source stringlengths 31 227 | text stringlengths 9 2k |
|---|---|
https://en.wikipedia.org/wiki/Capped%20square%20antiprismatic%20molecular%20geometry | In chemistry, the capped square antiprismatic molecular geometry describes the shape of compounds where nine atoms, groups of atoms, or ligands are arranged around a central atom, defining the vertices of a gyroelongated square pyramid.
The gyroelongated square pyramid is a square pyramid with a square antiprism conne... |
https://en.wikipedia.org/wiki/Doubly%20special%20relativity | Doubly special relativity (DSR) – also called deformed special relativity or, by some, extra-special relativity – is a modified theory of special relativity in which there is not only an observer-independent maximum velocity (the speed of light), but also, an observer-independent maximum energy scale (the Planck energy... |
https://en.wikipedia.org/wiki/Cleavage%20%28crystal%29 | Cleavage, in mineralogy and materials science, is the tendency of crystalline materials to split along definite crystallographic structural planes. These planes of relative weakness are a result of the regular locations of atoms and ions in the crystal, which create smooth repeating surfaces that are visible both in th... |
https://en.wikipedia.org/wiki/Robert%20Kennedy%20%28chemist%29 | Robert Travis Kennedy (born 1962) is an American chemist specializing in bioanalytical chemistry including liquid chromatography, capillary electrophoresis, and microfluidics. He is currently the Hobart H. Willard Distinguished University Professor of Chemistry and the chair of the department of chemistry at the Univer... |
https://en.wikipedia.org/wiki/Type%20VI%20secretion%20system | The type VI secretion system (T6SS) is molecular machine used by a wide range of Gram-negative bacterial species to transport effectors from the interior (cytoplasm or cytosol) of a bacterial cell across the cellular envelope into an adjacent target cell. While often reported that the T6SS was discovered in 2006 by res... |
https://en.wikipedia.org/wiki/Lettering | Lettering is an umbrella term that covers the art of drawing letters, instead of simply writing them. Lettering is considered an art form, where each letter in a phrase or quote acts as an illustration. Each letter is created with attention to detail and has a unique role within a composition. Lettering is created as a... |
https://en.wikipedia.org/wiki/Anaphase%20lag | Anaphase lag is a consequence of an event during cell division where sister chromatids do not properly separate from each other because of improper spindle formation. The chromosome or chromatid does not properly migrate during anaphase and the daughter cells will lose some genetic information. It is one of many causes... |
https://en.wikipedia.org/wiki/Scalar%20%28physics%29 | In physics, scalars (or scalar quantities) are physical quantities that are unaffected by changes to a vector space basis (i.e., a coordinate system transformation). Scalars are often accompanied by units of measurement, as in "10cm".
Examples of scalar quantities are mass, distance, charge, volume, time, speed, and t... |
https://en.wikipedia.org/wiki/MAJC | MAJC (Microprocessor Architecture for Java Computing) was a Sun Microsystems multi-core, multithreaded, very long instruction word (VLIW) microprocessor design from the mid-to-late 1990s. Originally called the UltraJava processor, the MAJC processor was targeted at running Java programs, whose "late compiling" allowed... |
https://en.wikipedia.org/wiki/Vibrio%20cholerae | Vibrio cholerae is a species of Gram-negative, facultative anaerobe and comma-shaped bacteria. The bacteria naturally live in brackish or saltwater where they attach themselves easily to the chitin-containing shells of crabs, shrimp, and other shellfish. Some strains of V. cholerae are pathogenic to humans and cause a ... |
https://en.wikipedia.org/wiki/Peer%20Distributed%20Transfer%20Protocol | The Peer Distributed Transfer Protocol is an Internet file transfer protocol for distributing files from a central server across a peer-to-peer network. It is conceptually similar to BitTorrent but allows for streaming media. The protocol has been assigned port 6086 by the Internet Assigned Numbers Authority. The pr... |
https://en.wikipedia.org/wiki/Set%20TSP%20problem | In combinatorial optimization, the set TSP, also known as the generalized TSP, group TSP, One-of-a-Set TSP, Multiple Choice TSP or Covering Salesman Problem, is a generalization of the traveling salesman problem (TSP), whereby it is required to find a shortest tour in a graph which visits all specified subsets of the v... |
https://en.wikipedia.org/wiki/The%20Equidistribution%20of%20Lattice%20Shapes%20of%20Rings%20of%20Integers%20of%20Cubic%2C%20Quartic%2C%20and%20Quintic%20Number%20Fields | The Equidistribution of Lattice Shapes of Rings of Integers of Cubic, Quartic, and Quintic Number Fields: An Artist's Rendering is a mathematics book by Piper Harron (also known as Piper H), based on her Princeton University doctoral thesis of the same title. It has been described as "feminist", "unique", "honest", "ge... |
https://en.wikipedia.org/wiki/List%20of%20feeding%20behaviours | Feeding is the process by which organisms, typically animals, obtain food. Terminology often uses either the suffixes -vore, -vory, or -vorous from Latin vorare, meaning "to devour", or -phage, -phagy, or -phagous from Greek φαγεῖν (), meaning "to eat".
Evolutionary history
The evolution of feeding is varied with some... |
https://en.wikipedia.org/wiki/Cauchy%E2%80%93Born%20rule | The Cauchy–Born rule or Cauchy–Born approximation is a basic hypothesis used in the mathematical formulation of solid mechanics which relates the movement of atoms in a crystal to the overall deformation of the bulk solid. It states that in a crystalline solid subject to a small strain, the positions of the atoms withi... |
https://en.wikipedia.org/wiki/Forest%20reproductive%20material | Forest reproductive material is a part of a tree that can be used for reproduction such as seed, cutting or seedling. Artificial regeneration, carried out through seeding or planting, typically involves transferring forest reproductive material to a particular site from other locations while natural regeneration relie... |
https://en.wikipedia.org/wiki/Bright%20Computing | Bright Computing, Inc. is a developer of software for deploying and managing high-performance (HPC) clusters, Kubernetes clusters, and OpenStack private clouds in on-premises data centers as well as in the public cloud.
History
Bright Computing was founded by Matthijs van Leeuwen in 2009, who spun the company out of ... |
https://en.wikipedia.org/wiki/RKM%20code | The RKM code, also referred to as "letter and numeral code for resistance and capacitance values and tolerances", "letter and digit code for resistance and capacitance values and tolerances", or informally as "R notation" is a notation to specify resistor and capacitor values defined in the international standard IEC 6... |
https://en.wikipedia.org/wiki/Trachylepis%20tschudii | Trachylepis tschudii is an enigmatic skink, purportedly from Peru. First described in 1845 on the basis of a single specimen, it may be the same as the Noronha skink (T. atlantica) from Fernando de Noronha, off northeastern Brazil. T. tschudii represents one of two doubtful records of the otherwise African genus Trachy... |
https://en.wikipedia.org/wiki/Louis%20Essen | Louis Essen OBE FRS(6 September 1908 – 24 August 1997) was an English physicist whose most notable achievements were in the precise measurement of time and the determination of the speed of light. He was a critic of Albert Einstein's theory of relativity, particularly as it related to time dilation.
Early work
Born i... |
https://en.wikipedia.org/wiki/Latency%20oriented%20processor%20architecture | Latency oriented processor architecture is the microarchitecture of a microprocessor designed to serve a serial computing thread with a low latency. This is typical of most central processing units (CPU) being developed since the 1970s. These architectures, in general, aim to execute as many instructions as possible be... |
https://en.wikipedia.org/wiki/Movile%20Cave | Movile Cave () is a cave near Mangalia, Constanța County, Romania discovered in 1986 by Cristian Lascu a few kilometers from the Black Sea coast. It is notable for its unique groundwater ecosystem abundant in hydrogen sulfide and carbon dioxide, but low in oxygen. Life in the cave has been separated from the outside fo... |
https://en.wikipedia.org/wiki/High%20Assurance%20Internet%20Protocol%20Encryptor | A High Assurance Internet Protocol Encryptor (HAIPE) is a Type 1 encryption device that complies with the National Security Agency's HAIPE IS (formerly the HAIPIS, the High Assurance Internet Protocol Interoperability Specification). The cryptography used is Suite A and Suite B, also specified by the NSA as part of th... |
https://en.wikipedia.org/wiki/Chlorophycean%20mitochondrial%20code | The chlorophycean mitochondrial code (translation table 16) is a genetic code found in the mitochondria of Chlorophyceae.
Code
AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCA... |
https://en.wikipedia.org/wiki/Promoter%20based%20genetic%20algorithm | The promoter based genetic algorithm (PBGA) is a genetic algorithm for neuroevolution developed by F. Bellas and R.J. Duro in the Integrated Group for Engineering Research (GII) at the University of Coruña, in Spain. It evolves variable size feedforward artificial neural networks (ANN) that are encoded into sequences o... |
https://en.wikipedia.org/wiki/Centuria%20Insectorum | (Latin, "one hundred insects") is a 1763 taxonomic work by Carl Linnaeus, and defended as a thesis by Boas Johansson; which of the two men should for taxonomic purposes be credited with its authorship has been the subject of some controversy. It includes descriptions of 102 new insect and crustacean species that had be... |
https://en.wikipedia.org/wiki/Dual%20code | In coding theory, the dual code of a linear code
is the linear code defined by
where
is a scalar product. In linear algebra terms, the dual code is the annihilator of C with respect to the bilinear form . The dimension of C and its dual always add up to the length n:
A generator matrix for the dual code is the par... |
https://en.wikipedia.org/wiki/Assembly%20language | In computer programming, assembly language (alternatively assembler language or symbolic machine code), often referred to simply as assembly and commonly abbreviated as ASM or asm, is any low-level programming language with a very strong correspondence between the instructions in the language and the architecture's ma... |
https://en.wikipedia.org/wiki/Tacheometry | Tacheometry (; from Greek for "quick measure") is a system of rapid surveying, by which the horizontal and vertical positions of points on the earth's surface relative to one another are determined without using a chain or tape, or a separate levelling instrument.
Instead of the pole normally employed to mark a point, ... |
https://en.wikipedia.org/wiki/Applied%20spectroscopy | Applied spectroscopy is the application of various spectroscopic methods for the detection and identification of different elements or compounds to solve problems in fields like forensics, medicine, the oil industry, atmospheric chemistry, and pharmacology.
Spectroscopic methods
A common spectroscopic method for anal... |
https://en.wikipedia.org/wiki/International%20Conference%20on%20Nitride%20Semiconductors | The International Conference on Nitride Semiconductors (ICNS) is a major academic conference and exhibition in the field of group III nitride research. It has been held biennially since 1995. Since the second conference in 1997, hosting of the event has rotated between the Asian, European and North American continents.... |
https://en.wikipedia.org/wiki/Volodymyr%20Savchenko%20%28writer%29 | Vladimir Ivanovich Savchenko (; ) was a Soviet Ukrainian science fiction writer and engineer.
Born on February 15, 1933, in Poltava, he studied at the Moscow Power Engineering Institute and was an electronics engineer. Savchenko, who wrote in Russian , published his first short stories in the late 1950s, and his first... |
https://en.wikipedia.org/wiki/Max%20Abraham | Max Abraham (; 26 March 1875 – 16 November 1922) was a German physicist known for his work on electromagnetism and his opposition to the theory of relativity.
Biography
Abraham was born in Danzig, Imperial Germany (now Gdańsk in Poland) to a family of Jewish merchants. His father was Moritz Abraham and his mother was... |
https://en.wikipedia.org/wiki/Franco-British%20Nuclear%20Forum | The first meeting of the Franco–British Nuclear Forum was held in Paris in November 2007, chaired by the Minister for Energy and the French Industry Minister. The working groups are focusing on specific areas for collaboration. A follow-up meeting on the issue in London was planned for March 2008, but did not take plac... |
https://en.wikipedia.org/wiki/Endocannabinoid%20system | The endocannabinoid system (ECS) is a biological system composed of endocannabinoids, which are endogenous lipid-based retrograde neurotransmitters that bind to cannabinoid receptors (CBRs), and cannabinoid receptor proteins that are expressed throughout the vertebrate central nervous system (including the brain) and p... |
https://en.wikipedia.org/wiki/Coating | A coating is a covering that is applied to the surface of an object, usually referred to as the substrate. The purpose of applying the coating may be decorative, functional, or both. Coatings may be applied as liquids, gases or solids e.g. Powder coatings.
Paints and lacquers are coatings that mostly have dual uses, w... |
https://en.wikipedia.org/wiki/MyGrid | The myGrid consortium produces and uses a suite of tools design to “help e-Scientists get on with science and get on with scientists”. The tools support the creation of e-laboratories and have been used in domains as diverse as systems biology, social science, music, astronomy, multimedia and chemistry.
The consortiu... |
https://en.wikipedia.org/wiki/Section%20formula | In coordinate geometry, Section formula is used to find the ratio in which a line segment is divided by a point internally or externally. It is used to find out the centroid, incenter and excenters of a triangle. In physics, it is used to find the center of mass of systems, equilibrium points, etc.
Internal Divisions... |
https://en.wikipedia.org/wiki/Splanchnic | Splanchnic is usually used to describe organs in the abdominal cavity.
It is used when describing:
Splanchnic tissue
Splanchnic organs - including the stomach, small intestine, large intestine, pancreas, spleen, liver, and may also include the kidney.
Splanchnic nerves
Splanchnic mesoderm
Splanchnic circulation –... |
https://en.wikipedia.org/wiki/Greenberg%E2%80%93Hastings%20cellular%20automaton | The Greenberg–Hastings Cellular Automaton (abbrev. GH model) is a three state two dimensional cellular automaton (abbrev CA) named after James M. Greenberg and Stuart Hastings, designed to model excitable media, One advantage of a CA model is ease of computation. The model can be understood quite well using simple "h... |
https://en.wikipedia.org/wiki/Binodal | In thermodynamics, the binodal, also known as the coexistence curve or binodal curve, denotes the condition at which two distinct phases may coexist. Equivalently, it is the boundary between the set of conditions in which it is thermodynamically favorable for the system to be fully mixed and the set of conditions in w... |
https://en.wikipedia.org/wiki/Exchange%20ActiveSync | Exchange ActiveSync (commonly known as EAS) is a proprietary protocol designed for the synchronization of email, contacts, calendar, tasks, and notes from a messaging server to a smartphone or other mobile devices. The protocol also provides mobile device management and policy controls. The protocol is based on XML. Th... |
https://en.wikipedia.org/wiki/Sowing | Sowing is the process of planting seeds. An area or object that has had seeds planted in it will be described as a sowed or sown area.
Plants which are usually sown
Among the major field crops, oats, wheat, and rye are sown, grasses and legumes are seeded and maize and soybeans are planted. In planting, wider rows (... |
https://en.wikipedia.org/wiki/Klebsiella%20pneumoniae | Klebsiella pneumoniae is a Gram-negative, non-motile, encapsulated, lactose-fermenting, facultative anaerobic, rod-shaped bacterium. It appears as a mucoid lactose fermenter on MacConkey agar.
Although found in the normal flora of the mouth, skin, and intestines, it can cause destructive changes to human and animal lu... |
https://en.wikipedia.org/wiki/Goldstine%20theorem | In functional analysis, a branch of mathematics, the Goldstine theorem, named after Herman Goldstine, is stated as follows:
Goldstine theorem. Let be a Banach space, then the image of the closed unit ball under the canonical embedding into the closed unit ball of the bidual space is a weak*-dense subset.
The conc... |
https://en.wikipedia.org/wiki/Phenylsilatrane | Phenylsilatrane is a convulsant chemical which has been used as a rodenticide. Phenylsilatrane and some of its analogs with 4-substituents of H, CH3, Cl, Br, and CSi(CH3)3 are highly toxic to mice. They have been observed in the laboratory to inhibit the 35S-tert-butylbicyclophosphorothionate (TBPS) binding site (GAB... |
https://en.wikipedia.org/wiki/CPAchecker | CPAchecker is a framework and tool for formal software verification, and program analysis, of C programs. Some of its ideas and concepts, for example lazy abstraction, were inherited from the software model checker BLAST.
CPAchecker is based on the idea of configurable program analysis
which is a concept that allows e... |
https://en.wikipedia.org/wiki/Uteroglobin | Uteroglobin, or blastokinin, also known as secretoglobin family 1A member 1 (SCGB1A1), is a protein that in humans is encoded by the SCGB1A1 gene.
SCGB1A1 is the founding member of the secretoglobin family of small, secreted, disulfide-bridged dimeric proteins found only in mammals. This antiparallel disulfide linked ... |
https://en.wikipedia.org/wiki/HAIFA%20construction | The HAIFA construction (hash iterative framework) is a cryptographic structure used in the design of hash functions. It is one of the modern alternatives to the Merkle–Damgård construction, avoiding its weaknesses like length extension attacks. The construction was designed by Eli Biham and Orr Dunkelman in 2007.
Thre... |
https://en.wikipedia.org/wiki/Lipophilic%20efficiency | Lipophilic efficiency (LiPE), sometimes referred to as ligand-lipophilicity efficiency (LLE) is a parameter used in drug design and drug discovery to evaluate the quality of research compounds, linking potency and lipophilicity in an attempt to estimate druglikeness. For a given compound LiPE is defined as the pIC50 (... |
https://en.wikipedia.org/wiki/KCNK17 | Potassium channel subfamily K member 17 is a protein that in humans is encoded by the KCNK17 gene.
This gene encodes K2P17.1, one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This open channel, primarily expressed in the pancreas, is activated at alkaline pH.
... |
https://en.wikipedia.org/wiki/Roger%20Jones%20%28mathematician%29 | Roger L. Jones is an American mathematician specializing in harmonic analysis and ergodic theory.
Biography
He obtained a B.S. in mathematics in 1971 from University at Albany, SUNY, and a Ph.D. in mathematics in 1974 from Rutgers University, with thesis Inequalities for the Ergodic Maximal Function written under the ... |
https://en.wikipedia.org/wiki/Command%20and%20Control%20%28book%29 | Command and Control: Nuclear Weapons, the Damascus Accident, and the Illusion of Safety is a 2013 nonfiction book by Eric Schlosser about the history of nuclear weapons systems and accidents involving nuclear weapons in the United States. Incidents Schlosser discusses in the book include the 1980 Damascus Titan missile... |
https://en.wikipedia.org/wiki/Seed%20orchard | A seed orchard is an intensively-managed plantation of specifically arranged trees for the mass production of genetically improved seeds to create plants, or seeds for the establishment of new forests.
General
Seed orchards are a common method of mass-multiplication for transferring genetically improved material from ... |
https://en.wikipedia.org/wiki/Vector%20processor | In computing, a vector processor or array processor is a central processing unit (CPU) that implements an instruction set where its instructions are designed to operate efficiently and effectively on large one-dimensional arrays of data called vectors. This is in contrast to scalar processors, whose instructions operat... |
https://en.wikipedia.org/wiki/Polony%20%28biology%29 | Polony is a contraction of "polymerase colony," a small colony of DNA.
Polonies are discrete clonal amplifications of a single DNA molecule, grown in a gel matrix. This approach greatly improves the signal-to-noise ratio. Polonies can be generated using several techniques that include solid-phase polymerase chain reac... |
https://en.wikipedia.org/wiki/The%20Hobbit%20%281982%20video%20game%29 | The Hobbit is an illustrated text adventure computer game released in 1982 for the ZX Spectrum home computer and based on the 1937 book The Hobbit, by J. R. R. Tolkien. It was developed at Beam Software by Philip Mitchell and Veronika Megler and published by Melbourne House. It was later converted to most home computer... |
https://en.wikipedia.org/wiki/Speech%20technology | Speech technology relates to the technologies designed to duplicate and respond to the human voice. They have many uses. These include aid to the voice-disabled, the hearing-disabled, and the blind, along with communication with computers without a keyboard. They enhance game software and aid in marketing goods or serv... |
https://en.wikipedia.org/wiki/Legendre%20polynomials | In mathematics, Legendre polynomials, named after Adrien-Marie Legendre (1782), are a system of complete and orthogonal polynomials with a vast number of mathematical properties and numerous applications. They can be defined in many ways, and the various definitions highlight different aspects as well as suggest genera... |
https://en.wikipedia.org/wiki/Cytometry | Cytometry is the measurement of number and characteristics of cells. Variables that can be measured by cytometric methods include cell size, cell count, cell morphology (shape and structure), cell cycle phase, DNA content, and the existence or absence of specific proteins on the cell surface or in the cytoplasm. Cytome... |
https://en.wikipedia.org/wiki/Carolyn%20S.%20Gordon | Carolyn S. Gordon (born 1950) is a mathematician and Benjamin Cheney Professor of Mathematics at Dartmouth College. She is most well known for giving a negative answer to the question "Can you hear the shape of a drum?" in her work with David Webb and Scott A. Wolpert. She is a Chauvenet Prize winner and a 2010 Noether... |
https://en.wikipedia.org/wiki/Matrix%20variate%20beta%20distribution | In statistics, the matrix variate beta distribution is a generalization of the beta distribution. If is a positive definite matrix with a matrix variate beta distribution, and are real parameters, we write (sometimes ). The probability density function for is:
Here is the multivariate beta function:
where i... |
https://en.wikipedia.org/wiki/Nassi%E2%80%93Shneiderman%20diagram | A Nassi–Shneiderman diagram (NSD) in computer programming is a graphical design representation for structured programming. This type of diagram was developed in 1972 by Isaac Nassi and Ben Shneiderman who were both graduate students at Stony Brook University. These diagrams are also called structograms, as they show a ... |
https://en.wikipedia.org/wiki/Progressively%20measurable%20process | In mathematics, progressive measurability is a property in the theory of stochastic processes. A progressively measurable process, while defined quite technically, is important because it implies the stopped process is measurable. Being progressively measurable is a strictly stronger property than the notion of being a... |
https://en.wikipedia.org/wiki/Atari%20Mindlink | The Atari Mindlink is an unreleased video game controller for the Atari 2600, originally intended for release in 1984. The Mindlink was unique in that its headband form factor controls the game by reading the myoneural signal voltage from the player's forehead. The player's forehead movements are read by infrared senso... |
https://en.wikipedia.org/wiki/Web%20data%20services | Web data services refers to service-oriented architecture (SOA) applied to data sourced from the World Wide Web and the Internet as a whole. Web data services enable maximal mashup, reuse, and sharing of structured data (such as relational tables), semi-structured information (such as Extensible Markup Language (XML) d... |
https://en.wikipedia.org/wiki/Instituto%20de%20F%C3%ADsica%20Corpuscular | The Instituto de Física Corpuscular (IFIC, English: Institute for Corpuscular Physics) is a CSIC and University of Valencia joint center dedicated to experimental and theoretical research in the fields of particle physics, nuclear physics, cosmology, astroparticles and medical physics.
It is located at the scientific ... |
https://en.wikipedia.org/wiki/%CE%A0%20pad | The Π pad (pi pad) is a specific type of attenuator circuit in electronics whereby the topology of the circuit is formed in the shape of the Greek capital letter pi (Π).
Attenuators are used in electronics to reduce the level of a signal. They are also referred to as pads due to their effect of padding down a signal ... |
https://en.wikipedia.org/wiki/Epson%20Equity | The Epson Equity series of IBM Compatible Personal Computers was manufactured from 1985 until the early '90s by Epson Inc. Epson was well known for its dot matrix printers at the time and the Equity series represents their entry into the growing PC compatible market. The Equity I was the first system introduced, equipp... |
https://en.wikipedia.org/wiki/Word-representable%20graph | In the mathematical field of graph theory, a word-representable graph is a graph that can be characterized by a word (or sequence) whose entries alternate in a prescribed way. In particular, if the vertex set of the graph is V, one should be able to choose a word w over the alphabet V such that letters a and b alterna... |
https://en.wikipedia.org/wiki/On%20the%20roof%20gang | The On the Roof Gang (sometimes written On-the-Roof-Gang and abbreviated OTRG) was a group of United States Navy cryptologists and radiomen during World War II who are seen as the forerunners of U.S. Navy cryptology and cryptanalysis. One hundred fifty Sailors and 26 Marines worked on the roof of the Navy Department bu... |
https://en.wikipedia.org/wiki/HotChalk | HotChalk was an education technology company founded in September 2004. HotChalk ran an online community application designed for grade school teachers, students, and parents. In August 2007, McGraw-Hill partnered with HotChalk to make McGraw-Hill training and certification tools available to HotChalk users. NBC partne... |
https://en.wikipedia.org/wiki/The%20Banksias | The Banksias, by Celia Rosser, is a three-volume series of monographs containing paintings of every Banksia species. Its publication represented the first time such a large genus had been entirely painted by a single botanical artist. It has been described as "one of the outstanding botanical works of this century."
T... |
https://en.wikipedia.org/wiki/Iterative%20Stencil%20Loops | Iterative Stencil Loops (ISLs) are a class of numerical data processing solution
which update array elements according to some fixed pattern, called a stencil.
They are most commonly found in computer simulations, e.g. for computational fluid dynamics in the context of scientific and engineering applications.
Other ... |
https://en.wikipedia.org/wiki/Hyperplasia | Hyperplasia (from ancient Greek ὑπέρ huper 'over' + πλάσις plasis 'formation'), or hypergenesis, is an enlargement of an organ or tissue caused by an increase in the amount of organic tissue that results from cell proliferation. It may lead to the gross enlargement of an organ, and the term is sometimes confused with b... |
https://en.wikipedia.org/wiki/Dimension%20doubling%20theorem | In probability theory, the dimension doubling theorems are two results about the Hausdorff dimension of an image of a Brownian motion. In their core both statements say, that the dimension of a set under a Brownian motion doubles almost surely.
The first result is due to Henry P. McKean jr and hence called McKean's t... |
https://en.wikipedia.org/wiki/Line%20Printer%20Daemon%20protocol | The Line Printer Daemon protocol/Line Printer Remote protocol (or LPD, LPR) is a network printing protocol for submitting print jobs to a remote printer. The original implementation of LPD was in the Berkeley printing system in the BSD UNIX operating system; the LPRng project also supports that protocol. The Common U... |
https://en.wikipedia.org/wiki/International%20Young%20Physicists%27%20Tournament | The International Young Physicists' Tournament (IYPT), sometimes referred to as the “Physics World Cup”, is a scientific competition between teams of secondary school students. It mimics, as close as possible, the real-world scientific research and the process of presenting and defending the results obtained.
Particip... |
https://en.wikipedia.org/wiki/J.%20Robert%20Oppenheimer%20Memorial%20Prize | The J. Robert Oppenheimer Memorial Prize and Medal was awarded by the Center for Theoretical Studies, University of Miami, from 1969, until 1984. Established in memory of US physicist J. Robert Oppenheimer, the award consisted of a medal, certificate and a $1000 honorarium. It was awarded for "outstanding contributions... |
https://en.wikipedia.org/wiki/Xerox%20Alto | The Xerox Alto is a computer that was designed from its inception to support an operating system based on a graphical user interface (GUI), later using the desktop metaphor. The first machines were introduced on 1 March 1973, a decade before mass-market GUI machines became available.
The Alto is contained in a relativ... |
https://en.wikipedia.org/wiki/Agrifirm | Agrifirm is a cooperative enterprise in which more than 10.000 Dutch farmers and horticulturalists have combined their purchasing power. Agrifirm in its current form was founded in 2010 due to a successive merger of regional cooperatives. The enterprise operates as a link for farmers being currently active throughout t... |
https://en.wikipedia.org/wiki/LearnedLeague | LearnedLeague is a web-based, invitation-only global quiz league operated by Seattle-based software engineer Shayne Bushfield under the pseudonym "Thorsten A. Integrity". As of August 2023, it has over 28,000 members worldwide.
Structure
Players are organized into leagues with nonspecific geographic designations like ... |
https://en.wikipedia.org/wiki/Death%20by%20vending%20machine | Vending machines being rocked or tilted have been known to cause serious injury and death when the heavy machines fall over.
Users may rock machines in order to obtain free products, release stuck products, or obtain change.(1 January 1992). Soft-drink machine crushes woman who kicked it, Sun Journal (Associated Press... |
https://en.wikipedia.org/wiki/Divide%20and%20choose | Divide and choose (also Cut and choose or I cut, you choose) is a procedure for fair division of a continuous resource, such as a cake, between two parties. It involves a heterogeneous good or resource ("the cake") and two partners who have different preferences over parts of the cake. The protocol proceeds as follows:... |
https://en.wikipedia.org/wiki/Delone%20set | In the mathematical theory of metric spaces, ε-nets, ε-packings, ε-coverings, uniformly discrete sets, relatively dense sets, and Delone sets (named after Boris Delone) are several closely related definitions of well-spaced sets of points, and the packing radius and covering radius of these sets measure how well-spaced... |
https://en.wikipedia.org/wiki/C%C3%A9cile%20La%20Grenade | Dame Cécile Ellen Fleurette La Grenade, (born 30 December 1952) is a Grenadian food scientist who has served as Governor-General of Grenada since 7 May 2013.
Early life and career
La Grenade was born in La Borie, located in Saint George Parish, Grenada. She is the third of five daughters born to Allan A. La Grenade... |
https://en.wikipedia.org/wiki/Wet-bulb%20temperature | The wet-bulb temperature (WBT) is the temperature read by a thermometer covered in water-soaked (water at ambient temperature) cloth (a wet-bulb thermometer) over which air is passed. At 100% relative humidity, the wet-bulb temperature is equal to the air temperature (dry-bulb temperature); at lower humidity the wet-bu... |
https://en.wikipedia.org/wiki/Forbidden%20Flowers | Forbidden Flowers by Nancy Friday is a book which explores women's sexual fantasies. It can be read as a feminist analysis of the development of women's fantasies against a background of sexual liberation, or simply as a series of candid, erotic fantasies. It is part of a series of three books beginning in 1968 with My... |
https://en.wikipedia.org/wiki/Cubic%20graph | In the mathematical field of graph theory, a cubic graph is a graph in which all vertices have degree three. In other words, a cubic graph is a 3-regular graph. Cubic graphs are also called trivalent graphs.
A bicubic graph is a cubic bipartite graph.
Symmetry
In 1932, Ronald M. Foster began collecting examples of c... |
https://en.wikipedia.org/wiki/Zfp28%20zinc%20finger%20protein | ZFP28 zinc finger protein is a protein that in humans is encoded by the ZFP28 gene. |
https://en.wikipedia.org/wiki/Hypersonic%20effect | The hypersonic effect is a phenomenon reported in a controversial scientific study by Tsutomu Oohashi et al., which claims that, although humans cannot consciously hear ultrasound (sounds at frequencies above approximately 20 kHz), the presence or absence of those frequencies has a measurable effect on their physiologi... |
https://en.wikipedia.org/wiki/Oleiharenicola | Oleiharenicola is a genus of bacteria from the family of Opitutaceae. |
https://en.wikipedia.org/wiki/Pere%20Alberch | Pere Alberch Vie (2 November 1954, Badalona – 13 March 1998, Madrid) was a Spanish naturalist, biologist and embryologist. He was a professor at Harvard University from 1980 to 1989, and director of the Museo Nacional de Ciencias Naturales, Madrid. He studied in the United States, earning a bachelor's degree from the U... |
https://en.wikipedia.org/wiki/DockNET | DockNET is an intelligent control system for cargo handling developed by Portsystem in Sweden.
The control system was created for being able to analyze, communicate, supervise, direct, record and to document everything that happens in and around a loading door hole in a modern cargo terminal. Cargo terminals often suf... |
https://en.wikipedia.org/wiki/Johnny%20Canuck | Johnny Canuck is a Canadian cartoon hero and superhero who was created as a political cartoon in 1869 and was later re-invented as a Second World War action hero in 1942. The Vancouver Canucks, a professional ice hockey team in the National Hockey League (NHL), currently use a hockey playing "Johnny Canuck" logo as one... |
https://en.wikipedia.org/wiki/Meta-regression | Meta-regression is defined to be a meta-analysis that uses regression analysis to combine, compare, and synthesize research findings from multiple studies while adjusting for the effects of available covariates on a response variable. A meta-regression analysis aims to reconcile conflicting studies or corroborate consi... |
https://en.wikipedia.org/wiki/Alinea%20%28restaurant%29 | Alinea is a restaurant in Chicago, Illinois, United States. In 2010, Alinea was awarded three stars by the Michelin Guide. Since the closing on December 20, 2017 of Grace, Alinea remains the only Chicago restaurant with three Michelin stars.
History
The restaurant opened on May 4, 2005, and takes its name from th... |
https://en.wikipedia.org/wiki/Dyne%3Abolic | dyne:bolic GNU/Linux is a Live CD/DVD distribution based on the Linux kernel. It is shaped by the needs of media activists, artists and creators to be a practical tool with a focus on multimedia production, that delivers a large assortment of applications. It allows manipulation and broadcast of both sound and video w... |
https://en.wikipedia.org/wiki/Upstream%20activating%20sequence | An upstream activating sequence or upstream activation sequence (UAS) is a cis-acting regulatory sequence. It is distinct from the promoter and increases the expression of a neighbouring gene. Due to its essential role in activating transcription, the upstream activating sequence is often considered to be analogous to ... |
https://en.wikipedia.org/wiki/Experimenter%27s%20regress | In science, experimenter's regress refers to a loop of dependence between theory and evidence. In order to judge whether evidence is erroneous we must rely on theory-based expectations, and to judge the value of competing theories we rely on evidence. Cognitive bias affects experiments, and experiments determine which ... |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.