]) for i in rect.collidelistall(self.items)} # Recursively check the lower quadrants. if self.nw and rect.left <= self.cx and rect.top <= self.cy: hits |= self.nw.hit(rect) if self.sw and rect.left <= self.cx and rect.bottom >= self.cy: hits |= self.sw.hit(rect) if self.ne and rect.right >= self.cx and rect.top <= self.cy: hits |= self.ne.hit(rect) if self.se and rect.right >= self.cx and rect.bottom >= self.cy: hits |= self.se.hit(rect) return hits
python
def hit(self, rect): # Find the hits at the current level. hits = {tuple(self.items[i]) for i in rect.collidelistall(self.items)} # Recursively check the lower quadrants. if self.nw and rect.left <= self.cx and rect.top <= self.cy: hits |= self.nw.hit(rect) if self.sw and rect.left <= self.cx and rect.bottom >= self.cy: hits |= self.sw.hit(rect) if self.ne and rect.right >= self.cx and rect.top <= self.cy: hits |= self.ne.hit(rect) if self.se and rect.right >= self.cx and rect.bottom >= self.cy: hits |= self.se.hit(rect) return hits
[ "def", "hit", "(", "self", ",", "rect", ")", ":", "# Find the hits at the current level.", "hits", "=", "{", "tuple", "(", "self", ".", "items", "[", "i", "]", ")", "for", "i", "in", "rect", ".", "collidelistall", "(", "self", ".", "items", ")", "}", ...
Returns the items that overlap a bounding rectangle. Returns the set of all items in the quad-tree that overlap with a bounding rectangle. @param rect: The bounding rectangle being tested against the quad-tree. This must possess left, top, right and bottom attributes.
[ "Returns", "the", "items", "that", "overlap", "a", "bounding", "rectangle", "." ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/quadtree.py#L105-L129
24,563
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer.scroll
def scroll(self, vector): """ scroll the background in pixels :param vector: (int, int) """ self.center((vector[0] + self.view_rect.centerx, vector[1] + self.view_rect.centery))
python
def scroll(self, vector): self.center((vector[0] + self.view_rect.centerx, vector[1] + self.view_rect.centery))
[ "def", "scroll", "(", "self", ",", "vector", ")", ":", "self", ".", "center", "(", "(", "vector", "[", "0", "]", "+", "self", ".", "view_rect", ".", "centerx", ",", "vector", "[", "1", "]", "+", "self", ".", "view_rect", ".", "centery", ")", ")" ...
scroll the background in pixels :param vector: (int, int)
[ "scroll", "the", "background", "in", "pixels" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L87-L93
24,564
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer.center
def center(self, coords): """ center the map on a pixel float numbers will be rounded. :param coords: (number, number) """ x, y = round(coords[0]), round(coords[1]) self.view_rect.center = x, y mw, mh = self.data.map_size tw, th = self.data.tile_size vw, vh = self._tile_view.size # prevent camera from exposing edges of the map if self.clamp_camera: self._anchored_view = True self.view_rect.clamp_ip(self.map_rect) x, y = self.view_rect.center # calc the new position in tiles and pixel offset left, self._x_offset = divmod(x - self._half_width, tw) top, self._y_offset = divmod(y - self._half_height, th) right = left + vw bottom = top + vh if not self.clamp_camera: # not anchored, so the rendered map is being offset by values larger # than the tile size. this occurs when the edges of the map are inside # the screen. a situation like is shows a background under the map. self._anchored_view = True dx = int(left - self._tile_view.left) dy = int(top - self._tile_view.top) if mw < vw or left < 0: left = 0 self._x_offset = x - self._half_width self._anchored_view = False elif right > mw: left = mw - vw self._x_offset += dx * tw self._anchored_view = False if mh < vh or top < 0: top = 0 self._y_offset = y - self._half_height self._anchored_view = False elif bottom > mh: top = mh - vh self._y_offset += dy * th self._anchored_view = False # adjust the view if the view has changed without a redraw dx = int(left - self._tile_view.left) dy = int(top - self._tile_view.top) view_change = max(abs(dx), abs(dy)) if view_change and (view_change <= self._redraw_cutoff): self._buffer.scroll(-dx * tw, -dy * th) self._tile_view.move_ip(dx, dy) self._queue_edge_tiles(dx, dy) self._flush_tile_queue(self._buffer) elif view_change > self._redraw_cutoff: logger.info('scrolling too quickly. redraw forced') self._tile_view.move_ip(dx, dy) self.redraw_tiles(self._buffer)
python
def center(self, coords): x, y = round(coords[0]), round(coords[1]) self.view_rect.center = x, y mw, mh = self.data.map_size tw, th = self.data.tile_size vw, vh = self._tile_view.size # prevent camera from exposing edges of the map if self.clamp_camera: self._anchored_view = True self.view_rect.clamp_ip(self.map_rect) x, y = self.view_rect.center # calc the new position in tiles and pixel offset left, self._x_offset = divmod(x - self._half_width, tw) top, self._y_offset = divmod(y - self._half_height, th) right = left + vw bottom = top + vh if not self.clamp_camera: # not anchored, so the rendered map is being offset by values larger # than the tile size. this occurs when the edges of the map are inside # the screen. a situation like is shows a background under the map. self._anchored_view = True dx = int(left - self._tile_view.left) dy = int(top - self._tile_view.top) if mw < vw or left < 0: left = 0 self._x_offset = x - self._half_width self._anchored_view = False elif right > mw: left = mw - vw self._x_offset += dx * tw self._anchored_view = False if mh < vh or top < 0: top = 0 self._y_offset = y - self._half_height self._anchored_view = False elif bottom > mh: top = mh - vh self._y_offset += dy * th self._anchored_view = False # adjust the view if the view has changed without a redraw dx = int(left - self._tile_view.left) dy = int(top - self._tile_view.top) view_change = max(abs(dx), abs(dy)) if view_change and (view_change <= self._redraw_cutoff): self._buffer.scroll(-dx * tw, -dy * th) self._tile_view.move_ip(dx, dy) self._queue_edge_tiles(dx, dy) self._flush_tile_queue(self._buffer) elif view_change > self._redraw_cutoff: logger.info('scrolling too quickly. redraw forced') self._tile_view.move_ip(dx, dy) self.redraw_tiles(self._buffer)
[ "def", "center", "(", "self", ",", "coords", ")", ":", "x", ",", "y", "=", "round", "(", "coords", "[", "0", "]", ")", ",", "round", "(", "coords", "[", "1", "]", ")", "self", ".", "view_rect", ".", "center", "=", "x", ",", "y", "mw", ",", ...
center the map on a pixel float numbers will be rounded. :param coords: (number, number)
[ "center", "the", "map", "on", "a", "pixel" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L95-L163
24,565
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer.draw
def draw(self, surface, rect, surfaces=None): """ Draw the map onto a surface pass a rect that defines the draw area for: drawing to an area smaller that the whole window/screen surfaces may optionally be passed that will be blitted onto the surface. this must be a sequence of tuples containing a layer number, image, and rect in screen coordinates. surfaces will be drawn in order passed, and will be correctly drawn with tiles from a higher layer overlapping the surface. surfaces list should be in the following format: [ (layer, surface, rect), ... ] or this: [ (layer, surface, rect, blendmode_flags), ... ] :param surface: pygame surface to draw to :param rect: area to draw to :param surfaces: optional sequence of surfaces to interlace between tiles :return rect: area that was drawn over """ if self._zoom_level == 1.0: self._render_map(surface, rect, surfaces) else: self._render_map(self._zoom_buffer, self._zoom_buffer.get_rect(), surfaces) self.scaling_function(self._zoom_buffer, rect.size, surface) return self._previous_blit.copy()
python
def draw(self, surface, rect, surfaces=None): if self._zoom_level == 1.0: self._render_map(surface, rect, surfaces) else: self._render_map(self._zoom_buffer, self._zoom_buffer.get_rect(), surfaces) self.scaling_function(self._zoom_buffer, rect.size, surface) return self._previous_blit.copy()
[ "def", "draw", "(", "self", ",", "surface", ",", "rect", ",", "surfaces", "=", "None", ")", ":", "if", "self", ".", "_zoom_level", "==", "1.0", ":", "self", ".", "_render_map", "(", "surface", ",", "rect", ",", "surfaces", ")", "else", ":", "self", ...
Draw the map onto a surface pass a rect that defines the draw area for: drawing to an area smaller that the whole window/screen surfaces may optionally be passed that will be blitted onto the surface. this must be a sequence of tuples containing a layer number, image, and rect in screen coordinates. surfaces will be drawn in order passed, and will be correctly drawn with tiles from a higher layer overlapping the surface. surfaces list should be in the following format: [ (layer, surface, rect), ... ] or this: [ (layer, surface, rect, blendmode_flags), ... ] :param surface: pygame surface to draw to :param rect: area to draw to :param surfaces: optional sequence of surfaces to interlace between tiles :return rect: area that was drawn over
[ "Draw", "the", "map", "onto", "a", "surface" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L165-L193
24,566
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer.set_size
def set_size(self, size): """ Set the size of the map in pixels This is an expensive operation, do only when absolutely needed. :param size: (width, height) pixel size of camera/view of the group """ buffer_size = self._calculate_zoom_buffer_size(size, self._zoom_level) self._size = size self._initialize_buffers(buffer_size)
python
def set_size(self, size): buffer_size = self._calculate_zoom_buffer_size(size, self._zoom_level) self._size = size self._initialize_buffers(buffer_size)
[ "def", "set_size", "(", "self", ",", "size", ")", ":", "buffer_size", "=", "self", ".", "_calculate_zoom_buffer_size", "(", "size", ",", "self", ".", "_zoom_level", ")", "self", ".", "_size", "=", "size", "self", ".", "_initialize_buffers", "(", "buffer_size...
Set the size of the map in pixels This is an expensive operation, do only when absolutely needed. :param size: (width, height) pixel size of camera/view of the group
[ "Set", "the", "size", "of", "the", "map", "in", "pixels" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L219-L228
24,567
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer.translate_point
def translate_point(self, point): """ Translate world coordinates and return screen coordinates. Respects zoom level Will be returned as tuple. :rtype: tuple """ mx, my = self.get_center_offset() if self._zoom_level == 1.0: return point[0] + mx, point[1] + my else: return int(round((point[0] + mx)) * self._real_ratio_x), int(round((point[1] + my) * self._real_ratio_y))
python
def translate_point(self, point): mx, my = self.get_center_offset() if self._zoom_level == 1.0: return point[0] + mx, point[1] + my else: return int(round((point[0] + mx)) * self._real_ratio_x), int(round((point[1] + my) * self._real_ratio_y))
[ "def", "translate_point", "(", "self", ",", "point", ")", ":", "mx", ",", "my", "=", "self", ".", "get_center_offset", "(", ")", "if", "self", ".", "_zoom_level", "==", "1.0", ":", "return", "point", "[", "0", "]", "+", "mx", ",", "point", "[", "1"...
Translate world coordinates and return screen coordinates. Respects zoom level Will be returned as tuple. :rtype: tuple
[ "Translate", "world", "coordinates", "and", "return", "screen", "coordinates", ".", "Respects", "zoom", "level" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L246-L257
24,568
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer.translate_points
def translate_points(self, points): """ Translate coordinates and return screen coordinates Will be returned in order passed as tuples. :return: list """ retval = list() append = retval.append sx, sy = self.get_center_offset() if self._zoom_level == 1.0: for c in points: append((c[0] + sx, c[1] + sy)) else: rx = self._real_ratio_x ry = self._real_ratio_y for c in points: append((int(round((c[0] + sx) * rx)), int(round((c[1] + sy) * ry)))) return retval
python
def translate_points(self, points): retval = list() append = retval.append sx, sy = self.get_center_offset() if self._zoom_level == 1.0: for c in points: append((c[0] + sx, c[1] + sy)) else: rx = self._real_ratio_x ry = self._real_ratio_y for c in points: append((int(round((c[0] + sx) * rx)), int(round((c[1] + sy) * ry)))) return retval
[ "def", "translate_points", "(", "self", ",", "points", ")", ":", "retval", "=", "list", "(", ")", "append", "=", "retval", ".", "append", "sx", ",", "sy", "=", "self", ".", "get_center_offset", "(", ")", "if", "self", ".", "_zoom_level", "==", "1.0", ...
Translate coordinates and return screen coordinates Will be returned in order passed as tuples. :return: list
[ "Translate", "coordinates", "and", "return", "screen", "coordinates" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L273-L291
24,569
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer._render_map
def _render_map(self, surface, rect, surfaces): """ Render the map and optional surfaces to destination surface :param surface: pygame surface to draw to :param rect: area to draw to :param surfaces: optional sequence of surfaces to interlace between tiles """ self._tile_queue = self.data.process_animation_queue(self._tile_view) self._tile_queue and self._flush_tile_queue(self._buffer) # TODO: could maybe optimize to remove just the edges, ideally by drawing lines # if not self.anchored_view: # surface.fill(self._clear_color, self._previous_blit) if not self._anchored_view: self._clear_surface(surface, self._previous_blit) offset = -self._x_offset + rect.left, -self._y_offset + rect.top with surface_clipping_context(surface, rect): self._previous_blit = surface.blit(self._buffer, offset) if surfaces: surfaces_offset = -offset[0], -offset[1] self._draw_surfaces(surface, surfaces_offset, surfaces)
python
def _render_map(self, surface, rect, surfaces): self._tile_queue = self.data.process_animation_queue(self._tile_view) self._tile_queue and self._flush_tile_queue(self._buffer) # TODO: could maybe optimize to remove just the edges, ideally by drawing lines # if not self.anchored_view: # surface.fill(self._clear_color, self._previous_blit) if not self._anchored_view: self._clear_surface(surface, self._previous_blit) offset = -self._x_offset + rect.left, -self._y_offset + rect.top with surface_clipping_context(surface, rect): self._previous_blit = surface.blit(self._buffer, offset) if surfaces: surfaces_offset = -offset[0], -offset[1] self._draw_surfaces(surface, surfaces_offset, surfaces)
[ "def", "_render_map", "(", "self", ",", "surface", ",", "rect", ",", "surfaces", ")", ":", "self", ".", "_tile_queue", "=", "self", ".", "data", ".", "process_animation_queue", "(", "self", ".", "_tile_view", ")", "self", ".", "_tile_queue", "and", "self",...
Render the map and optional surfaces to destination surface :param surface: pygame surface to draw to :param rect: area to draw to :param surfaces: optional sequence of surfaces to interlace between tiles
[ "Render", "the", "map", "and", "optional", "surfaces", "to", "destination", "surface" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L315-L337
24,570
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer._clear_surface
def _clear_surface(self, surface, rect=None): """ Clear the buffer, taking in account colorkey or alpha :return: """ clear_color = self._rgb_clear_color if self._clear_color is None else self._clear_color surface.fill(clear_color, rect)
python
def _clear_surface(self, surface, rect=None): clear_color = self._rgb_clear_color if self._clear_color is None else self._clear_color surface.fill(clear_color, rect)
[ "def", "_clear_surface", "(", "self", ",", "surface", ",", "rect", "=", "None", ")", ":", "clear_color", "=", "self", ".", "_rgb_clear_color", "if", "self", ".", "_clear_color", "is", "None", "else", "self", ".", "_clear_color", "surface", ".", "fill", "("...
Clear the buffer, taking in account colorkey or alpha :return:
[ "Clear", "the", "buffer", "taking", "in", "account", "colorkey", "or", "alpha" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L339-L345
24,571
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer._draw_surfaces
def _draw_surfaces(self, surface, offset, surfaces): """ Draw surfaces onto buffer, then redraw tiles that cover them :param surface: destination :param offset: offset to compensate for buffer alignment :param surfaces: sequence of surfaces to blit """ surface_blit = surface.blit ox, oy = offset left, top = self._tile_view.topleft hit = self._layer_quadtree.hit get_tile = self.data.get_tile_image tile_layers = tuple(self.data.visible_tile_layers) dirty = list() dirty_append = dirty.append # TODO: check to avoid sorting overhead # sort layers, then the y value def sprite_sort(i): return i[2], i[1][1] + i[0].get_height() surfaces.sort(key=sprite_sort) layer_getter = itemgetter(2) for layer, group in groupby(surfaces, layer_getter): del dirty[:] for i in group: try: flags = i[3] except IndexError: dirty_append(surface_blit(i[0], i[1])) else: dirty_append(surface_blit(i[0], i[1], None, flags)) # TODO: make set of covered tiles, in the case where a cluster # of sprite surfaces causes excessive over tile overdrawing for dirty_rect in dirty: for r in hit(dirty_rect.move(ox, oy)): x, y, tw, th = r for l in [i for i in tile_layers if gt(i, layer)]: if self.tall_sprites and l == layer + 1: if y - oy + th <= dirty_rect.bottom - self.tall_sprites: continue tile = get_tile(x // tw + left, y // th + top, l) tile and surface_blit(tile, (x - ox, y - oy))
python
def _draw_surfaces(self, surface, offset, surfaces): surface_blit = surface.blit ox, oy = offset left, top = self._tile_view.topleft hit = self._layer_quadtree.hit get_tile = self.data.get_tile_image tile_layers = tuple(self.data.visible_tile_layers) dirty = list() dirty_append = dirty.append # TODO: check to avoid sorting overhead # sort layers, then the y value def sprite_sort(i): return i[2], i[1][1] + i[0].get_height() surfaces.sort(key=sprite_sort) layer_getter = itemgetter(2) for layer, group in groupby(surfaces, layer_getter): del dirty[:] for i in group: try: flags = i[3] except IndexError: dirty_append(surface_blit(i[0], i[1])) else: dirty_append(surface_blit(i[0], i[1], None, flags)) # TODO: make set of covered tiles, in the case where a cluster # of sprite surfaces causes excessive over tile overdrawing for dirty_rect in dirty: for r in hit(dirty_rect.move(ox, oy)): x, y, tw, th = r for l in [i for i in tile_layers if gt(i, layer)]: if self.tall_sprites and l == layer + 1: if y - oy + th <= dirty_rect.bottom - self.tall_sprites: continue tile = get_tile(x // tw + left, y // th + top, l) tile and surface_blit(tile, (x - ox, y - oy))
[ "def", "_draw_surfaces", "(", "self", ",", "surface", ",", "offset", ",", "surfaces", ")", ":", "surface_blit", "=", "surface", ".", "blit", "ox", ",", "oy", "=", "offset", "left", ",", "top", "=", "self", ".", "_tile_view", ".", "topleft", "hit", "=",...
Draw surfaces onto buffer, then redraw tiles that cover them :param surface: destination :param offset: offset to compensate for buffer alignment :param surfaces: sequence of surfaces to blit
[ "Draw", "surfaces", "onto", "buffer", "then", "redraw", "tiles", "that", "cover", "them" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L347-L394
24,572
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer._queue_edge_tiles
def _queue_edge_tiles(self, dx, dy): """ Queue edge tiles and clear edge areas on buffer if needed :param dx: Edge along X axis to enqueue :param dy: Edge along Y axis to enqueue :return: None """ v = self._tile_view tw, th = self.data.tile_size self._tile_queue = iter([]) def append(rect): self._tile_queue = chain(self._tile_queue, self.data.get_tile_images_by_rect(rect)) # TODO: optimize so fill is only used when map is smaller than buffer self._clear_surface(self._buffer, ((rect[0] - v.left) * tw, (rect[1] - v.top) * th, rect[2] * tw, rect[3] * th)) if dx > 0: # right side append((v.right - 1, v.top, dx, v.height)) elif dx < 0: # left side append((v.left, v.top, -dx, v.height)) if dy > 0: # bottom side append((v.left, v.bottom - 1, v.width, dy)) elif dy < 0: # top side append((v.left, v.top, v.width, -dy))
python
def _queue_edge_tiles(self, dx, dy): v = self._tile_view tw, th = self.data.tile_size self._tile_queue = iter([]) def append(rect): self._tile_queue = chain(self._tile_queue, self.data.get_tile_images_by_rect(rect)) # TODO: optimize so fill is only used when map is smaller than buffer self._clear_surface(self._buffer, ((rect[0] - v.left) * tw, (rect[1] - v.top) * th, rect[2] * tw, rect[3] * th)) if dx > 0: # right side append((v.right - 1, v.top, dx, v.height)) elif dx < 0: # left side append((v.left, v.top, -dx, v.height)) if dy > 0: # bottom side append((v.left, v.bottom - 1, v.width, dy)) elif dy < 0: # top side append((v.left, v.top, v.width, -dy))
[ "def", "_queue_edge_tiles", "(", "self", ",", "dx", ",", "dy", ")", ":", "v", "=", "self", ".", "_tile_view", "tw", ",", "th", "=", "self", ".", "data", ".", "tile_size", "self", ".", "_tile_queue", "=", "iter", "(", "[", "]", ")", "def", "append",...
Queue edge tiles and clear edge areas on buffer if needed :param dx: Edge along X axis to enqueue :param dy: Edge along Y axis to enqueue :return: None
[ "Queue", "edge", "tiles", "and", "clear", "edge", "areas", "on", "buffer", "if", "needed" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L396-L423
24,573
bitcraft/pyscroll
pyscroll/orthographic.py
BufferedRenderer._create_buffers
def _create_buffers(self, view_size, buffer_size): """ Create the buffers, taking in account pixel alpha or colorkey :param view_size: pixel size of the view :param buffer_size: pixel size of the buffer """ requires_zoom_buffer = not view_size == buffer_size self._zoom_buffer = None if self._clear_color is None: if requires_zoom_buffer: self._zoom_buffer = Surface(view_size) self._buffer = Surface(buffer_size) elif self._clear_color == self._rgba_clear_color: if requires_zoom_buffer: self._zoom_buffer = Surface(view_size, flags=pygame.SRCALPHA) self._buffer = Surface(buffer_size, flags=pygame.SRCALPHA) self.data.convert_surfaces(self._buffer, True) elif self._clear_color is not self._rgb_clear_color: if requires_zoom_buffer: self._zoom_buffer = Surface(view_size, flags=pygame.RLEACCEL) self._zoom_buffer.set_colorkey(self._clear_color) self._buffer = Surface(buffer_size, flags=pygame.RLEACCEL) self._buffer.set_colorkey(self._clear_color) self._buffer.fill(self._clear_color)
python
def _create_buffers(self, view_size, buffer_size): requires_zoom_buffer = not view_size == buffer_size self._zoom_buffer = None if self._clear_color is None: if requires_zoom_buffer: self._zoom_buffer = Surface(view_size) self._buffer = Surface(buffer_size) elif self._clear_color == self._rgba_clear_color: if requires_zoom_buffer: self._zoom_buffer = Surface(view_size, flags=pygame.SRCALPHA) self._buffer = Surface(buffer_size, flags=pygame.SRCALPHA) self.data.convert_surfaces(self._buffer, True) elif self._clear_color is not self._rgb_clear_color: if requires_zoom_buffer: self._zoom_buffer = Surface(view_size, flags=pygame.RLEACCEL) self._zoom_buffer.set_colorkey(self._clear_color) self._buffer = Surface(buffer_size, flags=pygame.RLEACCEL) self._buffer.set_colorkey(self._clear_color) self._buffer.fill(self._clear_color)
[ "def", "_create_buffers", "(", "self", ",", "view_size", ",", "buffer_size", ")", ":", "requires_zoom_buffer", "=", "not", "view_size", "==", "buffer_size", "self", ".", "_zoom_buffer", "=", "None", "if", "self", ".", "_clear_color", "is", "None", ":", "if", ...
Create the buffers, taking in account pixel alpha or colorkey :param view_size: pixel size of the view :param buffer_size: pixel size of the buffer
[ "Create", "the", "buffers", "taking", "in", "account", "pixel", "alpha", "or", "colorkey" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/orthographic.py#L433-L457
24,574
bitcraft/pyscroll
pyscroll/data.py
PyscrollDataAdapter.reload_animations
def reload_animations(self): """ Reload animation information PyscrollDataAdapter.get_animations must be implemented """ self._update_time() self._animation_queue = list() self._tracked_gids = set() self._animation_map = dict() for gid, frame_data in self.get_animations(): self._tracked_gids.add(gid) frames = list() for frame_gid, frame_duration in frame_data: image = self._get_tile_image_by_id(frame_gid) frames.append(AnimationFrame(image, frame_duration)) # the following line is slow when loading maps, but avoids overhead when rendering # positions = set(self.tmx.get_tile_locations_by_gid(gid)) # ideally, positions would be populated with all the known # locations of an animation, but searching for their locations # is slow. so it will be updated as the map is drawn. positions = set() ani = AnimationToken(positions, frames, self._last_time) self._animation_map[gid] = ani heappush(self._animation_queue, ani)
python
def reload_animations(self): self._update_time() self._animation_queue = list() self._tracked_gids = set() self._animation_map = dict() for gid, frame_data in self.get_animations(): self._tracked_gids.add(gid) frames = list() for frame_gid, frame_duration in frame_data: image = self._get_tile_image_by_id(frame_gid) frames.append(AnimationFrame(image, frame_duration)) # the following line is slow when loading maps, but avoids overhead when rendering # positions = set(self.tmx.get_tile_locations_by_gid(gid)) # ideally, positions would be populated with all the known # locations of an animation, but searching for their locations # is slow. so it will be updated as the map is drawn. positions = set() ani = AnimationToken(positions, frames, self._last_time) self._animation_map[gid] = ani heappush(self._animation_queue, ani)
[ "def", "reload_animations", "(", "self", ")", ":", "self", ".", "_update_time", "(", ")", "self", ".", "_animation_queue", "=", "list", "(", ")", "self", ".", "_tracked_gids", "=", "set", "(", ")", "self", ".", "_animation_map", "=", "dict", "(", ")", ...
Reload animation information PyscrollDataAdapter.get_animations must be implemented
[ "Reload", "animation", "information" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/data.py#L132-L161
24,575
bitcraft/pyscroll
pyscroll/data.py
PyscrollDataAdapter.get_tile_image
def get_tile_image(self, x, y, l): """ Get a tile image, respecting current animations :param x: x coordinate :param y: y coordinate :param l: layer :type x: int :type y: int :type l: int :rtype: pygame.Surface """ # disabled for now, re-enable when support for generic maps is restored # # since the tile has been queried, assume it wants to be checked # # for animations sometime in the future # if self._animation_queue: # self._tracked_tiles.add((x, y, l)) try: # animated, so return the correct frame return self._animated_tile[(x, y, l)] except KeyError: # not animated, so return surface from data, if any return self._get_tile_image(x, y, l)
python
def get_tile_image(self, x, y, l): # disabled for now, re-enable when support for generic maps is restored # # since the tile has been queried, assume it wants to be checked # # for animations sometime in the future # if self._animation_queue: # self._tracked_tiles.add((x, y, l)) try: # animated, so return the correct frame return self._animated_tile[(x, y, l)] except KeyError: # not animated, so return surface from data, if any return self._get_tile_image(x, y, l)
[ "def", "get_tile_image", "(", "self", ",", "x", ",", "y", ",", "l", ")", ":", "# disabled for now, re-enable when support for generic maps is restored", "# # since the tile has been queried, assume it wants to be checked", "# # for animations sometime in the future", "# if self._animat...
Get a tile image, respecting current animations :param x: x coordinate :param y: y coordinate :param l: layer :type x: int :type y: int :type l: int :rtype: pygame.Surface
[ "Get", "a", "tile", "image", "respecting", "current", "animations" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/data.py#L163-L189
24,576
bitcraft/pyscroll
pyscroll/data.py
PyscrollDataAdapter.get_tile_images_by_rect
def get_tile_images_by_rect(self, rect): """ Given a 2d area, return generator of tile images inside Given the coordinates, yield the following tuple for each tile: X, Y, Layer Number, pygame Surface This method also defines render order by re arranging the positions of each tile as it is yielded to the renderer. There is an optimization that you can make for your data: If you can provide access to tile information in a batch, then pyscroll can access data faster and render quicker. To implement this optimization, override this method. Not like python 'Range': should include the end index! :param rect: a rect-like object that defines tiles to draw :return: generator """ x1, y1, x2, y2 = rect_to_bb(rect) for layer in self.visible_tile_layers: for y, x in product(range(y1, y2 + 1), range(x1, x2 + 1)): tile = self.get_tile_image(x, y, layer) if tile: yield x, y, layer, tile
python
def get_tile_images_by_rect(self, rect): x1, y1, x2, y2 = rect_to_bb(rect) for layer in self.visible_tile_layers: for y, x in product(range(y1, y2 + 1), range(x1, x2 + 1)): tile = self.get_tile_image(x, y, layer) if tile: yield x, y, layer, tile
[ "def", "get_tile_images_by_rect", "(", "self", ",", "rect", ")", ":", "x1", ",", "y1", ",", "x2", ",", "y2", "=", "rect_to_bb", "(", "rect", ")", "for", "layer", "in", "self", ".", "visible_tile_layers", ":", "for", "y", ",", "x", "in", "product", "(...
Given a 2d area, return generator of tile images inside Given the coordinates, yield the following tuple for each tile: X, Y, Layer Number, pygame Surface This method also defines render order by re arranging the positions of each tile as it is yielded to the renderer. There is an optimization that you can make for your data: If you can provide access to tile information in a batch, then pyscroll can access data faster and render quicker. To implement this optimization, override this method. Not like python 'Range': should include the end index! :param rect: a rect-like object that defines tiles to draw :return: generator
[ "Given", "a", "2d", "area", "return", "generator", "of", "tile", "images", "inside" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/data.py#L251-L277
24,577
bitcraft/pyscroll
pyscroll/data.py
TiledMapData.convert_surfaces
def convert_surfaces(self, parent, alpha=False): """ Convert all images in the data to match the parent :param parent: pygame.Surface :param alpha: preserve alpha channel or not :return: None """ images = list() for i in self.tmx.images: try: if alpha: images.append(i.convert_alpha(parent)) else: images.append(i.convert(parent)) except AttributeError: images.append(None) self.tmx.images = images
python
def convert_surfaces(self, parent, alpha=False): images = list() for i in self.tmx.images: try: if alpha: images.append(i.convert_alpha(parent)) else: images.append(i.convert(parent)) except AttributeError: images.append(None) self.tmx.images = images
[ "def", "convert_surfaces", "(", "self", ",", "parent", ",", "alpha", "=", "False", ")", ":", "images", "=", "list", "(", ")", "for", "i", "in", "self", ".", "tmx", ".", "images", ":", "try", ":", "if", "alpha", ":", "images", ".", "append", "(", ...
Convert all images in the data to match the parent :param parent: pygame.Surface :param alpha: preserve alpha channel or not :return: None
[ "Convert", "all", "images", "in", "the", "data", "to", "match", "the", "parent" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/data.py#L301-L317
24,578
bitcraft/pyscroll
pyscroll/data.py
TiledMapData.visible_object_layers
def visible_object_layers(self): """ This must return layer objects This is not required for custom data formats. :return: Sequence of pytmx object layers/groups """ return (layer for layer in self.tmx.visible_layers if isinstance(layer, pytmx.TiledObjectGroup))
python
def visible_object_layers(self): return (layer for layer in self.tmx.visible_layers if isinstance(layer, pytmx.TiledObjectGroup))
[ "def", "visible_object_layers", "(", "self", ")", ":", "return", "(", "layer", "for", "layer", "in", "self", ".", "tmx", ".", "visible_layers", "if", "isinstance", "(", "layer", ",", "pytmx", ".", "TiledObjectGroup", ")", ")" ]
This must return layer objects This is not required for custom data formats. :return: Sequence of pytmx object layers/groups
[ "This", "must", "return", "layer", "objects" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/data.py#L344-L352
24,579
bitcraft/pyscroll
pyscroll/data.py
TiledMapData.get_tile_images_by_rect
def get_tile_images_by_rect(self, rect): """ Speed up data access More efficient because data is accessed and cached locally """ def rev(seq, start, stop): if start < 0: start = 0 return enumerate(seq[start:stop + 1], start) x1, y1, x2, y2 = rect_to_bb(rect) images = self.tmx.images layers = self.tmx.layers at = self._animated_tile tracked_gids = self._tracked_gids anim_map = self._animation_map track = bool(self._animation_queue) for l in self.tmx.visible_tile_layers: for y, row in rev(layers[l].data, y1, y2): for x, gid in [i for i in rev(row, x1, x2) if i[1]]: # since the tile has been queried, assume it wants to be checked # for animations sometime in the future if track and gid in tracked_gids: anim_map[gid].positions.add((x, y, l)) try: # animated, so return the correct frame yield x, y, l, at[(x, y, l)] except KeyError: # not animated, so return surface from data, if any yield x, y, l, images[gid]
python
def get_tile_images_by_rect(self, rect): def rev(seq, start, stop): if start < 0: start = 0 return enumerate(seq[start:stop + 1], start) x1, y1, x2, y2 = rect_to_bb(rect) images = self.tmx.images layers = self.tmx.layers at = self._animated_tile tracked_gids = self._tracked_gids anim_map = self._animation_map track = bool(self._animation_queue) for l in self.tmx.visible_tile_layers: for y, row in rev(layers[l].data, y1, y2): for x, gid in [i for i in rev(row, x1, x2) if i[1]]: # since the tile has been queried, assume it wants to be checked # for animations sometime in the future if track and gid in tracked_gids: anim_map[gid].positions.add((x, y, l)) try: # animated, so return the correct frame yield x, y, l, at[(x, y, l)] except KeyError: # not animated, so return surface from data, if any yield x, y, l, images[gid]
[ "def", "get_tile_images_by_rect", "(", "self", ",", "rect", ")", ":", "def", "rev", "(", "seq", ",", "start", ",", "stop", ")", ":", "if", "start", "<", "0", ":", "start", "=", "0", "return", "enumerate", "(", "seq", "[", "start", ":", "stop", "+",...
Speed up data access More efficient because data is accessed and cached locally
[ "Speed", "up", "data", "access" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/data.py#L370-L404
24,580
bitcraft/pyscroll
tutorial/quest.py
Hero.move_back
def move_back(self, dt): """ If called after an update, the sprite can move back """ self._position = self._old_position self.rect.topleft = self._position self.feet.midbottom = self.rect.midbottom
python
def move_back(self, dt): self._position = self._old_position self.rect.topleft = self._position self.feet.midbottom = self.rect.midbottom
[ "def", "move_back", "(", "self", ",", "dt", ")", ":", "self", ".", "_position", "=", "self", ".", "_old_position", "self", ".", "rect", ".", "topleft", "=", "self", ".", "_position", "self", ".", "feet", ".", "midbottom", "=", "self", ".", "rect", "....
If called after an update, the sprite can move back
[ "If", "called", "after", "an", "update", "the", "sprite", "can", "move", "back" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/tutorial/quest.py#L86-L91
24,581
bitcraft/pyscroll
tutorial/quest.py
QuestGame.handle_input
def handle_input(self): """ Handle pygame input events """ poll = pygame.event.poll event = poll() while event: if event.type == QUIT: self.running = False break elif event.type == KEYDOWN: if event.key == K_ESCAPE: self.running = False break elif event.key == K_EQUALS: self.map_layer.zoom += .25 elif event.key == K_MINUS: value = self.map_layer.zoom - .25 if value > 0: self.map_layer.zoom = value # this will be handled if the window is resized elif event.type == VIDEORESIZE: init_screen(event.w, event.h) self.map_layer.set_size((event.w, event.h)) event = poll() # using get_pressed is slightly less accurate than testing for events # but is much easier to use. pressed = pygame.key.get_pressed() if pressed[K_UP]: self.hero.velocity[1] = -HERO_MOVE_SPEED elif pressed[K_DOWN]: self.hero.velocity[1] = HERO_MOVE_SPEED else: self.hero.velocity[1] = 0 if pressed[K_LEFT]: self.hero.velocity[0] = -HERO_MOVE_SPEED elif pressed[K_RIGHT]: self.hero.velocity[0] = HERO_MOVE_SPEED else: self.hero.velocity[0] = 0
python
def handle_input(self): poll = pygame.event.poll event = poll() while event: if event.type == QUIT: self.running = False break elif event.type == KEYDOWN: if event.key == K_ESCAPE: self.running = False break elif event.key == K_EQUALS: self.map_layer.zoom += .25 elif event.key == K_MINUS: value = self.map_layer.zoom - .25 if value > 0: self.map_layer.zoom = value # this will be handled if the window is resized elif event.type == VIDEORESIZE: init_screen(event.w, event.h) self.map_layer.set_size((event.w, event.h)) event = poll() # using get_pressed is slightly less accurate than testing for events # but is much easier to use. pressed = pygame.key.get_pressed() if pressed[K_UP]: self.hero.velocity[1] = -HERO_MOVE_SPEED elif pressed[K_DOWN]: self.hero.velocity[1] = HERO_MOVE_SPEED else: self.hero.velocity[1] = 0 if pressed[K_LEFT]: self.hero.velocity[0] = -HERO_MOVE_SPEED elif pressed[K_RIGHT]: self.hero.velocity[0] = HERO_MOVE_SPEED else: self.hero.velocity[0] = 0
[ "def", "handle_input", "(", "self", ")", ":", "poll", "=", "pygame", ".", "event", ".", "poll", "event", "=", "poll", "(", ")", "while", "event", ":", "if", "event", ".", "type", "==", "QUIT", ":", "self", ".", "running", "=", "False", "break", "el...
Handle pygame input events
[ "Handle", "pygame", "input", "events" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/tutorial/quest.py#L149-L195
24,582
bitcraft/pyscroll
tutorial/quest.py
QuestGame.update
def update(self, dt): """ Tasks that occur over time should be handled here """ self.group.update(dt) # check if the sprite's feet are colliding with wall # sprite must have a rect called feet, and move_back method, # otherwise this will fail for sprite in self.group.sprites(): if sprite.feet.collidelist(self.walls) > -1: sprite.move_back(dt)
python
def update(self, dt): self.group.update(dt) # check if the sprite's feet are colliding with wall # sprite must have a rect called feet, and move_back method, # otherwise this will fail for sprite in self.group.sprites(): if sprite.feet.collidelist(self.walls) > -1: sprite.move_back(dt)
[ "def", "update", "(", "self", ",", "dt", ")", ":", "self", ".", "group", ".", "update", "(", "dt", ")", "# check if the sprite's feet are colliding with wall", "# sprite must have a rect called feet, and move_back method,", "# otherwise this will fail", "for", "sprite", "in...
Tasks that occur over time should be handled here
[ "Tasks", "that", "occur", "over", "time", "should", "be", "handled", "here" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/tutorial/quest.py#L197-L207
24,583
bitcraft/pyscroll
tutorial/quest.py
QuestGame.run
def run(self): """ Run the game loop """ clock = pygame.time.Clock() self.running = True from collections import deque times = deque(maxlen=30) try: while self.running: dt = clock.tick() / 1000. times.append(clock.get_fps()) # print(sum(times)/len(times)) self.handle_input() self.update(dt) self.draw(screen) pygame.display.flip() except KeyboardInterrupt: self.running = False
python
def run(self): clock = pygame.time.Clock() self.running = True from collections import deque times = deque(maxlen=30) try: while self.running: dt = clock.tick() / 1000. times.append(clock.get_fps()) # print(sum(times)/len(times)) self.handle_input() self.update(dt) self.draw(screen) pygame.display.flip() except KeyboardInterrupt: self.running = False
[ "def", "run", "(", "self", ")", ":", "clock", "=", "pygame", ".", "time", ".", "Clock", "(", ")", "self", ".", "running", "=", "True", "from", "collections", "import", "deque", "times", "=", "deque", "(", "maxlen", "=", "30", ")", "try", ":", "whil...
Run the game loop
[ "Run", "the", "game", "loop" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/tutorial/quest.py#L209-L230
24,584
bitcraft/pyscroll
pyscroll/group.py
PyscrollGroup.draw
def draw(self, surface): """ Draw all sprites and map onto the surface :param surface: pygame surface to draw to :type surface: pygame.surface.Surface """ ox, oy = self._map_layer.get_center_offset() new_surfaces = list() spritedict = self.spritedict gl = self.get_layer_of_sprite new_surfaces_append = new_surfaces.append for spr in self.sprites(): new_rect = spr.rect.move(ox, oy) try: new_surfaces_append((spr.image, new_rect, gl(spr), spr.blendmode)) except AttributeError: # generally should only fail when no blendmode available new_surfaces_append((spr.image, new_rect, gl(spr))) spritedict[spr] = new_rect self.lostsprites = [] return self._map_layer.draw(surface, surface.get_rect(), new_surfaces)
python
def draw(self, surface): ox, oy = self._map_layer.get_center_offset() new_surfaces = list() spritedict = self.spritedict gl = self.get_layer_of_sprite new_surfaces_append = new_surfaces.append for spr in self.sprites(): new_rect = spr.rect.move(ox, oy) try: new_surfaces_append((spr.image, new_rect, gl(spr), spr.blendmode)) except AttributeError: # generally should only fail when no blendmode available new_surfaces_append((spr.image, new_rect, gl(spr))) spritedict[spr] = new_rect self.lostsprites = [] return self._map_layer.draw(surface, surface.get_rect(), new_surfaces)
[ "def", "draw", "(", "self", ",", "surface", ")", ":", "ox", ",", "oy", "=", "self", ".", "_map_layer", ".", "get_center_offset", "(", ")", "new_surfaces", "=", "list", "(", ")", "spritedict", "=", "self", ".", "spritedict", "gl", "=", "self", ".", "g...
Draw all sprites and map onto the surface :param surface: pygame surface to draw to :type surface: pygame.surface.Surface
[ "Draw", "all", "sprites", "and", "map", "onto", "the", "surface" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/group.py#L34-L56
24,585
bitcraft/pyscroll
pyscroll/isometric.py
IsometricBufferedRenderer.center
def center(self, coords): """ center the map on a "map pixel" """ x, y = [round(i, 0) for i in coords] self.view_rect.center = x, y tw, th = self.data.tile_size left, ox = divmod(x, tw) top, oy = divmod(y, th) vec = int(ox / 2), int(oy) iso = vector2_to_iso(vec) self._x_offset = iso[0] self._y_offset = iso[1] print(self._tile_view.size) print(self._buffer.get_size()) # center the buffer on the screen self._x_offset += (self._buffer.get_width() - self.view_rect.width) // 2 self._y_offset += (self._buffer.get_height() - self.view_rect.height) // 4 # adjust the view if the view has changed without a redraw dx = int(left - self._tile_view.left) dy = int(top - self._tile_view.top) view_change = max(abs(dx), abs(dy)) # force redraw every time: edge queuing not supported yet self._redraw_cutoff = 0 if view_change and (view_change <= self._redraw_cutoff): self._buffer.scroll(-dx * tw, -dy * th) self._tile_view.move_ip(dx, dy) self._queue_edge_tiles(dx, dy) self._flush_tile_queue() elif view_change > self._redraw_cutoff: # logger.info('scrolling too quickly. redraw forced') self._tile_view.move_ip(dx, dy) self.redraw_tiles()
python
def center(self, coords): x, y = [round(i, 0) for i in coords] self.view_rect.center = x, y tw, th = self.data.tile_size left, ox = divmod(x, tw) top, oy = divmod(y, th) vec = int(ox / 2), int(oy) iso = vector2_to_iso(vec) self._x_offset = iso[0] self._y_offset = iso[1] print(self._tile_view.size) print(self._buffer.get_size()) # center the buffer on the screen self._x_offset += (self._buffer.get_width() - self.view_rect.width) // 2 self._y_offset += (self._buffer.get_height() - self.view_rect.height) // 4 # adjust the view if the view has changed without a redraw dx = int(left - self._tile_view.left) dy = int(top - self._tile_view.top) view_change = max(abs(dx), abs(dy)) # force redraw every time: edge queuing not supported yet self._redraw_cutoff = 0 if view_change and (view_change <= self._redraw_cutoff): self._buffer.scroll(-dx * tw, -dy * th) self._tile_view.move_ip(dx, dy) self._queue_edge_tiles(dx, dy) self._flush_tile_queue() elif view_change > self._redraw_cutoff: # logger.info('scrolling too quickly. redraw forced') self._tile_view.move_ip(dx, dy) self.redraw_tiles()
[ "def", "center", "(", "self", ",", "coords", ")", ":", "x", ",", "y", "=", "[", "round", "(", "i", ",", "0", ")", "for", "i", "in", "coords", "]", "self", ".", "view_rect", ".", "center", "=", "x", ",", "y", "tw", ",", "th", "=", "self", "....
center the map on a "map pixel"
[ "center", "the", "map", "on", "a", "map", "pixel" ]
b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f
https://github.com/bitcraft/pyscroll/blob/b41c1016dfefd0e2d83a14a2ce40d7ad298c5b0f/pyscroll/isometric.py#L86-L127
24,586
acsone/click-odoo
click_odoo/env_options.py
env_options.get_odoo_args
def get_odoo_args(self, ctx): """Return a list of Odoo command line arguments from the Click context.""" config = ctx.params.get("config") addons_path = ctx.params.get("addons_path") database = ctx.params.get("database") log_level = ctx.params.get("log_level") logfile = ctx.params.get("logfile") odoo_args = [] if config: odoo_args.extend(["--config", config]) if addons_path: odoo_args.extend(["--addons-path", addons_path]) if database: odoo_args.extend(["--database", database]) if log_level: odoo_args.extend(["--log-level", log_level]) if logfile: odoo_args.extend(["--logfile", logfile]) return odoo_args
python
def get_odoo_args(self, ctx): config = ctx.params.get("config") addons_path = ctx.params.get("addons_path") database = ctx.params.get("database") log_level = ctx.params.get("log_level") logfile = ctx.params.get("logfile") odoo_args = [] if config: odoo_args.extend(["--config", config]) if addons_path: odoo_args.extend(["--addons-path", addons_path]) if database: odoo_args.extend(["--database", database]) if log_level: odoo_args.extend(["--log-level", log_level]) if logfile: odoo_args.extend(["--logfile", logfile]) return odoo_args
[ "def", "get_odoo_args", "(", "self", ",", "ctx", ")", ":", "config", "=", "ctx", ".", "params", ".", "get", "(", "\"config\"", ")", "addons_path", "=", "ctx", ".", "params", ".", "get", "(", "\"addons_path\"", ")", "database", "=", "ctx", ".", "params"...
Return a list of Odoo command line arguments from the Click context.
[ "Return", "a", "list", "of", "Odoo", "command", "line", "arguments", "from", "the", "Click", "context", "." ]
7335f722bb6edbaf34cee29e027a49f47e83e052
https://github.com/acsone/click-odoo/blob/7335f722bb6edbaf34cee29e027a49f47e83e052/click_odoo/env_options.py#L123-L144
24,587
williamgilpin/pypdb
pypdb/pypdb.py
make_query
def make_query(search_term, querytype='AdvancedKeywordQuery'): ''' Repackage strings into a search dictionary This function takes a list of search terms and specifications and repackages it as a dictionary object that can be used to conduct a search Parameters ---------- search_term : str The specific term to search in the database. For specific query types, the strings that will yield valid results are limited to: 'HoldingsQuery' : A Ggeneral search of the metadata associated with PDB IDs 'ExpTypeQuery' : Experimental Method such as 'X-RAY', 'SOLID-STATE NMR', etc 'AdvancedKeywordQuery' : Any string that appears in the title or abstract 'StructureIdQuery' : Perform a search for a specific Structure ID 'ModifiedStructuresQuery' : Search for related structures 'AdvancedAuthorQuery' : Search by the names of authors associated with entries 'MotifQuery' : Search for a specific motif 'NoLigandQuery' : Find full list of PDB IDs without free ligrands querytype : str The type of query to perform, the easiest is an AdvancedKeywordQuery but more specific types of searches may also be performed Returns ------- scan_params : dict A dictionary representing the query Examples -------- This method usually gets used in tandem with do_search >>> a = make_query('actin network') >>> print (a) {'orgPdbQuery': {'description': 'Text Search for: actin', 'keywords': 'actin', 'queryType': 'AdvancedKeywordQuery'}} >>> search_dict = make_query('actin network') >>> found_pdbs = do_search(search_dict) >>> print(found_pdbs) ['1D7M', '3W3D', '4A7H', '4A7L', '4A7N'] >>> search_dict = make_query('T[AG]AGGY',querytype='MotifQuery') >>> found_pdbs = do_search(search_dict) >>> print(found_pdbs) ['3LEZ', '3SGH', '4F47'] ''' assert querytype in {'HoldingsQuery', 'ExpTypeQuery', 'AdvancedKeywordQuery','StructureIdQuery', 'ModifiedStructuresQuery', 'AdvancedAuthorQuery', 'MotifQuery', 'NoLigandQuery', 'PubmedIdQuery' }, 'Query type %s not supported yet' % querytype query_params = dict() query_params['queryType'] = querytype if querytype=='AdvancedKeywordQuery': query_params['description'] = 'Text Search for: '+ search_term query_params['keywords'] = search_term elif querytype=='NoLigandQuery': query_params['haveLigands'] = 'yes' elif querytype=='AdvancedAuthorQuery': query_params['description'] = 'Author Name: '+ search_term query_params['searchType'] = 'All Authors' query_params['audit_author.name'] = search_term query_params['exactMatch'] = 'false' elif querytype=='MotifQuery': query_params['description'] = 'Motif Query For: '+ search_term query_params['motif'] = search_term # search for a specific structure elif querytype in ['StructureIdQuery','ModifiedStructuresQuery']: query_params['structureIdList'] = search_term elif querytype=='ExpTypeQuery': query_params['experimentalMethod'] = search_term query_params['description'] = 'Experimental Method Search : Experimental Method='+ search_term query_params['mvStructure.expMethod.value']= search_term elif querytype=='PubmedIdQuery': query_params['description'] = 'Pubmed Id Search for Pubmed Id '+ search_term query_params['pubMedIdList'] = search_term scan_params = dict() scan_params['orgPdbQuery'] = query_params return scan_params
python
def make_query(search_term, querytype='AdvancedKeywordQuery'): ''' Repackage strings into a search dictionary This function takes a list of search terms and specifications and repackages it as a dictionary object that can be used to conduct a search Parameters ---------- search_term : str The specific term to search in the database. For specific query types, the strings that will yield valid results are limited to: 'HoldingsQuery' : A Ggeneral search of the metadata associated with PDB IDs 'ExpTypeQuery' : Experimental Method such as 'X-RAY', 'SOLID-STATE NMR', etc 'AdvancedKeywordQuery' : Any string that appears in the title or abstract 'StructureIdQuery' : Perform a search for a specific Structure ID 'ModifiedStructuresQuery' : Search for related structures 'AdvancedAuthorQuery' : Search by the names of authors associated with entries 'MotifQuery' : Search for a specific motif 'NoLigandQuery' : Find full list of PDB IDs without free ligrands querytype : str The type of query to perform, the easiest is an AdvancedKeywordQuery but more specific types of searches may also be performed Returns ------- scan_params : dict A dictionary representing the query Examples -------- This method usually gets used in tandem with do_search >>> a = make_query('actin network') >>> print (a) {'orgPdbQuery': {'description': 'Text Search for: actin', 'keywords': 'actin', 'queryType': 'AdvancedKeywordQuery'}} >>> search_dict = make_query('actin network') >>> found_pdbs = do_search(search_dict) >>> print(found_pdbs) ['1D7M', '3W3D', '4A7H', '4A7L', '4A7N'] >>> search_dict = make_query('T[AG]AGGY',querytype='MotifQuery') >>> found_pdbs = do_search(search_dict) >>> print(found_pdbs) ['3LEZ', '3SGH', '4F47'] ''' assert querytype in {'HoldingsQuery', 'ExpTypeQuery', 'AdvancedKeywordQuery','StructureIdQuery', 'ModifiedStructuresQuery', 'AdvancedAuthorQuery', 'MotifQuery', 'NoLigandQuery', 'PubmedIdQuery' }, 'Query type %s not supported yet' % querytype query_params = dict() query_params['queryType'] = querytype if querytype=='AdvancedKeywordQuery': query_params['description'] = 'Text Search for: '+ search_term query_params['keywords'] = search_term elif querytype=='NoLigandQuery': query_params['haveLigands'] = 'yes' elif querytype=='AdvancedAuthorQuery': query_params['description'] = 'Author Name: '+ search_term query_params['searchType'] = 'All Authors' query_params['audit_author.name'] = search_term query_params['exactMatch'] = 'false' elif querytype=='MotifQuery': query_params['description'] = 'Motif Query For: '+ search_term query_params['motif'] = search_term # search for a specific structure elif querytype in ['StructureIdQuery','ModifiedStructuresQuery']: query_params['structureIdList'] = search_term elif querytype=='ExpTypeQuery': query_params['experimentalMethod'] = search_term query_params['description'] = 'Experimental Method Search : Experimental Method='+ search_term query_params['mvStructure.expMethod.value']= search_term elif querytype=='PubmedIdQuery': query_params['description'] = 'Pubmed Id Search for Pubmed Id '+ search_term query_params['pubMedIdList'] = search_term scan_params = dict() scan_params['orgPdbQuery'] = query_params return scan_params
[ "def", "make_query", "(", "search_term", ",", "querytype", "=", "'AdvancedKeywordQuery'", ")", ":", "assert", "querytype", "in", "{", "'HoldingsQuery'", ",", "'ExpTypeQuery'", ",", "'AdvancedKeywordQuery'", ",", "'StructureIdQuery'", ",", "'ModifiedStructuresQuery'", ",...
Repackage strings into a search dictionary This function takes a list of search terms and specifications and repackages it as a dictionary object that can be used to conduct a search Parameters ---------- search_term : str The specific term to search in the database. For specific query types, the strings that will yield valid results are limited to: 'HoldingsQuery' : A Ggeneral search of the metadata associated with PDB IDs 'ExpTypeQuery' : Experimental Method such as 'X-RAY', 'SOLID-STATE NMR', etc 'AdvancedKeywordQuery' : Any string that appears in the title or abstract 'StructureIdQuery' : Perform a search for a specific Structure ID 'ModifiedStructuresQuery' : Search for related structures 'AdvancedAuthorQuery' : Search by the names of authors associated with entries 'MotifQuery' : Search for a specific motif 'NoLigandQuery' : Find full list of PDB IDs without free ligrands querytype : str The type of query to perform, the easiest is an AdvancedKeywordQuery but more specific types of searches may also be performed Returns ------- scan_params : dict A dictionary representing the query Examples -------- This method usually gets used in tandem with do_search >>> a = make_query('actin network') >>> print (a) {'orgPdbQuery': {'description': 'Text Search for: actin', 'keywords': 'actin', 'queryType': 'AdvancedKeywordQuery'}} >>> search_dict = make_query('actin network') >>> found_pdbs = do_search(search_dict) >>> print(found_pdbs) ['1D7M', '3W3D', '4A7H', '4A7L', '4A7N'] >>> search_dict = make_query('T[AG]AGGY',querytype='MotifQuery') >>> found_pdbs = do_search(search_dict) >>> print(found_pdbs) ['3LEZ', '3SGH', '4F47']
[ "Repackage", "strings", "into", "a", "search", "dictionary" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L51-L159
24,588
williamgilpin/pypdb
pypdb/pypdb.py
do_protsym_search
def do_protsym_search(point_group, min_rmsd=0.0, max_rmsd=7.0): '''Performs a protein symmetry search of the PDB This function can search the Protein Data Bank based on how closely entries match the user-specified symmetry group Parameters ---------- point_group : str The name of the symmetry point group to search. This includes all the standard abbreviations for symmetry point groups (e.g., C1, C2, D2, T, O, I, H, A1) min_rmsd : float The smallest allowed total deviation (in Angstroms) for a result to be classified as having a matching symmetry max_rmsd : float The largest allowed total deviation (in Angstroms) for a result to be classified as having a matching symmetry Returns ------- idlist : list of strings A list of PDB IDs resulting from the search Examples -------- >>> kk = do_protsym_search('C9', min_rmsd=0.0, max_rmsd=1.0) >>> print(kk[:5]) ['1KZU', '1NKZ', '2FKW', '3B8M', '3B8N'] ''' query_params = dict() query_params['queryType'] = 'PointGroupQuery' query_params['rMSDComparator'] = 'between' query_params['pointGroup'] = point_group query_params['rMSDMin'] = min_rmsd query_params['rMSDMax'] = max_rmsd scan_params = dict() scan_params['orgPdbQuery'] = query_params idlist = do_search(scan_params) return idlist
python
def do_protsym_search(point_group, min_rmsd=0.0, max_rmsd=7.0): '''Performs a protein symmetry search of the PDB This function can search the Protein Data Bank based on how closely entries match the user-specified symmetry group Parameters ---------- point_group : str The name of the symmetry point group to search. This includes all the standard abbreviations for symmetry point groups (e.g., C1, C2, D2, T, O, I, H, A1) min_rmsd : float The smallest allowed total deviation (in Angstroms) for a result to be classified as having a matching symmetry max_rmsd : float The largest allowed total deviation (in Angstroms) for a result to be classified as having a matching symmetry Returns ------- idlist : list of strings A list of PDB IDs resulting from the search Examples -------- >>> kk = do_protsym_search('C9', min_rmsd=0.0, max_rmsd=1.0) >>> print(kk[:5]) ['1KZU', '1NKZ', '2FKW', '3B8M', '3B8N'] ''' query_params = dict() query_params['queryType'] = 'PointGroupQuery' query_params['rMSDComparator'] = 'between' query_params['pointGroup'] = point_group query_params['rMSDMin'] = min_rmsd query_params['rMSDMax'] = max_rmsd scan_params = dict() scan_params['orgPdbQuery'] = query_params idlist = do_search(scan_params) return idlist
[ "def", "do_protsym_search", "(", "point_group", ",", "min_rmsd", "=", "0.0", ",", "max_rmsd", "=", "7.0", ")", ":", "query_params", "=", "dict", "(", ")", "query_params", "[", "'queryType'", "]", "=", "'PointGroupQuery'", "query_params", "[", "'rMSDComparator'",...
Performs a protein symmetry search of the PDB This function can search the Protein Data Bank based on how closely entries match the user-specified symmetry group Parameters ---------- point_group : str The name of the symmetry point group to search. This includes all the standard abbreviations for symmetry point groups (e.g., C1, C2, D2, T, O, I, H, A1) min_rmsd : float The smallest allowed total deviation (in Angstroms) for a result to be classified as having a matching symmetry max_rmsd : float The largest allowed total deviation (in Angstroms) for a result to be classified as having a matching symmetry Returns ------- idlist : list of strings A list of PDB IDs resulting from the search Examples -------- >>> kk = do_protsym_search('C9', min_rmsd=0.0, max_rmsd=1.0) >>> print(kk[:5]) ['1KZU', '1NKZ', '2FKW', '3B8M', '3B8N']
[ "Performs", "a", "protein", "symmetry", "search", "of", "the", "PDB" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L222-L270
24,589
williamgilpin/pypdb
pypdb/pypdb.py
get_all
def get_all(): """Return a list of all PDB entries currently in the RCSB Protein Data Bank Returns ------- out : list of str A list of all of the PDB IDs currently in the RCSB PDB Examples -------- >>> print(get_all()[:10]) ['100D', '101D', '101M', '102D', '102L', '102M', '103D', '103L', '103M', '104D'] """ url = 'http://www.rcsb.org/pdb/rest/getCurrent' req = urllib.request.Request(url) f = urllib.request.urlopen(req) result = f.read() assert result kk = str(result) p = re.compile('structureId=\"...."') matches = p.findall(str(result)) out = list() for item in matches: out.append(item[-5:-1]) return out
python
def get_all(): url = 'http://www.rcsb.org/pdb/rest/getCurrent' req = urllib.request.Request(url) f = urllib.request.urlopen(req) result = f.read() assert result kk = str(result) p = re.compile('structureId=\"...."') matches = p.findall(str(result)) out = list() for item in matches: out.append(item[-5:-1]) return out
[ "def", "get_all", "(", ")", ":", "url", "=", "'http://www.rcsb.org/pdb/rest/getCurrent'", "req", "=", "urllib", ".", "request", ".", "Request", "(", "url", ")", "f", "=", "urllib", ".", "request", ".", "urlopen", "(", "req", ")", "result", "=", "f", ".",...
Return a list of all PDB entries currently in the RCSB Protein Data Bank Returns ------- out : list of str A list of all of the PDB IDs currently in the RCSB PDB Examples -------- >>> print(get_all()[:10]) ['100D', '101D', '101M', '102D', '102L', '102M', '103D', '103L', '103M', '104D']
[ "Return", "a", "list", "of", "all", "PDB", "entries", "currently", "in", "the", "RCSB", "Protein", "Data", "Bank" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L273-L305
24,590
williamgilpin/pypdb
pypdb/pypdb.py
get_info
def get_info(pdb_id, url_root='http://www.rcsb.org/pdb/rest/describeMol?structureId='): '''Look up all information about a given PDB ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest url_root : string The string root of the specific url for the request type Returns ------- out : OrderedDict An ordered dictionary object corresponding to bare xml ''' url = url_root + pdb_id req = urllib.request.Request(url) f = urllib.request.urlopen(req) result = f.read() assert result out = xmltodict.parse(result,process_namespaces=True) return out
python
def get_info(pdb_id, url_root='http://www.rcsb.org/pdb/rest/describeMol?structureId='): '''Look up all information about a given PDB ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest url_root : string The string root of the specific url for the request type Returns ------- out : OrderedDict An ordered dictionary object corresponding to bare xml ''' url = url_root + pdb_id req = urllib.request.Request(url) f = urllib.request.urlopen(req) result = f.read() assert result out = xmltodict.parse(result,process_namespaces=True) return out
[ "def", "get_info", "(", "pdb_id", ",", "url_root", "=", "'http://www.rcsb.org/pdb/rest/describeMol?structureId='", ")", ":", "url", "=", "url_root", "+", "pdb_id", "req", "=", "urllib", ".", "request", ".", "Request", "(", "url", ")", "f", "=", "urllib", ".", ...
Look up all information about a given PDB ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest url_root : string The string root of the specific url for the request type Returns ------- out : OrderedDict An ordered dictionary object corresponding to bare xml
[ "Look", "up", "all", "information", "about", "a", "given", "PDB", "ID" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L313-L341
24,591
williamgilpin/pypdb
pypdb/pypdb.py
get_pdb_file
def get_pdb_file(pdb_id, filetype='pdb', compression=False): '''Get the full PDB file associated with a PDB_ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest filetype: string The file type. 'pdb' is the older file format, 'cif' is the newer replacement. 'xml' an also be obtained and parsed using the various xml tools included in PyPDB 'structfact' retrieves structure factors (only available for certain PDB entries) compression : bool Retrieve a compressed (gz) version of the file Returns ------- result : string The string representing the full PDB file in the given format Examples -------- >>> pdb_file = get_pdb_file('4lza', filetype='cif', compression=True) >>> print(pdb_file[:200]) data_4LZA # _entry.id 4LZA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 4.032 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx ''' full_url = "https://files.rcsb.org/download/" full_url += pdb_id if (filetype == 'structfact'): full_url += "-sf.cif" else: full_url += "." + filetype if compression: full_url += ".gz" else: pass req = urllib.request.Request(full_url) f = urllib.request.urlopen(req) result = f.read() if not compression: result = result.decode('ascii') else: pass return result
python
def get_pdb_file(pdb_id, filetype='pdb', compression=False): '''Get the full PDB file associated with a PDB_ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest filetype: string The file type. 'pdb' is the older file format, 'cif' is the newer replacement. 'xml' an also be obtained and parsed using the various xml tools included in PyPDB 'structfact' retrieves structure factors (only available for certain PDB entries) compression : bool Retrieve a compressed (gz) version of the file Returns ------- result : string The string representing the full PDB file in the given format Examples -------- >>> pdb_file = get_pdb_file('4lza', filetype='cif', compression=True) >>> print(pdb_file[:200]) data_4LZA # _entry.id 4LZA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 4.032 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx ''' full_url = "https://files.rcsb.org/download/" full_url += pdb_id if (filetype == 'structfact'): full_url += "-sf.cif" else: full_url += "." + filetype if compression: full_url += ".gz" else: pass req = urllib.request.Request(full_url) f = urllib.request.urlopen(req) result = f.read() if not compression: result = result.decode('ascii') else: pass return result
[ "def", "get_pdb_file", "(", "pdb_id", ",", "filetype", "=", "'pdb'", ",", "compression", "=", "False", ")", ":", "full_url", "=", "\"https://files.rcsb.org/download/\"", "full_url", "+=", "pdb_id", "if", "(", "filetype", "==", "'structfact'", ")", ":", "full_url...
Get the full PDB file associated with a PDB_ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest filetype: string The file type. 'pdb' is the older file format, 'cif' is the newer replacement. 'xml' an also be obtained and parsed using the various xml tools included in PyPDB 'structfact' retrieves structure factors (only available for certain PDB entries) compression : bool Retrieve a compressed (gz) version of the file Returns ------- result : string The string representing the full PDB file in the given format Examples -------- >>> pdb_file = get_pdb_file('4lza', filetype='cif', compression=True) >>> print(pdb_file[:200]) data_4LZA # _entry.id 4LZA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 4.032 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx
[ "Get", "the", "full", "PDB", "file", "associated", "with", "a", "PDB_ID" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L343-L406
24,592
williamgilpin/pypdb
pypdb/pypdb.py
get_all_info
def get_all_info(pdb_id): '''A wrapper for get_info that cleans up the output slighly Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing all the information stored in the entry Examples -------- >>> all_info = get_all_info('4lza') >>> print(all_info) {'polymer': {'macroMolecule': {'@name': 'Adenine phosphoribosyltransferase', ' accession': {'@id': 'B0K969'}}, '@entityNr': '1', '@type': 'protein', 'polymerDescription': {'@description': 'Adenine phosphoribosyltransferase'}, 'synonym': {'@name': 'APRT'}, '@length': '195', 'enzClass': {'@ec': '2.4.2.7'}, 'chain': [{'@id': 'A'}, {'@id': 'B'}], 'Taxonomy': {'@name': 'Thermoanaerobacter pseudethanolicus ATCC 33223', '@id': '340099'}, '@weight': '22023.9'}, 'id': '4LZA'} >>> results = get_all_info('2F5N') >>> first_polymer = results['polymer'][0] >>> first_polymer['polymerDescription'] {'@description': "5'-D(*AP*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3'"} ''' out = to_dict( get_info(pdb_id) )['molDescription']['structureId'] out = remove_at_sign(out) return out
python
def get_all_info(pdb_id): '''A wrapper for get_info that cleans up the output slighly Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing all the information stored in the entry Examples -------- >>> all_info = get_all_info('4lza') >>> print(all_info) {'polymer': {'macroMolecule': {'@name': 'Adenine phosphoribosyltransferase', ' accession': {'@id': 'B0K969'}}, '@entityNr': '1', '@type': 'protein', 'polymerDescription': {'@description': 'Adenine phosphoribosyltransferase'}, 'synonym': {'@name': 'APRT'}, '@length': '195', 'enzClass': {'@ec': '2.4.2.7'}, 'chain': [{'@id': 'A'}, {'@id': 'B'}], 'Taxonomy': {'@name': 'Thermoanaerobacter pseudethanolicus ATCC 33223', '@id': '340099'}, '@weight': '22023.9'}, 'id': '4LZA'} >>> results = get_all_info('2F5N') >>> first_polymer = results['polymer'][0] >>> first_polymer['polymerDescription'] {'@description': "5'-D(*AP*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3'"} ''' out = to_dict( get_info(pdb_id) )['molDescription']['structureId'] out = remove_at_sign(out) return out
[ "def", "get_all_info", "(", "pdb_id", ")", ":", "out", "=", "to_dict", "(", "get_info", "(", "pdb_id", ")", ")", "[", "'molDescription'", "]", "[", "'structureId'", "]", "out", "=", "remove_at_sign", "(", "out", ")", "return", "out" ]
A wrapper for get_info that cleans up the output slighly Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing all the information stored in the entry Examples -------- >>> all_info = get_all_info('4lza') >>> print(all_info) {'polymer': {'macroMolecule': {'@name': 'Adenine phosphoribosyltransferase', ' accession': {'@id': 'B0K969'}}, '@entityNr': '1', '@type': 'protein', 'polymerDescription': {'@description': 'Adenine phosphoribosyltransferase'}, 'synonym': {'@name': 'APRT'}, '@length': '195', 'enzClass': {'@ec': '2.4.2.7'}, 'chain': [{'@id': 'A'}, {'@id': 'B'}], 'Taxonomy': {'@name': 'Thermoanaerobacter pseudethanolicus ATCC 33223', '@id': '340099'}, '@weight': '22023.9'}, 'id': '4LZA'} >>> results = get_all_info('2F5N') >>> first_polymer = results['polymer'][0] >>> first_polymer['polymerDescription'] {'@description': "5'-D(*AP*GP*GP*TP*AP*GP*AP*CP*CP*TP*GP*GP*AP*CP*GP*C)-3'"}
[ "A", "wrapper", "for", "get_info", "that", "cleans", "up", "the", "output", "slighly" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L409-L445
24,593
williamgilpin/pypdb
pypdb/pypdb.py
get_raw_blast
def get_raw_blast(pdb_id, output_form='HTML', chain_id='A'): '''Look up full BLAST page for a given PDB ID get_blast() uses this function internally Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest chain_id : string A single character designating the chain ID of interest output_form : string TXT, HTML, or XML formatting of the outputs Returns ------- out : OrderedDict An ordered dictionary object corresponding to bare xml ''' url_root = 'http://www.rcsb.org/pdb/rest/getBlastPDB2?structureId=' url = url_root + pdb_id + '&chainId='+ chain_id +'&outputFormat=' + output_form req = urllib.request.Request(url) f = urllib.request.urlopen(req) result = f.read() result = result.decode('unicode_escape') assert result return result
python
def get_raw_blast(pdb_id, output_form='HTML', chain_id='A'): '''Look up full BLAST page for a given PDB ID get_blast() uses this function internally Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest chain_id : string A single character designating the chain ID of interest output_form : string TXT, HTML, or XML formatting of the outputs Returns ------- out : OrderedDict An ordered dictionary object corresponding to bare xml ''' url_root = 'http://www.rcsb.org/pdb/rest/getBlastPDB2?structureId=' url = url_root + pdb_id + '&chainId='+ chain_id +'&outputFormat=' + output_form req = urllib.request.Request(url) f = urllib.request.urlopen(req) result = f.read() result = result.decode('unicode_escape') assert result return result
[ "def", "get_raw_blast", "(", "pdb_id", ",", "output_form", "=", "'HTML'", ",", "chain_id", "=", "'A'", ")", ":", "url_root", "=", "'http://www.rcsb.org/pdb/rest/getBlastPDB2?structureId='", "url", "=", "url_root", "+", "pdb_id", "+", "'&chainId='", "+", "chain_id", ...
Look up full BLAST page for a given PDB ID get_blast() uses this function internally Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest chain_id : string A single character designating the chain ID of interest output_form : string TXT, HTML, or XML formatting of the outputs Returns ------- out : OrderedDict An ordered dictionary object corresponding to bare xml
[ "Look", "up", "full", "BLAST", "page", "for", "a", "given", "PDB", "ID" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L447-L481
24,594
williamgilpin/pypdb
pypdb/pypdb.py
parse_blast
def parse_blast(blast_string): '''Clean up HTML BLAST results This function requires BeautifulSoup and the re module It goes throught the complicated output returned by the BLAST search and provides a list of matches, as well as the raw text file showing the alignments for each of the matches. This function works best with HTML formatted Inputs ------ get_blast() uses this function internally Parameters ---------- blast_string : str A complete webpage of standard BLAST results Returns ------- out : 2-tuple A tuple consisting of a list of PDB matches, and a list of their alignment text files (unformatted) ''' soup = BeautifulSoup(str(blast_string), "html.parser") all_blasts = list() all_blast_ids = list() pattern = '></a>....:' prog = re.compile(pattern) for item in soup.find_all('pre'): if len(item.find_all('a'))==1: all_blasts.append(item) blast_id = re.findall(pattern, str(item) )[0][-5:-1] all_blast_ids.append(blast_id) out = (all_blast_ids, all_blasts) return out
python
def parse_blast(blast_string): '''Clean up HTML BLAST results This function requires BeautifulSoup and the re module It goes throught the complicated output returned by the BLAST search and provides a list of matches, as well as the raw text file showing the alignments for each of the matches. This function works best with HTML formatted Inputs ------ get_blast() uses this function internally Parameters ---------- blast_string : str A complete webpage of standard BLAST results Returns ------- out : 2-tuple A tuple consisting of a list of PDB matches, and a list of their alignment text files (unformatted) ''' soup = BeautifulSoup(str(blast_string), "html.parser") all_blasts = list() all_blast_ids = list() pattern = '></a>....:' prog = re.compile(pattern) for item in soup.find_all('pre'): if len(item.find_all('a'))==1: all_blasts.append(item) blast_id = re.findall(pattern, str(item) )[0][-5:-1] all_blast_ids.append(blast_id) out = (all_blast_ids, all_blasts) return out
[ "def", "parse_blast", "(", "blast_string", ")", ":", "soup", "=", "BeautifulSoup", "(", "str", "(", "blast_string", ")", ",", "\"html.parser\"", ")", "all_blasts", "=", "list", "(", ")", "all_blast_ids", "=", "list", "(", ")", "pattern", "=", "'></a>....:'",...
Clean up HTML BLAST results This function requires BeautifulSoup and the re module It goes throught the complicated output returned by the BLAST search and provides a list of matches, as well as the raw text file showing the alignments for each of the matches. This function works best with HTML formatted Inputs ------ get_blast() uses this function internally Parameters ---------- blast_string : str A complete webpage of standard BLAST results Returns ------- out : 2-tuple A tuple consisting of a list of PDB matches, and a list of their alignment text files (unformatted)
[ "Clean", "up", "HTML", "BLAST", "results" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L484-L528
24,595
williamgilpin/pypdb
pypdb/pypdb.py
get_blast2
def get_blast2(pdb_id, chain_id='A', output_form='HTML'): '''Alternative way to look up BLAST for a given PDB ID. This function is a wrapper for get_raw_blast and parse_blast Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest chain_id : string A single character designating the chain ID of interest output_form : string TXT, HTML, or XML formatting of the BLAST page Returns ------- out : 2-tuple A tuple consisting of a list of PDB matches, and a list of their alignment text files (unformatted) Examples -------- >>> blast_results = get_blast2('2F5N', chain_id='A', output_form='HTML') >>> print('Total Results: ' + str(len(blast_results[0])) +'\n') >>> print(blast_results[1][0]) Total Results: 84 <pre> &gt;<a name="45354"></a>2F5P:3:A|pdbid|entity|chain(s)|sequence Length = 274 Score = 545 bits (1404), Expect = e-155, Method: Composition-based stats. Identities = 274/274 (100%), Positives = 274/274 (100%) Query: 1 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK 60 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK Sbjct: 1 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK 60 ... ''' raw_results = get_raw_blast(pdb_id, chain_id=chain_id, output_form=output_form) out = parse_blast(raw_results) return out
python
def get_blast2(pdb_id, chain_id='A', output_form='HTML'): '''Alternative way to look up BLAST for a given PDB ID. This function is a wrapper for get_raw_blast and parse_blast Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest chain_id : string A single character designating the chain ID of interest output_form : string TXT, HTML, or XML formatting of the BLAST page Returns ------- out : 2-tuple A tuple consisting of a list of PDB matches, and a list of their alignment text files (unformatted) Examples -------- >>> blast_results = get_blast2('2F5N', chain_id='A', output_form='HTML') >>> print('Total Results: ' + str(len(blast_results[0])) +'\n') >>> print(blast_results[1][0]) Total Results: 84 <pre> &gt;<a name="45354"></a>2F5P:3:A|pdbid|entity|chain(s)|sequence Length = 274 Score = 545 bits (1404), Expect = e-155, Method: Composition-based stats. Identities = 274/274 (100%), Positives = 274/274 (100%) Query: 1 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK 60 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK Sbjct: 1 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK 60 ... ''' raw_results = get_raw_blast(pdb_id, chain_id=chain_id, output_form=output_form) out = parse_blast(raw_results) return out
[ "def", "get_blast2", "(", "pdb_id", ",", "chain_id", "=", "'A'", ",", "output_form", "=", "'HTML'", ")", ":", "raw_results", "=", "get_raw_blast", "(", "pdb_id", ",", "chain_id", "=", "chain_id", ",", "output_form", "=", "output_form", ")", "out", "=", "pa...
Alternative way to look up BLAST for a given PDB ID. This function is a wrapper for get_raw_blast and parse_blast Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest chain_id : string A single character designating the chain ID of interest output_form : string TXT, HTML, or XML formatting of the BLAST page Returns ------- out : 2-tuple A tuple consisting of a list of PDB matches, and a list of their alignment text files (unformatted) Examples -------- >>> blast_results = get_blast2('2F5N', chain_id='A', output_form='HTML') >>> print('Total Results: ' + str(len(blast_results[0])) +'\n') >>> print(blast_results[1][0]) Total Results: 84 <pre> &gt;<a name="45354"></a>2F5P:3:A|pdbid|entity|chain(s)|sequence Length = 274 Score = 545 bits (1404), Expect = e-155, Method: Composition-based stats. Identities = 274/274 (100%), Positives = 274/274 (100%) Query: 1 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK 60 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK Sbjct: 1 MPELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQTVRGLERRGK 60 ...
[ "Alternative", "way", "to", "look", "up", "BLAST", "for", "a", "given", "PDB", "ID", ".", "This", "function", "is", "a", "wrapper", "for", "get_raw_blast", "and", "parse_blast" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L531-L576
24,596
williamgilpin/pypdb
pypdb/pypdb.py
describe_pdb
def describe_pdb(pdb_id): """Get description and metadata of a PDB entry Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : string A text pdb description from PDB Examples -------- >>> describe_pdb('4lza') {'citation_authors': 'Malashkevich, V.N., Bhosle, R., Toro, R., Hillerich, B., Gizzi, A., Garforth, S., Kar, A., Chan, M.K., Lafluer, J., Patel, H., Matikainen, B., Chamala, S., Lim, S., Celikgil, A., Villegas, G., Evans, B., Love, J., Fiser, A., Khafizov, K., Seidel, R., Bonanno, J.B., Almo, S.C.', 'deposition_date': '2013-07-31', 'expMethod': 'X-RAY DIFFRACTION', 'keywords': 'TRANSFERASE', 'last_modification_date': '2013-08-14', 'nr_atoms': '0', 'nr_entities': '1', 'nr_residues': '390', 'release_date': '2013-08-14', 'resolution': '1.84', 'status': 'CURRENT', 'structureId': '4LZA', 'structure_authors': 'Malashkevich, V.N., Bhosle, R., Toro, R., Hillerich, B., Gizzi, A., Garforth, S., Kar, A., Chan, M.K., Lafluer, J., Patel, H., Matikainen, B., Chamala, S., Lim, S., Celikgil, A., Villegas, G., Evans, B., Love, J., Fiser, A., Khafizov, K., Seidel, R., Bonanno, J.B., Almo, S.C., New York Structural Genomics Research Consortium (NYSGRC)', 'title': 'Crystal structure of adenine phosphoribosyltransferase from Thermoanaerobacter pseudethanolicus ATCC 33223, NYSGRC Target 029700.'} """ out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/describePDB?structureId=') out = to_dict(out) out = remove_at_sign(out['PDBdescription']['PDB']) return out
python
def describe_pdb(pdb_id): out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/describePDB?structureId=') out = to_dict(out) out = remove_at_sign(out['PDBdescription']['PDB']) return out
[ "def", "describe_pdb", "(", "pdb_id", ")", ":", "out", "=", "get_info", "(", "pdb_id", ",", "url_root", "=", "'http://www.rcsb.org/pdb/rest/describePDB?structureId='", ")", "out", "=", "to_dict", "(", "out", ")", "out", "=", "remove_at_sign", "(", "out", "[", ...
Get description and metadata of a PDB entry Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : string A text pdb description from PDB Examples -------- >>> describe_pdb('4lza') {'citation_authors': 'Malashkevich, V.N., Bhosle, R., Toro, R., Hillerich, B., Gizzi, A., Garforth, S., Kar, A., Chan, M.K., Lafluer, J., Patel, H., Matikainen, B., Chamala, S., Lim, S., Celikgil, A., Villegas, G., Evans, B., Love, J., Fiser, A., Khafizov, K., Seidel, R., Bonanno, J.B., Almo, S.C.', 'deposition_date': '2013-07-31', 'expMethod': 'X-RAY DIFFRACTION', 'keywords': 'TRANSFERASE', 'last_modification_date': '2013-08-14', 'nr_atoms': '0', 'nr_entities': '1', 'nr_residues': '390', 'release_date': '2013-08-14', 'resolution': '1.84', 'status': 'CURRENT', 'structureId': '4LZA', 'structure_authors': 'Malashkevich, V.N., Bhosle, R., Toro, R., Hillerich, B., Gizzi, A., Garforth, S., Kar, A., Chan, M.K., Lafluer, J., Patel, H., Matikainen, B., Chamala, S., Lim, S., Celikgil, A., Villegas, G., Evans, B., Love, J., Fiser, A., Khafizov, K., Seidel, R., Bonanno, J.B., Almo, S.C., New York Structural Genomics Research Consortium (NYSGRC)', 'title': 'Crystal structure of adenine phosphoribosyltransferase from Thermoanaerobacter pseudethanolicus ATCC 33223, NYSGRC Target 029700.'}
[ "Get", "description", "and", "metadata", "of", "a", "PDB", "entry" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L578-L615
24,597
williamgilpin/pypdb
pypdb/pypdb.py
get_entity_info
def get_entity_info(pdb_id): """Return pdb id information Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing a description the entry Examples -------- >>> get_entity_info('4lza') {'Entity': {'@id': '1', '@type': 'protein', 'Chain': [{'@id': 'A'}, {'@id': 'B'}]}, 'Method': {'@name': 'xray'}, 'bioAssemblies': '1', 'release_date': 'Wed Aug 14 00:00:00 PDT 2013', 'resolution': '1.84', 'structureId': '4lza'} """ out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/getEntityInfo?structureId=') out = to_dict(out) return remove_at_sign( out['entityInfo']['PDB'] )
python
def get_entity_info(pdb_id): out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/getEntityInfo?structureId=') out = to_dict(out) return remove_at_sign( out['entityInfo']['PDB'] )
[ "def", "get_entity_info", "(", "pdb_id", ")", ":", "out", "=", "get_info", "(", "pdb_id", ",", "url_root", "=", "'http://www.rcsb.org/pdb/rest/getEntityInfo?structureId='", ")", "out", "=", "to_dict", "(", "out", ")", "return", "remove_at_sign", "(", "out", "[", ...
Return pdb id information Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing a description the entry Examples -------- >>> get_entity_info('4lza') {'Entity': {'@id': '1', '@type': 'protein', 'Chain': [{'@id': 'A'}, {'@id': 'B'}]}, 'Method': {'@name': 'xray'}, 'bioAssemblies': '1', 'release_date': 'Wed Aug 14 00:00:00 PDT 2013', 'resolution': '1.84', 'structureId': '4lza'}
[ "Return", "pdb", "id", "information" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L617-L647
24,598
williamgilpin/pypdb
pypdb/pypdb.py
get_ligands
def get_ligands(pdb_id): """Return ligands of given PDB ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing a list of ligands associated with the entry Examples -------- >>> ligand_dict = get_ligands('100D') >>> print(ligand_dict) {'id': '100D', 'ligandInfo': {'ligand': {'@chemicalID': 'SPM', '@molecularWeight': '202.34', '@structureId': '100D', '@type': 'non-polymer', 'InChI': 'InChI=1S/C10H26N4/c11-5-3-9-13-7-1-2-8-14-10-4-6-12/h13-14H,1-12H2', 'InChIKey': 'PFNFFQXMRSDOHW-UHFFFAOYSA-N', 'chemicalName': 'SPERMINE', 'formula': 'C10 H26 N4', 'smiles': 'C(CCNCCCN)CNCCCN'}}} """ out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/ligandInfo?structureId=') out = to_dict(out) return remove_at_sign(out['structureId'])
python
def get_ligands(pdb_id): out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/ligandInfo?structureId=') out = to_dict(out) return remove_at_sign(out['structureId'])
[ "def", "get_ligands", "(", "pdb_id", ")", ":", "out", "=", "get_info", "(", "pdb_id", ",", "url_root", "=", "'http://www.rcsb.org/pdb/rest/ligandInfo?structureId='", ")", "out", "=", "to_dict", "(", "out", ")", "return", "remove_at_sign", "(", "out", "[", "'stru...
Return ligands of given PDB ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing a list of ligands associated with the entry Examples -------- >>> ligand_dict = get_ligands('100D') >>> print(ligand_dict) {'id': '100D', 'ligandInfo': {'ligand': {'@chemicalID': 'SPM', '@molecularWeight': '202.34', '@structureId': '100D', '@type': 'non-polymer', 'InChI': 'InChI=1S/C10H26N4/c11-5-3-9-13-7-1-2-8-14-10-4-6-12/h13-14H,1-12H2', 'InChIKey': 'PFNFFQXMRSDOHW-UHFFFAOYSA-N', 'chemicalName': 'SPERMINE', 'formula': 'C10 H26 N4', 'smiles': 'C(CCNCCCN)CNCCCN'}}}
[ "Return", "ligands", "of", "given", "PDB", "ID" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L681-L715
24,599
williamgilpin/pypdb
pypdb/pypdb.py
get_gene_onto
def get_gene_onto(pdb_id): """Return ligands of given PDB_ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing the gene ontology information associated with the entry Examples -------- >>> gene_info = get_gene_onto('4Z0L') >>> print(gene_info['term'][0]) {'@chainId': 'A', '@id': 'GO:0001516', '@structureId': '4Z0L', 'detail': {'@definition': 'The chemical reactions and pathways resulting ' 'in the formation of prostaglandins, any of a ' 'group of biologically active metabolites which ' 'contain a cyclopentane ring.', '@name': 'prostaglandin biosynthetic process', '@ontology': 'B', '@synonyms': 'prostaglandin anabolism, prostaglandin ' 'biosynthesis, prostaglandin formation, ' 'prostaglandin synthesis'}} """ out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/goTerms?structureId=') out = to_dict(out) if not out['goTerms']: return None out = remove_at_sign(out['goTerms']) return out
python
def get_gene_onto(pdb_id): out = get_info(pdb_id, url_root = 'http://www.rcsb.org/pdb/rest/goTerms?structureId=') out = to_dict(out) if not out['goTerms']: return None out = remove_at_sign(out['goTerms']) return out
[ "def", "get_gene_onto", "(", "pdb_id", ")", ":", "out", "=", "get_info", "(", "pdb_id", ",", "url_root", "=", "'http://www.rcsb.org/pdb/rest/goTerms?structureId='", ")", "out", "=", "to_dict", "(", "out", ")", "if", "not", "out", "[", "'goTerms'", "]", ":", ...
Return ligands of given PDB_ID Parameters ---------- pdb_id : string A 4 character string giving a pdb entry of interest Returns ------- out : dict A dictionary containing the gene ontology information associated with the entry Examples -------- >>> gene_info = get_gene_onto('4Z0L') >>> print(gene_info['term'][0]) {'@chainId': 'A', '@id': 'GO:0001516', '@structureId': '4Z0L', 'detail': {'@definition': 'The chemical reactions and pathways resulting ' 'in the formation of prostaglandins, any of a ' 'group of biologically active metabolites which ' 'contain a cyclopentane ring.', '@name': 'prostaglandin biosynthetic process', '@ontology': 'B', '@synonyms': 'prostaglandin anabolism, prostaglandin ' 'biosynthesis, prostaglandin formation, ' 'prostaglandin synthesis'}}
[ "Return", "ligands", "of", "given", "PDB_ID" ]
bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15
https://github.com/williamgilpin/pypdb/blob/bfb9e1b15b4ad097c5add50c4c176ac6cb28ee15/pypdb/pypdb.py#L717-L755