contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
A dragon symbolizes wisdom, power and wealth. On Lunar New Year's Day, people model a dragon with bamboo strips and clothes, raise them with rods, and hold the rods high and low to resemble a flying dragon.
A performer holding the rod low is represented by a 1, while one holding it high is represented by a 2. Thus, the line of performers can be represented by a sequence *a*1,<=*a*2,<=...,<=*a**n*.
Little Tommy is among them. He would like to choose an interval [*l*,<=*r*] (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), then reverse *a**l*,<=*a**l*<=+<=1,<=...,<=*a**r* so that the length of the longest non-decreasing subsequence of the new sequence is maximum.
A non-decreasing subsequence is a sequence of indices *p*1,<=*p*2,<=...,<=*p**k*, such that *p*1<=<<=*p*2<=<<=...<=<<=*p**k* and *a**p*1<=≤<=*a**p*2<=≤<=...<=≤<=*a**p**k*. The length of the subsequence is *k*.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=2000), denoting the length of the original sequence.
The second line contains *n* space-separated integers, describing the original sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2,<=*i*<==<=1,<=2,<=...,<=*n*).
|
Print a single integer, which means the maximum possible length of the longest non-decreasing subsequence of the new sequence.
|
[
"4\n1 2 1 2\n",
"10\n1 1 2 2 2 1 1 2 2 1\n"
] |
[
"4\n",
"9\n"
] |
In the first example, after reversing [2, 3], the array will become [1, 1, 2, 2], where the length of the longest non-decreasing subsequence is 4.
In the second example, after reversing [3, 7], the array will become [1, 1, 1, 1, 2, 2, 2, 2, 2, 1], where the length of the longest non-decreasing subsequence is 9.
| 0
|
[
{
"input": "4\n1 2 1 2",
"output": "4"
},
{
"input": "10\n1 1 2 2 2 1 1 2 2 1",
"output": "9"
},
{
"input": "200\n2 1 1 2 1 2 2 2 2 2 1 2 2 1 1 2 2 1 1 1 2 1 1 2 2 2 2 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 2 2 1 2 1 1 1 2 1 1 1 2 2 2 1 1 1 1 2 2 2 1 2 2 2 1 2 2 2 1 2 1 2 1 2 1 1 1 1 2 2 2 1 1 2 1 2 1 2 1 2 2 1 1 1 2 2 2 2 1 2 2 2 1 1 1 1 2 1 1 1 2 2 1 2 1 2 2 2 1 2 1 2 1 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 1 1 2 1 2 2 2 1 2 1 1 1 1 1 1 2 1 1 2 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 1 2 1 2 2 1 1 1 1 2 2 1 1 2 2 1 2 2 1 2 2 2",
"output": "116"
},
{
"input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "200"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "2\n2 1",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "3"
},
{
"input": "3\n1 2 1",
"output": "3"
},
{
"input": "100\n1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 2 1 1 1 1 1 1 2 1 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 1 2 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "89"
},
{
"input": "100\n1 2 1 2 2 2 1 1 2 2 2 1 2 2 2 1 1 1 1 2 2 2 1 1 1 1 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 1 2 1 2 1 2 2 1 2 2 1 2 1 2 2 1 2 1 1 2 2 1 2 2 1 1 1 1 2 2 1 2 2 1 1 1 1 1 1 1 2 2 2 1 1 2 2 1 2 2 1 1 1 2 2 1 1 1 1",
"output": "60"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 1 1 1 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 2 1 1 1 1 1 1 2 2",
"output": "91"
},
{
"input": "100\n2 2 2 2 1 2 1 1 1 1 2 1 1 1 2 1 1 1 1 2 2 1 1 1 1 2 1 1 1 2 1 2 1 2 2 2 2 2 1 1 1 1 2 1 1 2 1 1 2 2 1 1 1 1 2 1 1 2 2 2 2 1 1 1 2 1 1 1 2 2 1 1 2 1 2 2 2 1 1 2 2 1 1 2 2 1 1 1 2 2 1 1 2 2 2 1 1 1 2 2",
"output": "63"
},
{
"input": "200\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2",
"output": "187"
},
{
"input": "200\n1 2 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 2 2 1 1 1 1 1 2 1 1 1 1 2 1 2 1 1 1 2 1 2 1 1 2 2 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 2 2 1 2 1 1 1 2 2 1 2 2 1 2 2 2 2 2 1 1 1 2 2 2 1 1 2 2 1 2 1 2 2 1 2 2 1 2 1 2 2 1 1 1 1 1 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 2 1 1 1 2 1 2 1 2 2 1 1 1 1 2 1 1 2 1 2 1 1 2 2 1 1 1 2 1 1 1 2 1 2 1 2 1 1 1 1 2 2 2 1 2 1 2 2 1 2 1 1 2 1 1 2 1 2 1 2 1 1 2 1 1 2 2 1 2 1 1 2",
"output": "131"
},
{
"input": "200\n1 2 2 1 2 1 1 1 1 1 2 1 2 2 2 2 2 1 2 1 1 2 2 2 1 2 1 1 2 2 1 1 1 2 2 1 2 1 2 2 1 1 1 2 1 1 1 1 1 1 2 2 2 1 2 1 1 2 2 1 2 1 1 1 2 2 1 2 2 2 2 1 1 2 2 2 2 2 1 2 1 2 2 1 2 2 2 2 2 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 1 1 1 2 2 2 1 2 2 1 1 1 2 2 2 1 1 2 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 1 2 2 1 1 1 2 2 2 1 2 2 1 2 2 2 2 1 2 1 1 1 2 1 1 2 1 1 1 1 2 1 2 1 1 1 2 2 2 2 1 1 2 2 2 2",
"output": "118"
},
{
"input": "20\n1 2 2 2 2 2 2 2 1 1 1 2 2 2 1 2 1 1 2 1",
"output": "16"
},
{
"input": "200\n2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "191"
},
{
"input": "10\n2 2 2 2 2 2 2 2 2 1",
"output": "10"
},
{
"input": "6\n2 2 2 1 1 1",
"output": "6"
}
] | 1,518,615,219
| 5,319
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 2
| 46
| 5,632,000
|
n = int(input())
ns = [int(x) for x in input().split()]
ns.append(6)
maxi = 0
lst = []
last = ns[0]
count = 0
for i in range(n + 1):
if last == ns[i]:
last = ns[i]
count += 1
else:
lst.append(count)
count = 1
last = ns[i]
maxi = 0
summa = sum(lst[:4])
otr = lst[:4]
if len(lst) <= 4:
print(sum(lst))
else:
for i in range(len(lst) - 4):
otr.append(lst[i + 4])
otr.pop(0)
if summa < sum(otr):
summa = sum(otr)
print(summa)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A dragon symbolizes wisdom, power and wealth. On Lunar New Year's Day, people model a dragon with bamboo strips and clothes, raise them with rods, and hold the rods high and low to resemble a flying dragon.
A performer holding the rod low is represented by a 1, while one holding it high is represented by a 2. Thus, the line of performers can be represented by a sequence *a*1,<=*a*2,<=...,<=*a**n*.
Little Tommy is among them. He would like to choose an interval [*l*,<=*r*] (1<=≤<=*l*<=≤<=*r*<=≤<=*n*), then reverse *a**l*,<=*a**l*<=+<=1,<=...,<=*a**r* so that the length of the longest non-decreasing subsequence of the new sequence is maximum.
A non-decreasing subsequence is a sequence of indices *p*1,<=*p*2,<=...,<=*p**k*, such that *p*1<=<<=*p*2<=<<=...<=<<=*p**k* and *a**p*1<=≤<=*a**p*2<=≤<=...<=≤<=*a**p**k*. The length of the subsequence is *k*.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=2000), denoting the length of the original sequence.
The second line contains *n* space-separated integers, describing the original sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2,<=*i*<==<=1,<=2,<=...,<=*n*).
Output Specification:
Print a single integer, which means the maximum possible length of the longest non-decreasing subsequence of the new sequence.
Demo Input:
['4\n1 2 1 2\n', '10\n1 1 2 2 2 1 1 2 2 1\n']
Demo Output:
['4\n', '9\n']
Note:
In the first example, after reversing [2, 3], the array will become [1, 1, 2, 2], where the length of the longest non-decreasing subsequence is 4.
In the second example, after reversing [3, 7], the array will become [1, 1, 1, 1, 2, 2, 2, 2, 2, 1], where the length of the longest non-decreasing subsequence is 9.
|
```python
n = int(input())
ns = [int(x) for x in input().split()]
ns.append(6)
maxi = 0
lst = []
last = ns[0]
count = 0
for i in range(n + 1):
if last == ns[i]:
last = ns[i]
count += 1
else:
lst.append(count)
count = 1
last = ns[i]
maxi = 0
summa = sum(lst[:4])
otr = lst[:4]
if len(lst) <= 4:
print(sum(lst))
else:
for i in range(len(lst) - 4):
otr.append(lst[i + 4])
otr.pop(0)
if summa < sum(otr):
summa = sum(otr)
print(summa)
```
| 0
|
|
888
|
E
|
Maximum Subsequence
|
PROGRAMMING
| 1,800
|
[
"bitmasks",
"divide and conquer",
"meet-in-the-middle"
] | null | null |
You are given an array *a* consisting of *n* integers, and additionally an integer *m*. You have to choose some sequence of indices *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b*1<=<<=*b*2<=<<=...<=<<=*b**k*<=≤<=*n*) in such a way that the value of is maximized. Chosen sequence can be empty.
Print the maximum possible value of .
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=35, 1<=≤<=*m*<=≤<=109).
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109).
|
Print the maximum possible value of .
|
[
"4 4\n5 2 4 1\n",
"3 20\n199 41 299\n"
] |
[
"3\n",
"19\n"
] |
In the first example you can choose a sequence *b* = {1, 2}, so the sum <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c856546022c2feee13d02a4ec9cd1d361ab3a756.png" style="max-width: 100.0%;max-height: 100.0%;"/> is equal to 7 (and that's 3 after taking it modulo 4).
In the second example you can choose a sequence *b* = {3}.
| 0
|
[
{
"input": "4 4\n5 2 4 1",
"output": "3"
},
{
"input": "3 20\n199 41 299",
"output": "19"
},
{
"input": "5 10\n47 100 49 2 56",
"output": "9"
},
{
"input": "5 1000\n38361 75847 14913 11499 8297",
"output": "917"
},
{
"input": "10 10\n48 33 96 77 67 59 35 15 14 86",
"output": "9"
},
{
"input": "10 1000\n16140 63909 7177 99953 35627 40994 29288 7324 44476 36738",
"output": "999"
},
{
"input": "30 10\n99 44 42 36 43 82 99 99 10 79 97 84 5 78 37 45 87 87 11 11 79 66 47 100 8 50 27 98 32 27",
"output": "9"
},
{
"input": "30 1000\n81021 18939 94456 90340 76840 78808 27921 71826 99382 1237 93435 35153 71691 25508 96732 23778 49073 60025 95231 88719 61650 50925 34416 73600 7295 14654 78340 72871 17324 77484",
"output": "999"
},
{
"input": "35 10\n86 66 98 91 61 71 14 58 49 92 13 97 13 22 98 83 85 29 85 41 51 16 76 17 75 25 71 10 87 11 9 34 3 6 4",
"output": "9"
},
{
"input": "35 1000\n33689 27239 14396 26525 30455 13710 37039 80789 26268 1236 89916 87557 90571 13710 59152 99417 39577 40675 25931 14900 86611 46223 7105 64074 41238 59169 81308 70534 99894 10332 72983 85414 73848 68378 98404",
"output": "999"
},
{
"input": "35 1000000000\n723631245 190720106 931659134 503095294 874181352 712517040 800614682 904895364 256863800 39366772 763190862 770183843 774794919 55669976 329106527 513566505 207828535 258356470 816288168 657823769 5223226 865258331 655737365 278677545 880429272 718852999 810522025 229560899 544602508 195068526 878937336 739178504 474601895 54057210 432282541",
"output": "999999999"
},
{
"input": "35 982451653\n27540278 680344696 757828533 487257472 581415866 897315944 104006244 109795853 24393319 840585536 643747159 864374693 675946278 27492061 172462571 484550119 801174500 94160579 818984382 53253720 966692115 811281559 154162995 890236127 799613478 611617443 787587569 606421577 91876376 464150101 671199076 108388038 342311910 974681791 862530363",
"output": "982451652"
},
{
"input": "15 982451653\n384052103 7482105 882228352 582828798 992251028 892163214 687253903 951043841 277531875 402248542 499362766 919046434 350763964 288775999 982610665",
"output": "982368704"
},
{
"input": "35 1000000000\n513 9778 5859 8149 297 7965 7152 917 243 4353 7248 4913 9403 6199 2930 7461 3888 1898 3222 9424 3960 1902 2933 5268 2650 1687 5319 5065 8450 141 4219 2586 2176 1118 9635",
"output": "158921"
},
{
"input": "35 982451653\n5253 7912 3641 7428 6138 9613 9059 6352 9070 89 9030 1686 3098 7852 3316 8158 7497 5804 130 6201 235 64 3451 6104 4148 3446 6059 6802 7466 8781 1636 8291 8874 8924 5997",
"output": "197605"
},
{
"input": "15 982451653\n7975 7526 1213 2318 209 7815 4153 1853 6651 2880 4535 587 8022 3365 5491",
"output": "64593"
},
{
"input": "35 1730970\n141538 131452 93552 3046 119468 8282 166088 33782 36462 25246 178798 81434 180900 15102 175898 157782 155254 166352 60772 75162 102326 104854 181138 58618 123800 54458 157516 20658 25084 155276 194920 16680 15148 188292 88802",
"output": "1730968"
},
{
"input": "35 346194136\n89792 283104 58936 184528 194768 253076 304368 140216 220836 69196 274604 68988 300412 242588 25328 183488 81712 374964 377696 317872 146208 147400 346276 14356 90432 347556 35452 119348 311320 126112 113200 98936 189500 363424 320164",
"output": "6816156"
},
{
"input": "35 129822795\n379185 168630 1047420 892020 180690 1438200 168330 1328610 933930 936360 1065225 351990 1079190 681510 1336020 814590 365820 1493580 495825 809745 309585 190320 1148640 146790 1008900 365655 947265 1314060 1048770 1463535 1233420 969330 1324530 944130 1457160",
"output": "29838960"
},
{
"input": "35 106920170\n36941450 53002950 90488020 66086895 77577045 16147985 26130825 84977690 87374560 59007480 61416705 100977415 43291920 56833000 12676230 50531950 5325005 54745005 105536410 76922230 9031505 121004870 104634495 16271535 55819890 47603815 85830185 65938635 33074335 40289655 889560 19829775 31653510 120671285 37843365",
"output": "106907815"
},
{
"input": "35 200000000\n75420000 93400000 70560000 93860000 183600000 143600000 61780000 145000000 99360000 14560000 109280000 22040000 141220000 14360000 55140000 78580000 96940000 62400000 173220000 40420000 139600000 30100000 141640000 64780000 186080000 159220000 137780000 133640000 83560000 51280000 139100000 133020000 99460000 35900000 78980000",
"output": "199980000"
},
{
"input": "4 1\n435 124 324 2",
"output": "0"
},
{
"input": "1 12\n13",
"output": "1"
},
{
"input": "1 1000000000\n1000000000",
"output": "0"
},
{
"input": "7 19\n8 1 4 8 8 7 3",
"output": "18"
},
{
"input": "6 7\n1 1 1 1 1 6",
"output": "6"
},
{
"input": "3 5\n1 2 3",
"output": "4"
},
{
"input": "4 36\n22 9 24 27",
"output": "33"
},
{
"input": "2 8\n7 1",
"output": "7"
},
{
"input": "2 12\n8 7",
"output": "8"
},
{
"input": "4 10\n11 31 12 3",
"output": "7"
},
{
"input": "2 8\n2 7",
"output": "7"
},
{
"input": "4 19\n16 20 19 21",
"output": "18"
},
{
"input": "3 4\n9 16 11",
"output": "3"
},
{
"input": "2 3\n3 7",
"output": "1"
},
{
"input": "2 20\n4 3",
"output": "7"
},
{
"input": "3 299\n100 100 200",
"output": "200"
}
] | 1,637,929,023
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
import sys
input = sys.stdin.readline
def inlt():
return list(map(int,input().split()))
[n, m] = inlt()
a = inlt()
def powerset(s):
x = len(s)
for i in range(1 << x):
print [s[j] for j in range(x) if (i & (1 << j))]
max_value = 0
powerset_a = powerset(a)
for s in powerset_a:
cur_sum = sum(s) % m
if sum(s) % m > max_value:
max_value = cur_sum
print(max_value)
|
Title: Maximum Subsequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array *a* consisting of *n* integers, and additionally an integer *m*. You have to choose some sequence of indices *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b*1<=<<=*b*2<=<<=...<=<<=*b**k*<=≤<=*n*) in such a way that the value of is maximized. Chosen sequence can be empty.
Print the maximum possible value of .
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=35, 1<=≤<=*m*<=≤<=109).
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the maximum possible value of .
Demo Input:
['4 4\n5 2 4 1\n', '3 20\n199 41 299\n']
Demo Output:
['3\n', '19\n']
Note:
In the first example you can choose a sequence *b* = {1, 2}, so the sum <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c856546022c2feee13d02a4ec9cd1d361ab3a756.png" style="max-width: 100.0%;max-height: 100.0%;"/> is equal to 7 (and that's 3 after taking it modulo 4).
In the second example you can choose a sequence *b* = {3}.
|
```python
import sys
input = sys.stdin.readline
def inlt():
return list(map(int,input().split()))
[n, m] = inlt()
a = inlt()
def powerset(s):
x = len(s)
for i in range(1 << x):
print [s[j] for j in range(x) if (i & (1 << j))]
max_value = 0
powerset_a = powerset(a)
for s in powerset_a:
cur_sum = sum(s) % m
if sum(s) % m > max_value:
max_value = cur_sum
print(max_value)
```
| -1
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,691,053,217
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 92
| 0
|
n = int(input())
teams = {}
for i in range(n) :
team = input()
if team not in teams.keys() :
teams[team] = 1
else :
teams[team] += 1
score = max(teams.values())
for i in teams.keys() :
if teams[i] == score :
print(i)
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n = int(input())
teams = {}
for i in range(n) :
team = input()
if team not in teams.keys() :
teams[team] = 1
else :
teams[team] += 1
score = max(teams.values())
for i in teams.keys() :
if teams[i] == score :
print(i)
```
| 3.977
|
465
|
A
|
inc ARG
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit.
Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded.
Sergey wrote certain values of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell.
The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
|
Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell.
|
[
"4\n1100\n",
"4\n1111\n"
] |
[
"3\n",
"4\n"
] |
In the first sample the cell ends up with value 0010, in the second sample — with 0000.
| 500
|
[
{
"input": "4\n1100",
"output": "3"
},
{
"input": "4\n1111",
"output": "4"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n00",
"output": "1"
},
{
"input": "2\n01",
"output": "1"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n11",
"output": "2"
},
{
"input": "10\n0000000000",
"output": "1"
},
{
"input": "20\n11111111110110001100",
"output": "11"
},
{
"input": "50\n01011110100010000001010000100001001101001101101011",
"output": "1"
},
{
"input": "60\n111111111101111111111111111111111111111111111111111111111111",
"output": "11"
},
{
"input": "60\n111111111111111111111111111111111111111111111111111111111111",
"output": "60"
},
{
"input": "66\n111111010010011001110011000111000100011110011001111110011111111101",
"output": "7"
},
{
"input": "90\n000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "91\n1011111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "2"
},
{
"input": "92\n11111111101011111011111111111111111111111011101111111111011111111111111101111111101011111101",
"output": "10"
},
{
"input": "100\n0001011110100011001100100010111001000001111101101001001001001011110100101101010000000110100101110010",
"output": "1"
},
{
"input": "100\n0111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "1"
},
{
"input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "100"
},
{
"input": "100\n1011001110001000011111110011000100001110010110111101110110011011011000010100110001111100000010110010",
"output": "2"
},
{
"input": "100\n1101111011001111111111110011110111101110111111111111111111111111111111011111111111110111111111111111",
"output": "3"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "100"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110",
"output": "100"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111101",
"output": "99"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111100000",
"output": "96"
},
{
"input": "100\n1111111111111111111111111111111110011000110110001010101100100100001000010010010010000100110000010101",
"output": "34"
}
] | 1,696,763,990
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
n = int(input())
cell = input().strip()
# Initialize a variable to count the number of changing bits
changes = 0
# Initialize a carry bit to handle the addition
carry = 1
# Iterate through the bits from LSB to MSB
for i in range(n - 1, -1, -1):
bit = int(cell[i])
# Calculate the sum of the current bit and the carry
new_bit = (bit + carry) % 2
# Update the carry for the next iteration
carry = (bit + carry) // 2
# Check if the bit has changed
if new_bit != bit:
changes += 1
# Print the number of bits that change
print(changes)
|
Title: inc ARG
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit.
Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded.
Sergey wrote certain values of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell.
The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
Output Specification:
Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell.
Demo Input:
['4\n1100\n', '4\n1111\n']
Demo Output:
['3\n', '4\n']
Note:
In the first sample the cell ends up with value 0010, in the second sample — with 0000.
|
```python
n = int(input())
cell = input().strip()
# Initialize a variable to count the number of changing bits
changes = 0
# Initialize a carry bit to handle the addition
carry = 1
# Iterate through the bits from LSB to MSB
for i in range(n - 1, -1, -1):
bit = int(cell[i])
# Calculate the sum of the current bit and the carry
new_bit = (bit + carry) % 2
# Update the carry for the next iteration
carry = (bit + carry) // 2
# Check if the bit has changed
if new_bit != bit:
changes += 1
# Print the number of bits that change
print(changes)
```
| 0
|
|
802
|
J
|
Send the Fool Further! (easy)
|
PROGRAMMING
| 1,400
|
[
"dfs and similar",
"graphs",
"trees"
] | null | null |
Heidi's friend Jenny is asking Heidi to deliver an important letter to one of their common friends. Since Jenny is Irish, Heidi thinks that this might be a prank. More precisely, she suspects that the message she is asked to deliver states: "Send the fool further!", and upon reading it the recipient will ask Heidi to deliver the same message to yet another friend (that the recipient has in common with Heidi), and so on.
Heidi believes that her friends want to avoid awkward situations, so she will not be made to visit the same person (including Jenny) twice. She also knows how much it costs to travel between any two of her friends who know each other. She wants to know: what is the maximal amount of money she will waste on travel if it really is a prank?
Heidi's *n* friends are labeled 0 through *n*<=-<=1, and their network of connections forms a tree. In other words, every two of her friends *a*, *b* know each other, possibly indirectly (there is a sequence of friends starting from *a* and ending on *b* and such that each two consecutive friends in the sequence know each other directly), and there are exactly *n*<=-<=1 pairs of friends who know each other directly.
Jenny is given the number 0.
|
The first line of the input contains the number of friends *n* (3<=≤<=*n*<=≤<=100). The next *n*<=-<=1 lines each contain three space-separated integers *u*, *v* and *c* (0<=≤<=*u*,<=*v*<=≤<=*n*<=-<=1, 1<=≤<=*c*<=≤<=104), meaning that *u* and *v* are friends (know each other directly) and the cost for travelling between *u* and *v* is *c*.
It is guaranteed that the social network of the input forms a tree.
|
Output a single integer – the maximum sum of costs.
|
[
"4\n0 1 4\n0 2 2\n2 3 3\n",
"6\n1 2 3\n0 2 100\n1 4 2\n0 3 7\n3 5 10\n",
"11\n1 0 1664\n2 0 881\n3 2 4670\n4 2 1555\n5 1 1870\n6 2 1265\n7 2 288\n8 7 2266\n9 2 1536\n10 6 3378\n"
] |
[
"5\n",
"105\n",
"5551\n"
] |
In the second example, the worst-case scenario goes like this: Jenny sends Heidi to the friend labeled by number 2 (incurring a cost of 100), then friend 2 sends her to friend 1 (costing Heidi 3), and finally friend 1 relays her to friend 4 (incurring an additional cost of 2).
| 0
|
[
{
"input": "4\n0 1 4\n0 2 2\n2 3 3",
"output": "5"
},
{
"input": "3\n1 0 5987\n2 0 8891",
"output": "8891"
},
{
"input": "10\n1 0 518\n2 0 4071\n3 1 121\n4 2 3967\n5 3 9138\n6 2 9513\n7 3 3499\n8 2 2337\n9 4 7647",
"output": "15685"
},
{
"input": "11\n1 0 6646\n2 0 8816\n3 2 9375\n4 2 5950\n5 1 8702\n6 2 2657\n7 2 885\n8 7 2660\n9 2 5369\n10 6 3798",
"output": "18191"
},
{
"input": "10\n0 1 7171\n0 2 2280\n1 3 9126\n2 4 2598\n5 4 8320\n6 2 1855\n3 7 9204\n7 8 2145\n4 9 10",
"output": "27646"
},
{
"input": "6\n1 2 3\n0 2 100\n1 4 2\n0 3 7\n3 5 10",
"output": "105"
},
{
"input": "11\n1 0 1664\n2 0 881\n3 2 4670\n4 2 1555\n5 1 1870\n6 2 1265\n7 2 288\n8 7 2266\n9 2 1536\n10 6 3378",
"output": "5551"
}
] | 1,594,375,200
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 155
| 20,172,800
|
n=int(input())
al=[[] for j in range(n)]
for i in range(n-1):
a,b,c=map(int,input().split())
al[a].append([b,c])
al[b].append([a,c])
mc=0
va=[0]*(n)
ca=[0]*(n)
def dfs(n,c):
va[n]=1
#print(c)
ca[n]=ca[n]+c
for e in al[n]:
#print(e)
p=e[0]
q=e[1]+ca[n]
if(va[p]==0):
dfs(p,q)
dfs(0,0)
print(max(ca))
'''
mc = 0
cost = 0
visited = [False] * n
def DFS(num,visited,cost):
global mc
if cost > mc:
mc = cost
visited[num] = True
for i in range(len(li[num])):
if not visited[li[num][i][0]]:
DFS(li[num][i][0],visited,cost+li[num][i][1])
DFS(0,visited,0)
print(mc)'''
|
Title: Send the Fool Further! (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Heidi's friend Jenny is asking Heidi to deliver an important letter to one of their common friends. Since Jenny is Irish, Heidi thinks that this might be a prank. More precisely, she suspects that the message she is asked to deliver states: "Send the fool further!", and upon reading it the recipient will ask Heidi to deliver the same message to yet another friend (that the recipient has in common with Heidi), and so on.
Heidi believes that her friends want to avoid awkward situations, so she will not be made to visit the same person (including Jenny) twice. She also knows how much it costs to travel between any two of her friends who know each other. She wants to know: what is the maximal amount of money she will waste on travel if it really is a prank?
Heidi's *n* friends are labeled 0 through *n*<=-<=1, and their network of connections forms a tree. In other words, every two of her friends *a*, *b* know each other, possibly indirectly (there is a sequence of friends starting from *a* and ending on *b* and such that each two consecutive friends in the sequence know each other directly), and there are exactly *n*<=-<=1 pairs of friends who know each other directly.
Jenny is given the number 0.
Input Specification:
The first line of the input contains the number of friends *n* (3<=≤<=*n*<=≤<=100). The next *n*<=-<=1 lines each contain three space-separated integers *u*, *v* and *c* (0<=≤<=*u*,<=*v*<=≤<=*n*<=-<=1, 1<=≤<=*c*<=≤<=104), meaning that *u* and *v* are friends (know each other directly) and the cost for travelling between *u* and *v* is *c*.
It is guaranteed that the social network of the input forms a tree.
Output Specification:
Output a single integer – the maximum sum of costs.
Demo Input:
['4\n0 1 4\n0 2 2\n2 3 3\n', '6\n1 2 3\n0 2 100\n1 4 2\n0 3 7\n3 5 10\n', '11\n1 0 1664\n2 0 881\n3 2 4670\n4 2 1555\n5 1 1870\n6 2 1265\n7 2 288\n8 7 2266\n9 2 1536\n10 6 3378\n']
Demo Output:
['5\n', '105\n', '5551\n']
Note:
In the second example, the worst-case scenario goes like this: Jenny sends Heidi to the friend labeled by number 2 (incurring a cost of 100), then friend 2 sends her to friend 1 (costing Heidi 3), and finally friend 1 relays her to friend 4 (incurring an additional cost of 2).
|
```python
n=int(input())
al=[[] for j in range(n)]
for i in range(n-1):
a,b,c=map(int,input().split())
al[a].append([b,c])
al[b].append([a,c])
mc=0
va=[0]*(n)
ca=[0]*(n)
def dfs(n,c):
va[n]=1
#print(c)
ca[n]=ca[n]+c
for e in al[n]:
#print(e)
p=e[0]
q=e[1]+ca[n]
if(va[p]==0):
dfs(p,q)
dfs(0,0)
print(max(ca))
'''
mc = 0
cost = 0
visited = [False] * n
def DFS(num,visited,cost):
global mc
if cost > mc:
mc = cost
visited[num] = True
for i in range(len(li[num])):
if not visited[li[num][i][0]]:
DFS(li[num][i][0],visited,cost+li[num][i][1])
DFS(0,visited,0)
print(mc)'''
```
| 3
|
|
361
|
A
|
Levko and Table
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*.
Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
|
The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000).
|
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value.
If there are multiple suitable tables, you are allowed to print any of them.
|
[
"2 4\n",
"4 7\n"
] |
[
"1 3\n3 1\n",
"2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n"
] |
In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample.
In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
| 500
|
[
{
"input": "2 4",
"output": "4 0 \n0 4 "
},
{
"input": "4 7",
"output": "7 0 0 0 \n0 7 0 0 \n0 0 7 0 \n0 0 0 7 "
},
{
"input": "1 8",
"output": "8 "
},
{
"input": "9 3",
"output": "3 0 0 0 0 0 0 0 0 \n0 3 0 0 0 0 0 0 0 \n0 0 3 0 0 0 0 0 0 \n0 0 0 3 0 0 0 0 0 \n0 0 0 0 3 0 0 0 0 \n0 0 0 0 0 3 0 0 0 \n0 0 0 0 0 0 3 0 0 \n0 0 0 0 0 0 0 3 0 \n0 0 0 0 0 0 0 0 3 "
},
{
"input": "31 581",
"output": "581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 581 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "100 1000",
"output": "1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1000 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..."
},
{
"input": "100 999",
"output": "999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 999 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 998",
"output": "998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 998 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "100 997",
"output": "997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 997 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "81 111",
"output": "111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 111 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 111 0 0..."
},
{
"input": "1 407",
"output": "407 "
},
{
"input": "54 341",
"output": "341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 341 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "92 460",
"output": "460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 460 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "34 47",
"output": "47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 47 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 0 0 0 0 0 ..."
},
{
"input": "11 547",
"output": "547 0 0 0 0 0 0 0 0 0 0 \n0 547 0 0 0 0 0 0 0 0 0 \n0 0 547 0 0 0 0 0 0 0 0 \n0 0 0 547 0 0 0 0 0 0 0 \n0 0 0 0 547 0 0 0 0 0 0 \n0 0 0 0 0 547 0 0 0 0 0 \n0 0 0 0 0 0 547 0 0 0 0 \n0 0 0 0 0 0 0 547 0 0 0 \n0 0 0 0 0 0 0 0 547 0 0 \n0 0 0 0 0 0 0 0 0 547 0 \n0 0 0 0 0 0 0 0 0 0 547 "
},
{
"input": "100 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "99 2",
"output": "2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "2 7",
"output": "7 0 \n0 7 "
},
{
"input": "100 100",
"output": "100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 \n0 0 100 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0..."
},
{
"input": "4 3",
"output": "3 0 0 0 \n0 3 0 0 \n0 0 3 0 \n0 0 0 3 "
},
{
"input": "3 2",
"output": "2 0 0 \n0 2 0 \n0 0 2 "
}
] | 1,590,038,620
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 22
| 124
| 307,200
|
n , k=map(int , input().split())
for i in range(1,n+1):
for j in range(1,n+1):
print(k if i == j else 0, end = ' ')
print()
|
Title: Levko and Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko loves tables that consist of *n* rows and *n* columns very much. He especially loves beautiful tables. A table is beautiful to Levko if the sum of elements in each row and column of the table equals *k*.
Unfortunately, he doesn't know any such table. Your task is to help him to find at least one of them.
Input Specification:
The single line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=1000).
Output Specification:
Print any beautiful table. Levko doesn't like too big numbers, so all elements of the table mustn't exceed 1000 in their absolute value.
If there are multiple suitable tables, you are allowed to print any of them.
Demo Input:
['2 4\n', '4 7\n']
Demo Output:
['1 3\n3 1\n', '2 1 0 4\n4 0 2 1\n1 3 3 0\n0 3 2 2\n']
Note:
In the first sample the sum in the first row is 1 + 3 = 4, in the second row — 3 + 1 = 4, in the first column — 1 + 3 = 4 and in the second column — 3 + 1 = 4. There are other beautiful tables for this sample.
In the second sample the sum of elements in each row and each column equals 7. Besides, there are other tables that meet the statement requirements.
|
```python
n , k=map(int , input().split())
for i in range(1,n+1):
for j in range(1,n+1):
print(k if i == j else 0, end = ' ')
print()
```
| 3
|
|
474
|
B
|
Worms
|
PROGRAMMING
| 1,200
|
[
"binary search",
"implementation"
] | null | null |
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
|
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
|
[
"5\n2 7 3 4 9\n3\n1 25 11\n"
] |
[
"1\n5\n3\n"
] |
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
| 1,000
|
[
{
"input": "5\n2 7 3 4 9\n3\n1 25 11",
"output": "1\n5\n3"
}
] | 1,675,770,559
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 15
| 0
|
import numpy as np
n = int(input())
l = list(map(int,input().split()))
ans = np.zeros(int(sum(l))+2)
i = 1
for x in range(len(l)):
for j in range(i,i+l[x]):
ans[j] = int(x+1)
i = i+l[x]
t = int(input())
q = list(map(int,input().split()))
for i in q :
print(int(ans[i]))
|
Title: Worms
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Output Specification:
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
Demo Input:
['5\n2 7 3 4 9\n3\n1 25 11\n']
Demo Output:
['1\n5\n3\n']
Note:
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
|
```python
import numpy as np
n = int(input())
l = list(map(int,input().split()))
ans = np.zeros(int(sum(l))+2)
i = 1
for x in range(len(l)):
for j in range(i,i+l[x]):
ans[j] = int(x+1)
i = i+l[x]
t = int(input())
q = list(map(int,input().split()))
for i in q :
print(int(ans[i]))
```
| -1
|
|
350
|
B
|
Resort
|
PROGRAMMING
| 1,500
|
[
"graphs"
] | null | null |
Valera's finally decided to go on holiday! He packed up and headed for a ski resort.
Valera's fancied a ski trip but he soon realized that he could get lost in this new place. Somebody gave him a useful hint: the resort has *n* objects (we will consider the objects indexed in some way by integers from 1 to *n*), each object is either a hotel or a mountain.
Valera has also found out that the ski resort had multiple ski tracks. Specifically, for each object *v*, the resort has at most one object *u*, such that there is a ski track built from object *u* to object *v*. We also know that no hotel has got a ski track leading from the hotel to some object.
Valera is afraid of getting lost on the resort. So he wants you to come up with a path he would walk along. The path must consist of objects *v*1,<=*v*2,<=...,<=*v**k* (*k*<=≥<=1) and meet the following conditions:
1. Objects with numbers *v*1,<=*v*2,<=...,<=*v**k*<=-<=1 are mountains and the object with number *v**k* is the hotel. 1. For any integer *i* (1<=≤<=*i*<=<<=*k*), there is exactly one ski track leading from object *v**i*. This track goes to object *v**i*<=+<=1. 1. The path contains as many objects as possible (*k* is maximal).
Help Valera. Find such path that meets all the criteria of our hero!
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of objects.
The second line contains *n* space-separated integers *type*1,<=*type*2,<=...,<=*type**n* — the types of the objects. If *type**i* equals zero, then the *i*-th object is the mountain. If *type**i* equals one, then the *i*-th object is the hotel. It is guaranteed that at least one object is a hotel.
The third line of the input contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*) — the description of the ski tracks. If number *a**i* equals zero, then there is no such object *v*, that has a ski track built from *v* to *i*. If number *a**i* doesn't equal zero, that means that there is a track built from object *a**i* to object *i*.
|
In the first line print *k* — the maximum possible path length for Valera. In the second line print *k* integers *v*1,<=*v*2,<=...,<=*v**k* — the path. If there are multiple solutions, you can print any of them.
|
[
"5\n0 0 0 0 1\n0 1 2 3 4\n",
"5\n0 0 1 0 1\n0 1 2 2 4\n",
"4\n1 0 0 0\n2 3 4 2\n"
] |
[
"5\n1 2 3 4 5\n",
"2\n4 5\n",
"1\n1\n"
] |
none
| 1,000
|
[
{
"input": "5\n0 0 0 0 1\n0 1 2 3 4",
"output": "5\n1 2 3 4 5"
},
{
"input": "5\n0 0 1 0 1\n0 1 2 2 4",
"output": "2\n4 5"
},
{
"input": "4\n1 0 0 0\n2 3 4 2",
"output": "1\n1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 1\n4 0 8 4 7 8 5 5 7 2",
"output": "2\n2 10"
},
{
"input": "50\n0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 1 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 1 1 0 0 0 1 0\n28 4 33 22 4 35 36 31 42 25 50 33 25 36 18 23 23 28 43 3 18 31 1 2 15 22 40 43 29 32 28 35 18 27 48 40 14 36 27 50 40 5 48 14 36 24 32 33 26 50",
"output": "2\n3 20"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 1 0 0 0 0 1 0 0 0 0 1 0 0 0 0 0\n86 12 47 46 45 31 20 47 58 79 23 70 35 72 37 20 16 64 46 87 57 7 84 72 70 3 14 40 17 42 30 99 12 20 38 98 14 40 4 83 10 15 47 30 83 58 12 7 97 46 17 6 41 13 87 37 36 12 7 25 26 35 69 13 18 5 9 53 72 28 13 51 5 57 14 64 28 25 91 96 57 69 9 12 97 7 56 42 31 15 88 16 41 88 86 13 89 81 3 42",
"output": "1\n44"
},
{
"input": "10\n1 0 0 0 0 0 0 0 0 0\n6 2 7 8 2 9 0 5 4 2",
"output": "6\n5 8 4 9 6 1"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n38 2 49 55 6 42 12 100 25 69 85 76 13 22 78 73 37 64 5 21 0 23 61 87 4 16 44 3 98 54 1 91 18 26 82 24 18 50 95 21 75 97 51 9 67 73 51 19 63 92 27 82 8 7 20 84 2 93 40 11 39 80 58 85 74 48 72 78 34 33 31 65 46 71 32 36 33 88 47 4 66 84 16 27 16 14 90 16 79 41 99 30 57 73 28 89 45 81 86 29",
"output": "52\n57 93 58 63 49 3 28 95 39 61 23 22 14 86 99 91 32 75 41 90 87 24 36 76 12 7 54 30 92 50 38 1 31 71 74 65 72 67 45 97 42 6 5 19 48 66 81 98 29 100 8 53"
},
{
"input": "2\n1 1\n0 0",
"output": "1\n1"
},
{
"input": "1\n1\n0",
"output": "1\n1"
}
] | 1,665,819,293
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 4
| 154
| 22,425,600
|
import sys
input = sys.stdin.readline
n = int(input())
a = [0] + list(map(int, input().split()))
b = [0] + list(map(int, input().split()))
d = []
x = [0 for i in range(n+1)]
for i in b:
x[i] += 1
for i in range(1, n+1):
if a[i] == 1:
w = [i]
q = b[i]
while x[q] == 1:
w.append(q)
q = b[q]
if len(w) > len(d):
d = w.copy()
print(len(w))
print(' '.join(map(str, w[::-1])))
|
Title: Resort
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera's finally decided to go on holiday! He packed up and headed for a ski resort.
Valera's fancied a ski trip but he soon realized that he could get lost in this new place. Somebody gave him a useful hint: the resort has *n* objects (we will consider the objects indexed in some way by integers from 1 to *n*), each object is either a hotel or a mountain.
Valera has also found out that the ski resort had multiple ski tracks. Specifically, for each object *v*, the resort has at most one object *u*, such that there is a ski track built from object *u* to object *v*. We also know that no hotel has got a ski track leading from the hotel to some object.
Valera is afraid of getting lost on the resort. So he wants you to come up with a path he would walk along. The path must consist of objects *v*1,<=*v*2,<=...,<=*v**k* (*k*<=≥<=1) and meet the following conditions:
1. Objects with numbers *v*1,<=*v*2,<=...,<=*v**k*<=-<=1 are mountains and the object with number *v**k* is the hotel. 1. For any integer *i* (1<=≤<=*i*<=<<=*k*), there is exactly one ski track leading from object *v**i*. This track goes to object *v**i*<=+<=1. 1. The path contains as many objects as possible (*k* is maximal).
Help Valera. Find such path that meets all the criteria of our hero!
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of objects.
The second line contains *n* space-separated integers *type*1,<=*type*2,<=...,<=*type**n* — the types of the objects. If *type**i* equals zero, then the *i*-th object is the mountain. If *type**i* equals one, then the *i*-th object is the hotel. It is guaranteed that at least one object is a hotel.
The third line of the input contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=*n*) — the description of the ski tracks. If number *a**i* equals zero, then there is no such object *v*, that has a ski track built from *v* to *i*. If number *a**i* doesn't equal zero, that means that there is a track built from object *a**i* to object *i*.
Output Specification:
In the first line print *k* — the maximum possible path length for Valera. In the second line print *k* integers *v*1,<=*v*2,<=...,<=*v**k* — the path. If there are multiple solutions, you can print any of them.
Demo Input:
['5\n0 0 0 0 1\n0 1 2 3 4\n', '5\n0 0 1 0 1\n0 1 2 2 4\n', '4\n1 0 0 0\n2 3 4 2\n']
Demo Output:
['5\n1 2 3 4 5\n', '2\n4 5\n', '1\n1\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
n = int(input())
a = [0] + list(map(int, input().split()))
b = [0] + list(map(int, input().split()))
d = []
x = [0 for i in range(n+1)]
for i in b:
x[i] += 1
for i in range(1, n+1):
if a[i] == 1:
w = [i]
q = b[i]
while x[q] == 1:
w.append(q)
q = b[q]
if len(w) > len(d):
d = w.copy()
print(len(w))
print(' '.join(map(str, w[::-1])))
```
| 0
|
|
754
|
A
|
Lesha and array splitting
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"greedy",
"implementation"
] | null | null |
One spring day on his way to university Lesha found an array *A*. Lesha likes to split arrays into several parts. This time Lesha decided to split the array *A* into several, possibly one, new arrays so that the sum of elements in each of the new arrays is not zero. One more condition is that if we place the new arrays one after another they will form the old array *A*.
Lesha is tired now so he asked you to split the array. Help Lesha!
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array *A*.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=103<=≤<=*a**i*<=≤<=103) — the elements of the array *A*.
|
If it is not possible to split the array *A* and satisfy all the constraints, print single line containing "NO" (without quotes).
Otherwise in the first line print "YES" (without quotes). In the next line print single integer *k* — the number of new arrays. In each of the next *k* lines print two integers *l**i* and *r**i* which denote the subarray *A*[*l**i*... *r**i*] of the initial array *A* being the *i*-th new array. Integers *l**i*, *r**i* should satisfy the following conditions:
- *l*1<==<=1 - *r**k*<==<=*n* - *r**i*<=+<=1<==<=*l**i*<=+<=1 for each 1<=≤<=*i*<=<<=*k*.
If there are multiple answers, print any of them.
|
[
"3\n1 2 -3\n",
"8\n9 -12 3 4 -4 -10 7 3\n",
"1\n0\n",
"4\n1 2 3 -5\n"
] |
[
"YES\n2\n1 2\n3 3\n",
"YES\n2\n1 2\n3 8\n",
"NO\n",
"YES\n4\n1 1\n2 2\n3 3\n4 4\n"
] |
none
| 500
|
[
{
"input": "3\n1 2 -3",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "8\n9 -12 3 4 -4 -10 7 3",
"output": "YES\n8\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8"
},
{
"input": "1\n0",
"output": "NO"
},
{
"input": "4\n1 2 3 -5",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "6\n0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n507 -724 -243 -846 697 -569 -786 472 756 -272 731 -534 -664 202 592 -381 161 -668 -895 296 472 -868 599 396 -617 310 -283 -118 829 -218 807 939 -152 -343 -96 692 -570 110 442 159 -446 -631 -881 784 894 -3 -792 654 -273 -791 638 -599 -763 586 -812 248 -590 455 926 -402 61 228 209 419 -511 310 -283 857 369 472 -82 -435 -717 -421 862 -384 659 -235 406 793 -167 -504 -432 -951 0 165 36 650 -145 -500 988 -513 -495 -476 312 -754 332 819 -797 -715",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "100\n1 -2 -1 -1 2 2 0 1 -1 1 0 -2 1 -1 0 -2 -1 -1 2 0 -1 2 0 1 -2 -2 -1 1 2 0 -2 -2 -1 1 1 -1 -2 -1 0 -1 2 1 -1 -2 0 2 1 1 -2 1 1 -1 2 -2 2 0 1 -1 1 -2 0 0 0 0 0 0 -2 -2 2 1 2 2 0 -1 1 1 -2 -2 -2 1 0 2 -1 -2 -1 0 0 0 2 1 -2 0 -2 0 2 1 -2 -1 2 1",
"output": "YES\n78\n1 1\n2 2\n3 3\n4 4\n5 5\n6 7\n8 8\n9 9\n10 11\n12 12\n13 13\n14 15\n16 16\n17 17\n18 18\n19 20\n21 21\n22 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 39\n40 40\n41 41\n42 42\n43 43\n44 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 56\n57 57\n58 58\n59 59\n60 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 73\n74 74\n75 75\n76 76\n77 77\n78 78\n79 79\n80 81\n82 82\n83 83\n84 84\n85 88\n89 89\n90 90\n91 92\n93 94\n95 95\n96 96\n..."
},
{
"input": "7\n0 0 0 0 3 -3 0",
"output": "YES\n2\n1 5\n6 7"
},
{
"input": "5\n0 0 -4 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "100\n2 -38 51 -71 -24 19 35 -27 48 18 64 -4 30 -28 74 -17 -19 -25 54 41 3 -46 -43 -42 87 -76 -62 28 1 32 7 -76 15 0 -82 -33 17 40 -41 -7 43 -18 -27 65 -27 -13 46 -38 75 7 62 -23 7 -12 80 36 37 14 6 -40 -11 -35 -77 -24 -59 75 -41 -21 17 -21 -14 67 -36 16 -1 34 -26 30 -62 -4 -63 15 -49 18 57 7 77 23 -26 8 -20 8 -16 9 50 -24 -33 9 -9 -33",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75 75\n76..."
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -38 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 100"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n0 0 -17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 34\n35 100"
},
{
"input": "3\n1 -3 3",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "3\n1 0 -1",
"output": "YES\n2\n1 2\n3 3"
},
{
"input": "3\n3 0 0",
"output": "YES\n1\n1 3"
},
{
"input": "3\n0 0 0",
"output": "NO"
},
{
"input": "3\n-3 3 0",
"output": "YES\n2\n1 1\n2 3"
},
{
"input": "4\n3 -2 -1 3",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "4\n-1 0 1 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "4\n0 0 0 3",
"output": "YES\n1\n1 4"
},
{
"input": "4\n0 0 0 0",
"output": "NO"
},
{
"input": "4\n3 0 -3 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "5\n-3 2 2 0 -2",
"output": "YES\n4\n1 1\n2 2\n3 4\n5 5"
},
{
"input": "5\n0 -1 2 0 -1",
"output": "YES\n3\n1 2\n3 4\n5 5"
},
{
"input": "5\n0 2 0 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "5\n0 0 0 0 0",
"output": "NO"
},
{
"input": "5\n0 0 0 0 0",
"output": "NO"
},
{
"input": "20\n101 89 -166 -148 -38 -135 -138 193 14 -134 -185 -171 -52 -191 195 39 -148 200 51 -73",
"output": "YES\n20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "20\n-118 -5 101 7 9 144 55 -55 -9 -126 -71 -71 189 -64 -187 123 0 -48 -12 138",
"output": "YES\n19\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 17\n18 18\n19 19\n20 20"
},
{
"input": "20\n-161 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 20"
},
{
"input": "20\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "20\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 -137 0 0 0 0 137",
"output": "YES\n2\n1 19\n20 20"
},
{
"input": "40\n64 -94 -386 -78 35 -233 33 82 -5 -200 368 -259 124 353 390 -305 -247 -133 379 44 133 -146 151 -217 -16 53 -157 186 -203 -8 117 -71 272 -290 -97 133 52 113 -280 -176",
"output": "YES\n40\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40"
},
{
"input": "40\n120 -96 -216 131 231 -80 -166 -102 16 227 -120 105 43 -83 -53 229 24 190 -268 119 230 348 -33 19 0 -187 -349 -25 80 -38 -30 138 -104 337 -98 0 1 -66 -243 -231",
"output": "YES\n38\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 36\n37 37\n38 38\n39 39\n40 40"
},
{
"input": "40\n0 0 0 0 0 0 324 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 40"
},
{
"input": "40\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "40\n0 0 0 0 0 308 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -308 0 0 0 0 0 0 0",
"output": "YES\n2\n1 32\n33 40"
},
{
"input": "60\n-288 -213 -213 -23 496 489 137 -301 -219 -296 -577 269 -153 -52 -505 -138 -377 500 -256 405 588 274 -115 375 -93 117 -360 -160 429 -339 502 310 502 572 -41 -26 152 -203 562 -525 -179 -67 424 62 -329 -127 352 -474 417 -30 518 326 200 -598 471 107 339 107 -9 -244",
"output": "YES\n60\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60"
},
{
"input": "60\n112 141 -146 -389 175 399 -59 327 -41 397 263 -422 157 0 471 -2 -381 -438 99 368 173 9 -171 118 24 111 120 70 11 317 -71 -574 -139 0 -477 -211 -116 -367 16 568 -75 -430 75 -179 -21 156 291 -422 441 -224 -8 -337 -104 381 60 -138 257 91 103 -359",
"output": "YES\n58\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -238 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 60"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 -98 0 0 0 0 0 0 0 0 98 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 18\n19 60"
},
{
"input": "80\n-295 -774 -700 -366 -304 -173 -672 288 -721 -256 -348 650 223 211 379 -13 -483 162 800 631 -550 -704 -357 -306 490 713 -80 -234 -669 675 -688 471 315 607 -87 -327 -799 514 248 379 271 325 -244 98 -100 -447 574 -154 554 -377 380 -423 -140 -147 -189 -420 405 464 -110 273 -226 -109 -578 641 -426 -548 214 -184 -397 570 -428 -676 652 -155 127 462 338 534 -782 -481",
"output": "YES\n80\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "80\n237 66 409 -208 -460 4 -448 29 -420 -192 -21 -76 -147 435 205 -42 -299 -29 244 -480 -4 -38 2 -214 -311 556 692 111 -19 -84 -90 -350 -354 125 -207 -137 93 367 -481 -462 -440 -92 424 -107 221 -100 -631 -72 105 201 226 -90 197 -264 427 113 202 -144 -115 398 331 147 56 -24 292 -267 -31 -11 202 506 334 -103 534 -155 -472 -124 -257 209 12 360",
"output": "YES\n80\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 668 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 80"
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 -137 137 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 13\n14 80"
},
{
"input": "100\n-98 369 544 197 -991 231 399 521 582 -820 -650 -919 -615 -411 -843 -974 231 140 239 -209 721 84 -834 -27 162 460 -157 -40 0 -778 -491 -607 -34 -647 834 -7 -518 -5 -31 -766 -54 -698 -838 497 980 -77 238 549 -135 7 -629 -892 455 181 527 314 465 -321 656 -390 368 384 601 332 561 -1000 -636 -106 412 -216 -58 -365 -155 -445 404 114 260 -392 -20 840 -395 620 -860 -936 1 882 958 536 589 235 300 676 478 434 229 698 157 -95 908 -170",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75 75\n76..."
},
{
"input": "100\n-149 -71 -300 288 -677 -580 248 49 -167 264 -215 878 7 252 -239 25 -369 -22 526 -415 -175 173 549 679 161 -411 743 -454 -34 -714 282 -198 -47 -519 -45 71 615 -214 -317 399 86 -97 246 689 -22 -197 -139 237 -501 477 -385 -421 -463 -641 409 -279 538 -382 48 189 652 -696 74 303 6 -183 336 17 -178 -617 -739 280 -202 454 864 218 480 293 -118 -518 -24 -866 -357 410 239 -833 510 316 -168 38 -370 -22 741 470 -60 -507 -209 704 141 -148",
"output": "YES\n100\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n7..."
},
{
"input": "100\n0 0 697 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 100"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -475 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 475 0 0 0 0",
"output": "YES\n2\n1 95\n96 100"
},
{
"input": "4\n0 0 3 -3",
"output": "YES\n2\n1 3\n4 4"
},
{
"input": "4\n1 0 0 0",
"output": "YES\n1\n1 4"
},
{
"input": "4\n3 3 3 3",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "2\n0 1",
"output": "YES\n1\n1 2"
},
{
"input": "4\n0 -1 1 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "1\n1",
"output": "YES\n1\n1 1"
},
{
"input": "5\n0 0 1 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "4\n0 0 1 0",
"output": "YES\n1\n1 4"
},
{
"input": "10\n1 2 0 0 3 -3 0 0 -3 0",
"output": "YES\n5\n1 1\n2 4\n5 5\n6 8\n9 10"
},
{
"input": "3\n0 -1 0",
"output": "YES\n1\n1 3"
},
{
"input": "2\n1 0",
"output": "YES\n1\n1 2"
},
{
"input": "5\n3 -3 0 0 0",
"output": "YES\n2\n1 1\n2 5"
},
{
"input": "3\n0 1 0",
"output": "YES\n1\n1 3"
},
{
"input": "4\n0 0 0 1",
"output": "YES\n1\n1 4"
},
{
"input": "4\n1 -1 1 -1",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "1\n-1",
"output": "YES\n1\n1 1"
},
{
"input": "2\n1 1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n1 -1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n0 0",
"output": "NO"
},
{
"input": "2\n0 -1",
"output": "YES\n1\n1 2"
},
{
"input": "2\n-1 1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n-1 0",
"output": "YES\n1\n1 2"
},
{
"input": "2\n-1 -1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "3\n5 -5 5",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "5\n1 0 -1 0 1",
"output": "YES\n3\n1 2\n3 4\n5 5"
},
{
"input": "6\n0 0 0 3 0 0",
"output": "YES\n1\n1 6"
},
{
"input": "3\n1 -1 1",
"output": "YES\n3\n1 1\n2 2\n3 3"
}
] | 1,640,880,567
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 80
| 61
| 0
|
a=int(input())
b=list(map(int,input().split()))
s=0
l=[]
for i in b:
s+=i
if s!=0:
print("YES")
print("1")
print("1",len(b))
elif len(b)==b.count(0):
print("NO")
else:
for i in b:
if i!=0:
break
t=b.index(i)+1
print('YES')
print(2)
print("1",t)
print(t+1,len(b))
|
Title: Lesha and array splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One spring day on his way to university Lesha found an array *A*. Lesha likes to split arrays into several parts. This time Lesha decided to split the array *A* into several, possibly one, new arrays so that the sum of elements in each of the new arrays is not zero. One more condition is that if we place the new arrays one after another they will form the old array *A*.
Lesha is tired now so he asked you to split the array. Help Lesha!
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array *A*.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=103<=≤<=*a**i*<=≤<=103) — the elements of the array *A*.
Output Specification:
If it is not possible to split the array *A* and satisfy all the constraints, print single line containing "NO" (without quotes).
Otherwise in the first line print "YES" (without quotes). In the next line print single integer *k* — the number of new arrays. In each of the next *k* lines print two integers *l**i* and *r**i* which denote the subarray *A*[*l**i*... *r**i*] of the initial array *A* being the *i*-th new array. Integers *l**i*, *r**i* should satisfy the following conditions:
- *l*1<==<=1 - *r**k*<==<=*n* - *r**i*<=+<=1<==<=*l**i*<=+<=1 for each 1<=≤<=*i*<=<<=*k*.
If there are multiple answers, print any of them.
Demo Input:
['3\n1 2 -3\n', '8\n9 -12 3 4 -4 -10 7 3\n', '1\n0\n', '4\n1 2 3 -5\n']
Demo Output:
['YES\n2\n1 2\n3 3\n', 'YES\n2\n1 2\n3 8\n', 'NO\n', 'YES\n4\n1 1\n2 2\n3 3\n4 4\n']
Note:
none
|
```python
a=int(input())
b=list(map(int,input().split()))
s=0
l=[]
for i in b:
s+=i
if s!=0:
print("YES")
print("1")
print("1",len(b))
elif len(b)==b.count(0):
print("NO")
else:
for i in b:
if i!=0:
break
t=b.index(i)+1
print('YES')
print(2)
print("1",t)
print(t+1,len(b))
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,663,229,323
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
M,N=map(int,input().split())
if M%2==1 and N%2==1:
n=((M-1)*N/2)+(N-1)/2
print(int(n))
else:
print(int(M*N/2))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
M,N=map(int,input().split())
if M%2==1 and N%2==1:
n=((M-1)*N/2)+(N-1)/2
print(int(n))
else:
print(int(M*N/2))
```
| 3.977
|
393
|
A
|
Nineteen
|
PROGRAMMING
| 0
|
[] | null | null |
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
|
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
|
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
|
[
"nniinneetteeeenn\n",
"nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n",
"nineteenineteen\n"
] |
[
"2",
"2",
"2"
] |
none
| 500
|
[
{
"input": "nniinneetteeeenn",
"output": "2"
},
{
"input": "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii",
"output": "2"
},
{
"input": "nineteenineteen",
"output": "2"
},
{
"input": "nssemsnnsitjtihtthij",
"output": "0"
},
{
"input": "eehihnttehtherjsihihnrhimihrjinjiehmtjimnrss",
"output": "1"
},
{
"input": "rrrteiehtesisntnjirtitijnjjjthrsmhtneirjimniemmnrhirssjnhetmnmjejjnjjritjttnnrhnjs",
"output": "2"
},
{
"input": "mmrehtretseihsrjmtsenemniehssnisijmsnntesismmtmthnsieijjjnsnhisi",
"output": "2"
},
{
"input": "hshretttnntmmiertrrnjihnrmshnthirnnirrheinnnrjiirshthsrsijtrrtrmnjrrjnresnintnmtrhsnjrinsseimn",
"output": "1"
},
{
"input": "snmmensntritetnmmmerhhrmhnehehtesmhthseemjhmnrti",
"output": "2"
},
{
"input": "rmeetriiitijmrenmeiijt",
"output": "0"
},
{
"input": "ihimeitimrmhriemsjhrtjtijtesmhemnmmrsetmjttthtjhnnmirtimne",
"output": "1"
},
{
"input": "rhtsnmnesieernhstjnmmirthhieejsjttsiierhihhrrijhrrnejsjer",
"output": "2"
},
{
"input": "emmtjsjhretehmiiiestmtmnmissjrstnsnjmhimjmststsitemtttjrnhsrmsenjtjim",
"output": "2"
},
{
"input": "nmehhjrhirniitshjtrrtitsjsntjhrstjehhhrrerhemehjeermhmhjejjesnhsiirheijjrnrjmminneeehtm",
"output": "3"
},
{
"input": "hsntijjetmehejtsitnthietssmeenjrhhetsnjrsethisjrtrhrierjtmimeenjnhnijeesjttrmn",
"output": "3"
},
{
"input": "jnirirhmirmhisemittnnsmsttesjhmjnsjsmntisheneiinsrjsjirnrmnjmjhmistntersimrjni",
"output": "1"
},
{
"input": "neithjhhhtmejjnmieishethmtetthrienrhjmjenrmtejerernmthmsnrthhtrimmtmshm",
"output": "2"
},
{
"input": "sithnrsnemhijsnjitmijjhejjrinejhjinhtisttteermrjjrtsirmessejireihjnnhhemiirmhhjeet",
"output": "3"
},
{
"input": "jrjshtjstteh",
"output": "0"
},
{
"input": "jsihrimrjnnmhttmrtrenetimemjnshnimeiitmnmjishjjneisesrjemeshjsijithtn",
"output": "2"
},
{
"input": "hhtjnnmsemermhhtsstejehsssmnesereehnnsnnremjmmieethmirjjhn",
"output": "2"
},
{
"input": "tmnersmrtsehhntsietttrehrhneiireijnijjejmjhei",
"output": "1"
},
{
"input": "mtstiresrtmesritnjriirehtermtrtseirtjrhsejhhmnsineinsjsin",
"output": "2"
},
{
"input": "ssitrhtmmhtnmtreijteinimjemsiiirhrttinsnneshintjnin",
"output": "1"
},
{
"input": "rnsrsmretjiitrjthhritniijhjmm",
"output": "0"
},
{
"input": "hntrteieimrimteemenserntrejhhmijmtjjhnsrsrmrnsjseihnjmehtthnnithirnhj",
"output": "3"
},
{
"input": "nmmtsmjrntrhhtmimeresnrinstjnhiinjtnjjjnthsintmtrhijnrnmtjihtinmni",
"output": "0"
},
{
"input": "eihstiirnmteejeehimttrijittjsntjejmessstsemmtristjrhenithrrsssihnthheehhrnmimssjmejjreimjiemrmiis",
"output": "2"
},
{
"input": "srthnimimnemtnmhsjmmmjmmrsrisehjseinemienntetmitjtnnneseimhnrmiinsismhinjjnreehseh",
"output": "3"
},
{
"input": "etrsmrjehntjjimjnmsresjnrthjhehhtreiijjminnheeiinseenmmethiemmistsei",
"output": "3"
},
{
"input": "msjeshtthsieshejsjhsnhejsihisijsertenrshhrthjhiirijjneinjrtrmrs",
"output": "1"
},
{
"input": "mehsmstmeejrhhsjihntjmrjrihssmtnensttmirtieehimj",
"output": "1"
},
{
"input": "mmmsermimjmrhrhejhrrejermsneheihhjemnehrhihesnjsehthjsmmjeiejmmnhinsemjrntrhrhsmjtttsrhjjmejj",
"output": "2"
},
{
"input": "rhsmrmesijmmsnsmmhertnrhsetmisshriirhetmjihsmiinimtrnitrseii",
"output": "1"
},
{
"input": "iihienhirmnihh",
"output": "0"
},
{
"input": "ismtthhshjmhisssnmnhe",
"output": "0"
},
{
"input": "rhsmnrmhejshinnjrtmtsssijimimethnm",
"output": "0"
},
{
"input": "eehnshtiriejhiirntminrirnjihmrnittnmmnjejjhjtennremrnssnejtntrtsiejjijisermj",
"output": "3"
},
{
"input": "rnhmeesnhttrjintnhnrhristjrthhrmehrhjmjhjehmstrijemjmmistes",
"output": "2"
},
{
"input": "ssrmjmjeeetrnimemrhimes",
"output": "0"
},
{
"input": "n",
"output": "0"
},
{
"input": "ni",
"output": "0"
},
{
"input": "nine",
"output": "0"
},
{
"input": "nineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteen",
"output": "13"
},
{
"input": "ninetee",
"output": "0"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwynd",
"output": "0"
},
{
"input": "zenudggmyopddhszhrbmftgzmjorabhgojdtfnzxjkayjlkgczsyshczutkdch",
"output": "0"
},
{
"input": "rtzxovxqfapkdmelxiyjroohufhbakpmmvaxq",
"output": "0"
},
{
"input": "zninetneeineteeniwnteeennieteenineteenineteenineteenineteenineteenineteenineteenineteeninetzeenz",
"output": "13"
},
{
"input": "nnnnnnniiiiiiiiiiiitttttttttteeeeeeeeeeeeeeeeee",
"output": "3"
},
{
"input": "ttttiiiieeeeeeeeeeeennnnnnnnn",
"output": "4"
},
{
"input": "ttttttttteeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiinnnnnnn",
"output": "3"
},
{
"input": "nnnnnnnnnneeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiiiiitttttttttttttttttttt",
"output": "4"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiittttttttttttttttnnnnnnn",
"output": "3"
},
{
"input": "nineeen",
"output": "0"
},
{
"input": "nineteeeeeeeeeeeeeeeeettttttttttttttttttiiiiiiiiiiiiiiiiii",
"output": "0"
},
{
"input": "nineteenieteenieteenieteenieteenieteenieteen",
"output": "4"
},
{
"input": "nineteenineteenineteenineteenineteen",
"output": "5"
}
] | 1,584,681,185
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 171
| 0
|
from collections import *
s=input()
ka=Counter(s)
print(min(ka['n']//3,ka['e']//3,ka['i']//1,ka['t']))
|
Title: Nineteen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
Input Specification:
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
Output Specification:
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
Demo Input:
['nniinneetteeeenn\n', 'nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n', 'nineteenineteen\n']
Demo Output:
['2', '2', '2']
Note:
none
|
```python
from collections import *
s=input()
ka=Counter(s)
print(min(ka['n']//3,ka['e']//3,ka['i']//1,ka['t']))
```
| 0
|
|
583
|
B
|
Robot's Task
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
|
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
|
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
|
[
"3\n0 2 0\n",
"5\n4 2 3 0 1\n",
"7\n0 3 1 0 5 2 6\n"
] |
[
"1\n",
"3\n",
"2\n"
] |
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7.
| 1,000
|
[
{
"input": "3\n0 2 0",
"output": "1"
},
{
"input": "5\n4 2 3 0 1",
"output": "3"
},
{
"input": "7\n0 3 1 0 5 2 6",
"output": "2"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "0"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "3\n0 2 1",
"output": "1"
},
{
"input": "10\n7 1 9 3 5 8 6 0 2 4",
"output": "9"
},
{
"input": "10\n1 3 5 7 9 8 6 4 2 0",
"output": "9"
},
{
"input": "10\n5 0 0 1 3 2 2 2 5 7",
"output": "1"
},
{
"input": "10\n8 6 5 3 9 7 1 4 2 0",
"output": "8"
},
{
"input": "10\n1 2 4 5 0 1 3 7 1 4",
"output": "2"
},
{
"input": "10\n3 4 8 9 5 1 2 0 6 7",
"output": "6"
},
{
"input": "10\n2 2 0 0 6 2 9 0 2 0",
"output": "2"
},
{
"input": "10\n1 7 5 3 2 6 0 8 4 9",
"output": "8"
},
{
"input": "9\n1 3 8 6 2 4 5 0 7",
"output": "7"
},
{
"input": "9\n1 3 5 7 8 6 4 2 0",
"output": "8"
},
{
"input": "9\n2 4 3 1 3 0 5 4 3",
"output": "3"
},
{
"input": "9\n3 5 6 8 7 0 4 2 1",
"output": "5"
},
{
"input": "9\n2 0 8 1 0 3 0 5 3",
"output": "2"
},
{
"input": "9\n6 2 3 7 4 8 5 1 0",
"output": "4"
},
{
"input": "9\n3 1 5 6 0 3 2 0 0",
"output": "2"
},
{
"input": "9\n2 6 4 1 0 8 5 3 7",
"output": "7"
},
{
"input": "100\n27 20 18 78 93 38 56 2 48 75 36 88 96 57 69 10 25 74 68 86 65 85 66 14 22 12 43 80 99 34 42 63 61 71 77 15 37 54 21 59 23 94 28 30 50 84 62 76 47 16 26 64 82 92 72 53 17 11 41 91 35 83 79 95 67 13 1 7 3 4 73 90 8 19 33 58 98 32 39 45 87 52 60 46 6 44 49 70 51 9 5 29 31 24 40 97 81 0 89 55",
"output": "69"
},
{
"input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "99"
},
{
"input": "100\n13 89 81 0 62 1 59 92 29 13 1 37 2 8 53 15 20 34 12 70 0 85 97 55 84 60 37 54 14 65 22 69 30 22 95 44 59 85 50 80 9 71 91 93 74 21 11 78 28 21 40 81 76 24 26 60 48 85 61 68 89 76 46 73 34 52 98 29 4 38 94 51 5 55 6 27 74 27 38 37 82 70 44 89 51 59 30 37 15 55 63 78 42 39 71 43 4 10 2 13",
"output": "21"
},
{
"input": "100\n1 3 5 7 58 11 13 15 17 19 45 23 25 27 29 31 33 35 37 39 41 43 21 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 81 79 83 85 87 89 91 93 95 97 48 98 96 94 92 90 88 44 84 82 80 78 76 74 72 70 68 66 64 62 60 9 56 54 52 50 99 46 86 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "96"
},
{
"input": "100\n32 47 74 8 14 4 12 68 18 0 44 80 14 38 6 57 4 72 69 3 21 78 74 22 39 32 58 63 34 33 23 6 39 11 6 12 18 4 0 11 20 28 16 1 22 12 57 55 13 48 43 1 50 18 87 6 11 45 38 67 37 14 7 56 6 41 1 55 5 73 78 64 38 18 38 8 37 0 18 61 37 58 58 62 86 5 0 2 15 43 34 61 2 21 15 9 69 1 11 24",
"output": "4"
},
{
"input": "100\n40 3 55 7 6 77 13 46 17 64 21 54 25 27 91 41 1 15 37 82 23 43 42 47 26 95 53 5 11 59 61 9 78 67 69 58 73 0 36 79 60 83 2 87 63 33 71 89 97 99 98 93 56 92 19 88 86 84 39 28 65 20 34 76 51 94 66 12 62 49 96 72 24 52 48 50 44 35 74 31 38 57 81 32 22 80 70 29 30 18 68 16 14 90 10 8 85 4 45 75",
"output": "75"
},
{
"input": "100\n34 16 42 21 84 27 11 7 82 16 95 39 36 64 26 0 38 37 2 2 16 56 16 61 55 42 26 5 61 8 30 20 19 15 9 78 5 34 15 0 3 17 36 36 1 5 4 26 18 0 14 25 7 5 91 7 43 26 79 37 17 27 40 55 66 7 0 2 16 23 68 35 2 5 9 21 1 7 2 9 4 3 22 15 27 6 0 47 5 0 12 9 20 55 36 10 6 8 5 1",
"output": "3"
},
{
"input": "100\n35 53 87 49 13 24 93 20 5 11 31 32 40 52 96 46 1 25 66 69 28 88 84 82 70 9 75 39 26 21 18 29 23 57 90 16 48 22 95 0 58 43 7 73 8 62 63 30 64 92 79 3 6 94 34 12 76 99 67 55 56 97 14 91 68 36 44 78 41 71 86 89 47 74 4 45 98 37 80 33 83 27 42 59 72 54 17 60 51 81 15 77 65 50 10 85 61 19 38 2",
"output": "67"
},
{
"input": "99\n89 96 56 31 32 14 9 66 87 34 69 5 92 54 41 52 46 30 22 26 16 18 20 68 62 73 90 43 79 33 58 98 37 45 10 78 94 51 19 0 91 39 28 47 17 86 3 61 77 7 15 64 55 83 65 71 97 88 6 48 24 11 8 42 81 4 63 93 50 74 35 12 95 27 53 82 29 85 84 60 72 40 36 57 23 13 38 59 49 1 75 44 76 2 21 25 70 80 67",
"output": "75"
},
{
"input": "99\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "98"
},
{
"input": "99\n82 7 6 77 17 28 90 3 68 12 63 60 24 20 4 81 71 85 57 45 11 84 3 91 49 34 89 82 0 50 48 88 36 76 36 5 62 48 20 2 20 45 69 27 37 62 42 31 57 51 92 84 89 25 7 62 12 23 23 56 30 90 27 10 77 58 48 38 56 68 57 15 33 1 34 67 16 47 75 70 69 28 38 16 5 61 85 76 44 90 37 22 77 94 55 1 97 8 69",
"output": "22"
},
{
"input": "99\n1 51 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 42 43 45 47 49 3 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 8 76 74 72 70 68 66 22 62 60 58 56 54 52 0 48 46 44 41 40 38 36 34 32 30 28 26 24 64 20 18 16 14 12 10 78 6 4 2 50",
"output": "96"
},
{
"input": "99\n22 3 19 13 65 87 28 17 41 40 31 21 8 37 29 65 65 53 16 33 13 5 76 4 72 9 2 76 57 72 50 15 75 0 30 13 83 36 12 31 49 51 65 22 48 31 60 15 2 17 6 1 8 0 1 63 3 16 7 7 2 1 47 28 26 21 2 36 1 5 20 25 44 0 2 39 46 30 33 11 15 34 34 4 84 52 0 39 7 3 17 15 6 38 52 64 26 1 0",
"output": "3"
},
{
"input": "99\n24 87 25 82 97 11 37 15 23 19 34 17 76 13 45 89 33 1 27 78 63 43 54 47 49 2 42 41 75 83 61 90 65 67 21 71 60 57 77 62 81 58 85 69 3 91 68 55 72 93 29 94 66 16 88 86 84 53 14 39 35 44 9 70 80 92 56 79 74 5 64 31 52 50 48 46 51 59 40 38 36 96 32 30 28 95 7 22 20 18 26 73 12 10 8 6 4 98 0",
"output": "74"
},
{
"input": "99\n22 14 0 44 6 17 6 6 37 45 0 48 19 8 57 8 10 0 3 12 25 2 5 53 9 49 15 6 38 14 9 40 38 22 27 12 64 10 11 35 89 19 46 39 12 24 48 0 52 1 27 27 24 4 64 24 5 0 67 3 5 39 0 1 13 37 2 8 46 1 28 70 6 79 14 15 33 6 7 34 6 18 4 71 1 55 33 71 18 11 47 23 72 53 65 32 2 7 28",
"output": "3"
},
{
"input": "99\n28 59 73 89 52 27 0 20 36 12 83 95 31 24 54 94 49 14 51 34 50 93 13 1 2 68 63 48 41 81 23 43 18 9 16 38 33 60 62 3 40 85 72 69 90 98 11 37 22 44 35 6 21 39 82 10 64 66 96 42 74 30 8 67 97 46 84 32 17 57 75 71 5 26 4 55 58 29 7 15 45 19 92 91 78 65 88 25 86 80 77 87 79 53 47 70 56 76 61",
"output": "63"
}
] | 1,655,400,227
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 56
| 93
| 1,740,800
|
import sys
input = sys.stdin.readline
n = int(input())
w = list(map(int, input().split()))
z = n
c = 0
x = 0
while True:
new_w = []
n = len(w)
for i in range(n):
if w[i] <= c:
c += 1
else:
new_w.append(w[i])
if c == z:
break
x += 1
w = new_w[::-1]
print(x)
|
Title: Robot's Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
Input Specification:
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
Output Specification:
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
Demo Input:
['3\n0 2 0\n', '5\n4 2 3 0 1\n', '7\n0 3 1 0 5 2 6\n']
Demo Output:
['1\n', '3\n', '2\n']
Note:
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7.
|
```python
import sys
input = sys.stdin.readline
n = int(input())
w = list(map(int, input().split()))
z = n
c = 0
x = 0
while True:
new_w = []
n = len(w)
for i in range(n):
if w[i] <= c:
c += 1
else:
new_w.append(w[i])
if c == z:
break
x += 1
w = new_w[::-1]
print(x)
```
| 3
|
|
255
|
A
|
Greg's Workout
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
|
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
|
[
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] |
[
"biceps\n",
"back\n",
"chest\n"
] |
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
| 500
|
[
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,568,705,109
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 61
| 248
| 0
|
n = int(input())
num = input()
a = []
def get_the_data(count, num, arr):
for i in range(0, len(num)):
if num[i] == ' ':
arr.append(int(num[count:i]))
count = i+1
elif i == len(num)-1:
arr.append(int(num[count:len(num)]))
return arr
arr = get_the_data(0, num, a)
chest = 0
bicep = 0
back = 0
for i in range(0,len(arr),3):
chest += arr[i]
if i+1 <= len(arr)-1:
bicep += arr[i+1]
if i+2 <= len(arr)-1:
back += arr[i+2]
if chest >back and chest > bicep:
print('chest')
elif bicep > chest and bicep > back:
print('biceps')
else:
print('back')
|
Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
|
```python
n = int(input())
num = input()
a = []
def get_the_data(count, num, arr):
for i in range(0, len(num)):
if num[i] == ' ':
arr.append(int(num[count:i]))
count = i+1
elif i == len(num)-1:
arr.append(int(num[count:len(num)]))
return arr
arr = get_the_data(0, num, a)
chest = 0
bicep = 0
back = 0
for i in range(0,len(arr),3):
chest += arr[i]
if i+1 <= len(arr)-1:
bicep += arr[i+1]
if i+2 <= len(arr)-1:
back += arr[i+2]
if chest >back and chest > bicep:
print('chest')
elif bicep > chest and bicep > back:
print('biceps')
else:
print('back')
```
| 3
|
|
918
|
A
|
Eleven
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
|
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
|
Print Eleven's new name on the first and only line of output.
|
[
"8\n",
"15\n"
] |
[
"OOOoOooO\n",
"OOOoOooOooooOoo\n"
] |
none
| 500
|
[
{
"input": "8",
"output": "OOOoOooO"
},
{
"input": "15",
"output": "OOOoOooOooooOoo"
},
{
"input": "85",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooo"
},
{
"input": "381",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooo"
},
{
"input": "805",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1000",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "1",
"output": "O"
},
{
"input": "2",
"output": "OO"
},
{
"input": "3",
"output": "OOO"
},
{
"input": "5",
"output": "OOOoO"
},
{
"input": "17",
"output": "OOOoOooOooooOoooo"
},
{
"input": "49",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooo"
},
{
"input": "256",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooo"
},
{
"input": "512",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "933",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "61",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooo"
},
{
"input": "781",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
},
{
"input": "999",
"output": "OOOoOooOooooOoooooooOooooooooooooOooooooooooooooooooooOoooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooOooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooOoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo..."
}
] | 1,656,568,398
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 18
| 93
| 512,000
|
fib=[1,1]
c=50
while c>0:
fib.append(fib[-1]+fib[-2])
c=c-1
#print(fib)
a=int(input())
d=''
for i in range(1,a+1):
if i in fib:
d+='O'
else:
d+='o'
print(d)
|
Title: Eleven
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Eleven wants to choose a new name for herself. As a bunch of geeks, her friends suggested an algorithm to choose a name for her. Eleven wants her name to have exactly *n* characters.
Her friend suggested that her name should only consist of uppercase and lowercase letters 'O'. More precisely, they suggested that the *i*-th letter of her name should be 'O' (uppercase) if *i* is a member of Fibonacci sequence, and 'o' (lowercase) otherwise. The letters in the name are numbered from 1 to *n*. Fibonacci sequence is the sequence *f* where
- *f*1<==<=1, - *f*2<==<=1, - *f**n*<==<=*f**n*<=-<=2<=+<=*f**n*<=-<=1 (*n*<=><=2).
As her friends are too young to know what Fibonacci sequence is, they asked you to help Eleven determine her new name.
Input Specification:
The first and only line of input contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
Print Eleven's new name on the first and only line of output.
Demo Input:
['8\n', '15\n']
Demo Output:
['OOOoOooO\n', 'OOOoOooOooooOoo\n']
Note:
none
|
```python
fib=[1,1]
c=50
while c>0:
fib.append(fib[-1]+fib[-2])
c=c-1
#print(fib)
a=int(input())
d=''
for i in range(1,a+1):
if i in fib:
d+='O'
else:
d+='o'
print(d)
```
| 3
|
|
292
|
B
|
Network Topology
|
PROGRAMMING
| 1,200
|
[
"graphs",
"implementation"
] | null | null |
This problem uses a simplified network topology model, please read the problem statement carefully and use it as a formal document as you develop the solution.
Polycarpus continues working as a system administrator in a large corporation. The computer network of this corporation consists of *n* computers, some of them are connected by a cable. The computers are indexed by integers from 1 to *n*. It's known that any two computers connected by cable directly or through other computers
Polycarpus decided to find out the network's topology. A network topology is the way of describing the network configuration, the scheme that shows the location and the connections of network devices.
Polycarpus knows three main network topologies: bus, ring and star. A bus is the topology that represents a shared cable with all computers connected with it. In the ring topology the cable connects each computer only with two other ones. A star is the topology where all computers of a network are connected to the single central node.
Let's represent each of these network topologies as a connected non-directed graph. A bus is a connected graph that is the only path, that is, the graph where all nodes are connected with two other ones except for some two nodes that are the beginning and the end of the path. A ring is a connected graph, where all nodes are connected with two other ones. A star is a connected graph, where a single central node is singled out and connected with all other nodes. For clarifications, see the picture.
You've got a connected non-directed graph that characterizes the computer network in Polycarpus' corporation. Help him find out, which topology type the given network is. If that is impossible to do, say that the network's topology is unknown.
|
The first line contains two space-separated integers *n* and *m* (4<=≤<=*n*<=≤<=105; 3<=≤<=*m*<=≤<=105) — the number of nodes and edges in the graph, correspondingly. Next *m* lines contain the description of the graph's edges. The *i*-th line contains a space-separated pair of integers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*) — the numbers of nodes that are connected by the *i*-the edge.
It is guaranteed that the given graph is connected. There is at most one edge between any two nodes. No edge connects a node with itself.
|
In a single line print the network topology name of the given graph. If the answer is the bus, print "bus topology" (without the quotes), if the answer is the ring, print "ring topology" (without the quotes), if the answer is the star, print "star topology" (without the quotes). If no answer fits, print "unknown topology" (without the quotes).
|
[
"4 3\n1 2\n2 3\n3 4\n",
"4 4\n1 2\n2 3\n3 4\n4 1\n",
"4 3\n1 2\n1 3\n1 4\n",
"4 4\n1 2\n2 3\n3 1\n1 4\n"
] |
[
"bus topology\n",
"ring topology\n",
"star topology\n",
"unknown topology\n"
] |
none
| 1,000
|
[
{
"input": "4 3\n1 2\n2 3\n3 4",
"output": "bus topology"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n4 1",
"output": "ring topology"
},
{
"input": "4 3\n1 2\n1 3\n1 4",
"output": "star topology"
},
{
"input": "4 4\n1 2\n2 3\n3 1\n1 4",
"output": "unknown topology"
},
{
"input": "5 4\n1 2\n3 5\n1 4\n5 4",
"output": "bus topology"
},
{
"input": "5 5\n3 4\n5 2\n2 1\n5 4\n3 1",
"output": "ring topology"
},
{
"input": "5 4\n4 2\n5 2\n1 2\n2 3",
"output": "star topology"
},
{
"input": "5 9\n5 3\n4 5\n3 1\n3 2\n2 1\n2 5\n1 5\n1 4\n4 2",
"output": "unknown topology"
},
{
"input": "4 3\n2 4\n1 3\n4 1",
"output": "bus topology"
},
{
"input": "4 4\n2 4\n4 1\n1 3\n2 3",
"output": "ring topology"
},
{
"input": "4 3\n1 2\n2 4\n3 2",
"output": "star topology"
},
{
"input": "4 4\n3 2\n2 4\n4 1\n1 2",
"output": "unknown topology"
},
{
"input": "10 9\n10 6\n3 4\n8 9\n8 4\n6 1\n2 9\n5 1\n7 5\n10 3",
"output": "bus topology"
},
{
"input": "10 10\n1 4\n3 6\n10 7\n5 8\n2 10\n3 4\n7 5\n9 6\n8 1\n2 9",
"output": "ring topology"
},
{
"input": "10 9\n1 4\n4 10\n4 9\n8 4\n4 7\n4 5\n4 2\n4 6\n4 3",
"output": "star topology"
},
{
"input": "10 14\n3 2\n7 2\n6 4\n8 1\n3 9\n5 6\n6 3\n4 1\n2 5\n7 10\n9 5\n7 1\n8 10\n3 4",
"output": "unknown topology"
},
{
"input": "4 4\n1 2\n2 3\n2 4\n3 4",
"output": "unknown topology"
},
{
"input": "5 4\n1 2\n1 3\n1 4\n4 5",
"output": "unknown topology"
},
{
"input": "10 9\n10 1\n10 2\n10 3\n10 4\n10 5\n10 6\n10 7\n10 8\n10 9",
"output": "star topology"
},
{
"input": "6 6\n1 2\n2 3\n3 1\n4 5\n5 6\n6 1",
"output": "unknown topology"
},
{
"input": "6 5\n1 2\n1 3\n1 4\n4 5\n4 6",
"output": "unknown topology"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n4 2",
"output": "unknown topology"
},
{
"input": "4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4",
"output": "unknown topology"
}
] | 1,557,772,754
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 154
| 307,200
|
mod = 1000000007
ii = lambda : int(input())
si = lambda : input()
dgl = lambda : list(map(int, input()))
f = lambda : map(int, input().split())
il = lambda : list(map(int, input().split()))
ls = lambda : list(input())
bt,rt,st=1,1,1
n,m=f()
l=[sorted(il()) for _ in range(m)]
l.sort()
for i in range(m-1):
if l[i][1]!=l[i+1][0]:
bt=0
if bt==1 and l[-1][1]!=l[0][0]:
rt=0
if bt==1 and l[-1][1]==l[0][0]:
bt=0
if bt==0:
rt=0
x=0
if l[0][0]==l[1][0] or l[0][0]==l[1][1]:
x=l[0][0]
else:
x=l[0][1]
if any(i[0]!=x and i[1]!=x for i in l):
st=0
if bt==1:
print('bus topology')
elif rt==1:
print('ring topology')
elif st==1:
print('star topology')
else:
print('unknown topology')
|
Title: Network Topology
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem uses a simplified network topology model, please read the problem statement carefully and use it as a formal document as you develop the solution.
Polycarpus continues working as a system administrator in a large corporation. The computer network of this corporation consists of *n* computers, some of them are connected by a cable. The computers are indexed by integers from 1 to *n*. It's known that any two computers connected by cable directly or through other computers
Polycarpus decided to find out the network's topology. A network topology is the way of describing the network configuration, the scheme that shows the location and the connections of network devices.
Polycarpus knows three main network topologies: bus, ring and star. A bus is the topology that represents a shared cable with all computers connected with it. In the ring topology the cable connects each computer only with two other ones. A star is the topology where all computers of a network are connected to the single central node.
Let's represent each of these network topologies as a connected non-directed graph. A bus is a connected graph that is the only path, that is, the graph where all nodes are connected with two other ones except for some two nodes that are the beginning and the end of the path. A ring is a connected graph, where all nodes are connected with two other ones. A star is a connected graph, where a single central node is singled out and connected with all other nodes. For clarifications, see the picture.
You've got a connected non-directed graph that characterizes the computer network in Polycarpus' corporation. Help him find out, which topology type the given network is. If that is impossible to do, say that the network's topology is unknown.
Input Specification:
The first line contains two space-separated integers *n* and *m* (4<=≤<=*n*<=≤<=105; 3<=≤<=*m*<=≤<=105) — the number of nodes and edges in the graph, correspondingly. Next *m* lines contain the description of the graph's edges. The *i*-th line contains a space-separated pair of integers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*) — the numbers of nodes that are connected by the *i*-the edge.
It is guaranteed that the given graph is connected. There is at most one edge between any two nodes. No edge connects a node with itself.
Output Specification:
In a single line print the network topology name of the given graph. If the answer is the bus, print "bus topology" (without the quotes), if the answer is the ring, print "ring topology" (without the quotes), if the answer is the star, print "star topology" (without the quotes). If no answer fits, print "unknown topology" (without the quotes).
Demo Input:
['4 3\n1 2\n2 3\n3 4\n', '4 4\n1 2\n2 3\n3 4\n4 1\n', '4 3\n1 2\n1 3\n1 4\n', '4 4\n1 2\n2 3\n3 1\n1 4\n']
Demo Output:
['bus topology\n', 'ring topology\n', 'star topology\n', 'unknown topology\n']
Note:
none
|
```python
mod = 1000000007
ii = lambda : int(input())
si = lambda : input()
dgl = lambda : list(map(int, input()))
f = lambda : map(int, input().split())
il = lambda : list(map(int, input().split()))
ls = lambda : list(input())
bt,rt,st=1,1,1
n,m=f()
l=[sorted(il()) for _ in range(m)]
l.sort()
for i in range(m-1):
if l[i][1]!=l[i+1][0]:
bt=0
if bt==1 and l[-1][1]!=l[0][0]:
rt=0
if bt==1 and l[-1][1]==l[0][0]:
bt=0
if bt==0:
rt=0
x=0
if l[0][0]==l[1][0] or l[0][0]==l[1][1]:
x=l[0][0]
else:
x=l[0][1]
if any(i[0]!=x and i[1]!=x for i in l):
st=0
if bt==1:
print('bus topology')
elif rt==1:
print('ring topology')
elif st==1:
print('star topology')
else:
print('unknown topology')
```
| 0
|
|
545
|
C
|
Woodcutters
|
PROGRAMMING
| 1,500
|
[
"dp",
"greedy"
] | null | null |
Little Susie listens to fairy tales before bed every day. Today's fairy tale was about wood cutters and the little girl immediately started imagining the choppers cutting wood. She imagined the situation that is described below.
There are *n* trees located along the road at points with coordinates *x*1,<=*x*2,<=...,<=*x**n*. Each tree has its height *h**i*. Woodcutters can cut down a tree and fell it to the left or to the right. After that it occupies one of the segments [*x**i*<=-<=*h**i*,<=*x**i*] or [*x**i*;*x**i*<=+<=*h**i*]. The tree that is not cut down occupies a single point with coordinate *x**i*. Woodcutters can fell a tree if the segment to be occupied by the fallen tree doesn't contain any occupied point. The woodcutters want to process as many trees as possible, so Susie wonders, what is the maximum number of trees to fell.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of trees.
Next *n* lines contain pairs of integers *x**i*,<=*h**i* (1<=≤<=*x**i*,<=*h**i*<=≤<=109) — the coordinate and the height of the *і*-th tree.
The pairs are given in the order of ascending *x**i*. No two trees are located at the point with the same coordinate.
|
Print a single number — the maximum number of trees that you can cut down by the given rules.
|
[
"5\n1 2\n2 1\n5 10\n10 9\n19 1\n",
"5\n1 2\n2 1\n5 10\n10 9\n20 1\n"
] |
[
"3\n",
"4\n"
] |
In the first sample you can fell the trees like that:
- fell the 1-st tree to the left — now it occupies segment [ - 1;1] - fell the 2-nd tree to the right — now it occupies segment [2;3] - leave the 3-rd tree — it occupies point 5 - leave the 4-th tree — it occupies point 10 - fell the 5-th tree to the right — now it occupies segment [19;20]
In the second sample you can also fell 4-th tree to the right, after that it will occupy segment [10;19].
| 1,750
|
[
{
"input": "5\n1 2\n2 1\n5 10\n10 9\n19 1",
"output": "3"
},
{
"input": "5\n1 2\n2 1\n5 10\n10 9\n20 1",
"output": "4"
},
{
"input": "4\n10 4\n15 1\n19 3\n20 1",
"output": "4"
},
{
"input": "35\n1 7\n3 11\n6 12\n7 6\n8 5\n9 11\n15 3\n16 10\n22 2\n23 3\n25 7\n27 3\n34 5\n35 10\n37 3\n39 4\n40 5\n41 1\n44 1\n47 7\n48 11\n50 6\n52 5\n57 2\n58 7\n60 4\n62 1\n67 3\n68 12\n69 8\n70 1\n71 5\n72 5\n73 6\n74 4",
"output": "10"
},
{
"input": "40\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n8 1\n9 1\n10 1\n11 1\n12 1\n13 1\n14 1\n15 1\n16 1\n17 1\n18 1\n19 1\n20 1\n21 1\n22 1\n23 1\n24 1\n25 1\n26 1\n27 1\n28 1\n29 1\n30 1\n31 1\n32 1\n33 1\n34 1\n35 1\n36 1\n37 1\n38 1\n39 1\n40 1",
"output": "2"
},
{
"input": "67\n1 1\n3 8\n4 10\n7 8\n9 2\n10 1\n11 5\n12 8\n13 4\n16 6\n18 3\n19 3\n22 5\n24 6\n27 5\n28 3\n29 3\n30 5\n32 5\n33 10\n34 7\n35 8\n36 5\n41 3\n42 2\n43 5\n46 4\n48 4\n49 9\n52 4\n53 9\n55 1\n56 4\n59 7\n68 7\n69 4\n71 9\n72 10\n74 5\n76 4\n77 9\n80 7\n81 9\n82 5\n83 5\n84 9\n85 7\n86 9\n87 4\n88 7\n89 10\n90 3\n91 5\n92 10\n93 5\n94 8\n95 4\n96 2\n97 10\n98 1\n99 3\n100 1\n101 5\n102 4\n103 8\n104 8\n105 8",
"output": "5"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "10\n7 12\n10 2\n12 2\n15 1\n19 2\n20 1\n53 25\n63 10\n75 12\n87 1",
"output": "9"
},
{
"input": "3\n1 1\n1000 1000\n1000000000 1000000000",
"output": "3"
},
{
"input": "2\n1 999999999\n1000000000 1000000000",
"output": "2"
},
{
"input": "10\n999999900 1000000000\n999999901 1000000000\n999999902 1000000000\n999999903 1000000000\n999999904 1000000000\n999999905 1000000000\n999999906 1000000000\n999999907 1000000000\n999999908 1000000000\n999999909 1000000000",
"output": "2"
},
{
"input": "2\n100000000 1000000000\n1000000000 1000000000",
"output": "2"
}
] | 1,666,850,100
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 8
| 436
| 10,137,600
|
# LUOGU_RID: 91726065
n=int(input())
x=[0];h=[0];f=[[0,0,0]]#f[i][0]: 到第 i 棵树不倒最多;[i][1]:到第 i 棵树向左倒最多;f[i][2]:到第 i 棵树向右倒最多
for i in range(n):
x.append(0),h.append(0)
x[i+1],h[i+1]=input().split()
x[i+1]=int(x[i+1]);h[i+1]=int(h[i+1])
f.append([0,1,-1])
if x[2]-x[1]>h[1]:f[1][2]=1
for i in range(2,n):
f.append([-1,-1,-1])
f[i][0]=max(f[i-1][0],f[i-1][1],f[i-1][2])
if x[i]-x[i-1]>h[i]:
f[i][1]=max(f[i-1][0],f[i-1][1])+1
if ~f[i-1][2] and x[i]-x[i-1]>h[i]+h[i-1]:
f[i][1]=max(f[i][1],f[i-1][2]+1)
if x[i+1]-x[i]>h[i]:
f[i][2]=max(f[i-1][0],f[i-1][1],f[i-1][2])+1
print(max(f[n-1][0],f[n-1][1],f[n-1][2])+1)
|
Title: Woodcutters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Susie listens to fairy tales before bed every day. Today's fairy tale was about wood cutters and the little girl immediately started imagining the choppers cutting wood. She imagined the situation that is described below.
There are *n* trees located along the road at points with coordinates *x*1,<=*x*2,<=...,<=*x**n*. Each tree has its height *h**i*. Woodcutters can cut down a tree and fell it to the left or to the right. After that it occupies one of the segments [*x**i*<=-<=*h**i*,<=*x**i*] or [*x**i*;*x**i*<=+<=*h**i*]. The tree that is not cut down occupies a single point with coordinate *x**i*. Woodcutters can fell a tree if the segment to be occupied by the fallen tree doesn't contain any occupied point. The woodcutters want to process as many trees as possible, so Susie wonders, what is the maximum number of trees to fell.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of trees.
Next *n* lines contain pairs of integers *x**i*,<=*h**i* (1<=≤<=*x**i*,<=*h**i*<=≤<=109) — the coordinate and the height of the *і*-th tree.
The pairs are given in the order of ascending *x**i*. No two trees are located at the point with the same coordinate.
Output Specification:
Print a single number — the maximum number of trees that you can cut down by the given rules.
Demo Input:
['5\n1 2\n2 1\n5 10\n10 9\n19 1\n', '5\n1 2\n2 1\n5 10\n10 9\n20 1\n']
Demo Output:
['3\n', '4\n']
Note:
In the first sample you can fell the trees like that:
- fell the 1-st tree to the left — now it occupies segment [ - 1;1] - fell the 2-nd tree to the right — now it occupies segment [2;3] - leave the 3-rd tree — it occupies point 5 - leave the 4-th tree — it occupies point 10 - fell the 5-th tree to the right — now it occupies segment [19;20]
In the second sample you can also fell 4-th tree to the right, after that it will occupy segment [10;19].
|
```python
# LUOGU_RID: 91726065
n=int(input())
x=[0];h=[0];f=[[0,0,0]]#f[i][0]: 到第 i 棵树不倒最多;[i][1]:到第 i 棵树向左倒最多;f[i][2]:到第 i 棵树向右倒最多
for i in range(n):
x.append(0),h.append(0)
x[i+1],h[i+1]=input().split()
x[i+1]=int(x[i+1]);h[i+1]=int(h[i+1])
f.append([0,1,-1])
if x[2]-x[1]>h[1]:f[1][2]=1
for i in range(2,n):
f.append([-1,-1,-1])
f[i][0]=max(f[i-1][0],f[i-1][1],f[i-1][2])
if x[i]-x[i-1]>h[i]:
f[i][1]=max(f[i-1][0],f[i-1][1])+1
if ~f[i-1][2] and x[i]-x[i-1]>h[i]+h[i-1]:
f[i][1]=max(f[i][1],f[i-1][2]+1)
if x[i+1]-x[i]>h[i]:
f[i][2]=max(f[i-1][0],f[i-1][1],f[i-1][2])+1
print(max(f[n-1][0],f[n-1][1],f[n-1][2])+1)
```
| -1
|
|
877
|
A
|
Alex and broken contest
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
|
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
|
Print "YES", if problem is from this contest, and "NO" otherwise.
|
[
"Alex_and_broken_contest\n",
"NikitaAndString\n",
"Danil_and_Olya\n"
] |
[
"NO",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "Alex_and_broken_contest",
"output": "NO"
},
{
"input": "NikitaAndString",
"output": "YES"
},
{
"input": "Danil_and_Olya",
"output": "NO"
},
{
"input": "Slava____and_the_game",
"output": "YES"
},
{
"input": "Olya_and_energy_drinks",
"output": "YES"
},
{
"input": "Danil_and_part_time_job",
"output": "YES"
},
{
"input": "Ann_and_books",
"output": "YES"
},
{
"input": "Olya",
"output": "YES"
},
{
"input": "Nikita",
"output": "YES"
},
{
"input": "Slava",
"output": "YES"
},
{
"input": "Vanya",
"output": "NO"
},
{
"input": "I_dont_know_what_to_write_here",
"output": "NO"
},
{
"input": "danil_and_work",
"output": "NO"
},
{
"input": "Ann",
"output": "YES"
},
{
"input": "Batman_Nananananananan_Batman",
"output": "NO"
},
{
"input": "Olya_Nikita_Ann_Slava_Danil",
"output": "NO"
},
{
"input": "its_me_Mario",
"output": "NO"
},
{
"input": "A",
"output": "NO"
},
{
"input": "Wake_up_Neo",
"output": "NO"
},
{
"input": "Hardest_problem_ever",
"output": "NO"
},
{
"input": "Nikita_Nikita",
"output": "NO"
},
{
"input": "____________________________________________________________________________________________________",
"output": "NO"
},
{
"input": "Nikitb",
"output": "NO"
},
{
"input": "Unn",
"output": "NO"
},
{
"input": "oLya_adn_smth",
"output": "NO"
},
{
"input": "FloorISLava",
"output": "NO"
},
{
"input": "ann",
"output": "NO"
},
{
"input": "aa",
"output": "NO"
},
{
"input": "AAnnnnn",
"output": "YES"
},
{
"input": "AnnAnn",
"output": "NO"
},
{
"input": "Annn",
"output": "YES"
},
{
"input": "Dilzhan",
"output": "NO"
},
{
"input": "Danilaaa",
"output": "YES"
},
{
"input": "AndAnn",
"output": "YES"
},
{
"input": "OlyaAnnAnn",
"output": "NO"
},
{
"input": "DanilDanilOlya",
"output": "NO"
},
{
"input": "DDanil",
"output": "YES"
},
{
"input": "AnnAnnDanil",
"output": "NO"
},
{
"input": "And_Danil",
"output": "YES"
},
{
"input": "abcddddDanil",
"output": "YES"
},
{
"input": "DanilOlyaOlya",
"output": "NO"
},
{
"input": "Nikitaaa",
"output": "YES"
},
{
"input": "aaabbba",
"output": "NO"
},
{
"input": "Ann_Ann_Danil",
"output": "NO"
},
{
"input": "Danil_Danil_Nikita",
"output": "NO"
},
{
"input": "AlexaaaaaaBBBBBOlyaDDDDD",
"output": "YES"
},
{
"input": "IloveDaniland",
"output": "YES"
},
{
"input": "AnAnn",
"output": "YES"
},
{
"input": "Danil_Danil_Olya",
"output": "NO"
},
{
"input": "DanilDanilSlava",
"output": "NO"
},
{
"input": "DanilDanil",
"output": "NO"
},
{
"input": "OlyOlya",
"output": "YES"
},
{
"input": "NikitaNikitb",
"output": "YES"
},
{
"input": "ababaca",
"output": "NO"
},
{
"input": "AnnNikitaNikitaNikitaNikita__good_luck",
"output": "NO"
}
] | 1,693,643,604
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 20
| 46
| 0
|
a=["Danil", "Olya", "Slava", "Ann","Nikita"]
n=input()
c=0
for i in a:
if i in n:c+=1
if(c==1):print("YES")
else:print("NO")
|
Title: Alex and broken contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
Input Specification:
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
Output Specification:
Print "YES", if problem is from this contest, and "NO" otherwise.
Demo Input:
['Alex_and_broken_contest\n', 'NikitaAndString\n', 'Danil_and_Olya\n']
Demo Output:
['NO', 'YES', 'NO']
Note:
none
|
```python
a=["Danil", "Olya", "Slava", "Ann","Nikita"]
n=input()
c=0
for i in a:
if i in n:c+=1
if(c==1):print("YES")
else:print("NO")
```
| 0
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,670,427,883
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
word=input()
low=0
high=0
for i in word:
if ord(i)>90:
low+=1
else:
high+=1
if high>low:
print(word.upper())
else:
print(word.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
word=input()
low=0
high=0
for i in word:
if ord(i)>90:
low+=1
else:
high+=1
if high>low:
print(word.upper())
else:
print(word.lower())
```
| 3.977
|
606
|
A
|
Magic Spheres
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)?
|
The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get.
|
If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No".
|
[
"4 4 0\n2 1 2\n",
"5 6 1\n2 7 2\n",
"3 3 3\n2 2 2\n"
] |
[
"Yes\n",
"No\n",
"Yes\n"
] |
In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs.
| 500
|
[
{
"input": "4 4 0\n2 1 2",
"output": "Yes"
},
{
"input": "5 6 1\n2 7 2",
"output": "No"
},
{
"input": "3 3 3\n2 2 2",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 0",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 1",
"output": "No"
},
{
"input": "0 1 0\n0 0 0",
"output": "Yes"
},
{
"input": "1 0 0\n1 0 0",
"output": "Yes"
},
{
"input": "2 2 1\n1 1 2",
"output": "No"
},
{
"input": "1 3 1\n2 1 1",
"output": "Yes"
},
{
"input": "1000000 1000000 1000000\n1000000 1000000 1000000",
"output": "Yes"
},
{
"input": "1000000 500000 500000\n0 750000 750000",
"output": "Yes"
},
{
"input": "500000 1000000 500000\n750001 0 750000",
"output": "No"
},
{
"input": "499999 500000 1000000\n750000 750000 0",
"output": "No"
},
{
"input": "500000 500000 0\n0 0 500000",
"output": "Yes"
},
{
"input": "0 500001 499999\n500000 0 0",
"output": "No"
},
{
"input": "1000000 500000 1000000\n500000 1000000 500000",
"output": "Yes"
},
{
"input": "1000000 1000000 499999\n500000 500000 1000000",
"output": "No"
},
{
"input": "500000 1000000 1000000\n1000000 500001 500000",
"output": "No"
},
{
"input": "1000000 500000 500000\n0 1000000 500000",
"output": "Yes"
},
{
"input": "500000 500000 1000000\n500001 1000000 0",
"output": "No"
},
{
"input": "500000 999999 500000\n1000000 0 500000",
"output": "No"
},
{
"input": "4 0 3\n2 2 1",
"output": "Yes"
},
{
"input": "0 2 4\n2 0 2",
"output": "Yes"
},
{
"input": "3 1 0\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 1\n1 3 2",
"output": "Yes"
},
{
"input": "1 2 4\n2 1 3",
"output": "No"
},
{
"input": "1 1 0\n0 0 1",
"output": "No"
},
{
"input": "4 0 0\n0 1 1",
"output": "Yes"
},
{
"input": "0 3 0\n1 0 1",
"output": "No"
},
{
"input": "0 0 3\n1 0 1",
"output": "Yes"
},
{
"input": "1 12 1\n4 0 4",
"output": "Yes"
},
{
"input": "4 0 4\n1 2 1",
"output": "Yes"
},
{
"input": "4 4 0\n1 1 3",
"output": "No"
},
{
"input": "0 9 0\n2 2 2",
"output": "No"
},
{
"input": "0 10 0\n2 2 2",
"output": "Yes"
},
{
"input": "9 0 9\n0 8 0",
"output": "Yes"
},
{
"input": "0 9 9\n9 0 0",
"output": "No"
},
{
"input": "9 10 0\n0 0 9",
"output": "Yes"
},
{
"input": "10 0 9\n0 10 0",
"output": "No"
},
{
"input": "0 10 10\n10 0 0",
"output": "Yes"
},
{
"input": "10 10 0\n0 0 11",
"output": "No"
},
{
"input": "307075 152060 414033\n381653 222949 123101",
"output": "No"
},
{
"input": "569950 228830 153718\n162186 357079 229352",
"output": "No"
},
{
"input": "149416 303568 749016\n238307 493997 190377",
"output": "No"
},
{
"input": "438332 298094 225324\n194220 400244 245231",
"output": "No"
},
{
"input": "293792 300060 511272\n400687 382150 133304",
"output": "No"
},
{
"input": "295449 518151 368838\n382897 137148 471892",
"output": "No"
},
{
"input": "191789 291147 691092\n324321 416045 176232",
"output": "Yes"
},
{
"input": "286845 704749 266526\n392296 104421 461239",
"output": "Yes"
},
{
"input": "135522 188282 377041\n245719 212473 108265",
"output": "Yes"
},
{
"input": "404239 359124 133292\n180069 184791 332544",
"output": "No"
},
{
"input": "191906 624432 244408\n340002 367217 205432",
"output": "No"
},
{
"input": "275980 429361 101824\n274288 302579 166062",
"output": "No"
},
{
"input": "136092 364927 395302\n149173 343146 390922",
"output": "No"
},
{
"input": "613852 334661 146012\n363786 326286 275233",
"output": "No"
},
{
"input": "348369 104625 525203\n285621 215396 366411",
"output": "No"
},
{
"input": "225307 153572 114545\n154753 153282 149967",
"output": "Yes"
},
{
"input": "438576 124465 629784\n375118 276028 390116",
"output": "Yes"
},
{
"input": "447521 327510 158732\n395759 178458 259139",
"output": "Yes"
},
{
"input": "8 5 5\n5 5 5",
"output": "Yes"
},
{
"input": "100 100 100\n1 1 1",
"output": "Yes"
},
{
"input": "100 100 100\n0 0 0",
"output": "Yes"
},
{
"input": "3 2 3\n2 3 2",
"output": "No"
},
{
"input": "5 4 3\n2 2 2",
"output": "Yes"
},
{
"input": "14 9 8\n12 5 10",
"output": "Yes"
},
{
"input": "10 10 10\n1 1 1",
"output": "Yes"
},
{
"input": "6 3 3\n3 3 3",
"output": "Yes"
},
{
"input": "10 0 4\n2 4 2",
"output": "Yes"
},
{
"input": "100 100 100\n2 2 2",
"output": "Yes"
},
{
"input": "4 6 0\n2 1 2",
"output": "Yes"
},
{
"input": "4 6 3\n4 2 3",
"output": "Yes"
},
{
"input": "5 5 5\n1 1 1",
"output": "Yes"
},
{
"input": "41 17 34\n0 19 24",
"output": "Yes"
},
{
"input": "8 8 8\n3 3 3",
"output": "Yes"
},
{
"input": "7 7 1\n1 1 2",
"output": "Yes"
},
{
"input": "6 6 0\n2 2 2",
"output": "Yes"
},
{
"input": "5 5 5\n2 2 2",
"output": "Yes"
},
{
"input": "400 400 400\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 4\n2 2 2",
"output": "Yes"
}
] | 1,484,677,292
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 10
| 62
| 5,324,800
|
#Justin Hershberger
#Py3.5
import fileinput
def test():
pass
if __name__ == '__main__':
num_args = 2
for arg in range(num_args):
if arg == 0:
a,b,c = map(int, input().split())
else:
x,y,z = map(int, input().split())
# sum1 = a + b + c
# sum2 = x + y + z
#
# sum3 = (a - x) + (b - y) + (c - z)
if x <= a and y <= b and z <= c:
print("Yes")
elif (x > a and y > b) or (x > a and z > c) or (y > b and z > c):
sum1 = (x - a) + (y - b) + (z - c)
if sum1 < 0:
print("No")
elif (x - a > 0) and (((b-y) // 2 + (c-z) // 2) >= (x-a)):
print("Yes")
elif (y - b > 0) and (((a-x) // 2 + (c-z) // 2) >= (y-b)):
print("Yes")
elif (z - c > 0) and (((b-y) // 2 + (a-x) // 2) >= (z - c)):
print("Yes")
else:
print("No")
# if x <= a and y <= b and z <= c:
# print("Yes")
# elif (sum3 < 0):
# print("No")
# else:
# print("Yes")
|
Title: Magic Spheres
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)?
Input Specification:
The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get.
Output Specification:
If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No".
Demo Input:
['4 4 0\n2 1 2\n', '5 6 1\n2 7 2\n', '3 3 3\n2 2 2\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n']
Note:
In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs.
|
```python
#Justin Hershberger
#Py3.5
import fileinput
def test():
pass
if __name__ == '__main__':
num_args = 2
for arg in range(num_args):
if arg == 0:
a,b,c = map(int, input().split())
else:
x,y,z = map(int, input().split())
# sum1 = a + b + c
# sum2 = x + y + z
#
# sum3 = (a - x) + (b - y) + (c - z)
if x <= a and y <= b and z <= c:
print("Yes")
elif (x > a and y > b) or (x > a and z > c) or (y > b and z > c):
sum1 = (x - a) + (y - b) + (z - c)
if sum1 < 0:
print("No")
elif (x - a > 0) and (((b-y) // 2 + (c-z) // 2) >= (x-a)):
print("Yes")
elif (y - b > 0) and (((a-x) // 2 + (c-z) // 2) >= (y-b)):
print("Yes")
elif (z - c > 0) and (((b-y) // 2 + (a-x) // 2) >= (z - c)):
print("Yes")
else:
print("No")
# if x <= a and y <= b and z <= c:
# print("Yes")
# elif (sum3 < 0):
# print("No")
# else:
# print("Yes")
```
| 0
|
|
287
|
A
|
IQ Test
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
In the city of Ultima Thule job applicants are often offered an IQ test.
The test is as follows: the person gets a piece of squared paper with a 4<=×<=4 square painted on it. Some of the square's cells are painted black and others are painted white. Your task is to repaint at most one cell the other color so that the picture has a 2<=×<=2 square, completely consisting of cells of the same color. If the initial picture already has such a square, the person should just say so and the test will be completed.
Your task is to write a program that determines whether it is possible to pass the test. You cannot pass the test if either repainting any cell or no action doesn't result in a 2<=×<=2 square, consisting of cells of the same color.
|
Four lines contain four characters each: the *j*-th character of the *i*-th line equals "." if the cell in the *i*-th row and the *j*-th column of the square is painted white, and "#", if the cell is black.
|
Print "YES" (without the quotes), if the test can be passed and "NO" (without the quotes) otherwise.
|
[
"####\n.#..\n####\n....\n",
"####\n....\n####\n....\n"
] |
[
"YES\n",
"NO\n"
] |
In the first test sample it is enough to repaint the first cell in the second row. After such repainting the required 2 × 2 square is on the intersection of the 1-st and 2-nd row with the 1-st and 2-nd column.
| 500
|
[
{
"input": "###.\n...#\n###.\n...#",
"output": "NO"
},
{
"input": ".##.\n#..#\n.##.\n#..#",
"output": "NO"
},
{
"input": ".#.#\n#.#.\n.#.#\n#.#.",
"output": "NO"
},
{
"input": "##..\n..##\n##..\n..##",
"output": "NO"
},
{
"input": "#.#.\n#.#.\n.#.#\n.#.#",
"output": "NO"
},
{
"input": ".#.#\n#.#.\n#.#.\n#.#.",
"output": "NO"
},
{
"input": ".#.#\n#.#.\n#.#.\n.#.#",
"output": "NO"
},
{
"input": "#.#.\n#.#.\n#.#.\n#.#.",
"output": "NO"
},
{
"input": ".#.#\n.#.#\n.#.#\n.#.#",
"output": "NO"
},
{
"input": "#..#\n.##.\n####\n####",
"output": "YES"
},
{
"input": "#.#.\n.###\n#.#.\n.###",
"output": "YES"
},
{
"input": "#..#\n.##.\n.##.\n#..#",
"output": "YES"
},
{
"input": ".##.\n.#..\n##.#\n#..#",
"output": "YES"
},
{
"input": ".##.\n##..\n#..#\n..##",
"output": "YES"
},
{
"input": "##..\n##..\n..##\n..##",
"output": "YES"
},
{
"input": ".#..\n###.\n.#.#\n..#.",
"output": "YES"
},
{
"input": "###.\n###.\n...#\n...#",
"output": "YES"
},
{
"input": "#.##\n##.#\n#.##\n##.#",
"output": "YES"
},
{
"input": ".#.#\n#.#.\n.#.#\n#.##",
"output": "YES"
},
{
"input": "##..\n..##\n##..\n...#",
"output": "YES"
},
{
"input": ".#..\n..##\n##..\n..##",
"output": "YES"
},
{
"input": "##..\n...#\n##..\n...#",
"output": "YES"
},
{
"input": ".#..\n..#.\n.#..\n..#.",
"output": "YES"
},
{
"input": "....\n....\n....\n.#.#",
"output": "YES"
},
{
"input": "....\n....\n....\n...#",
"output": "YES"
}
] | 1,679,590,136
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 61
| 0
|
square = []
possible = False
for _ in range(0,4):
inp = input()
inp =inp.replace('.','1')
inp =inp.replace('#','0')
square.append( list(map(lambda x:int(inp[x]),range(0,4))))
for a in range(0,3):
if possible :
break
for b in range(0,3):
if square[a][b]+square[a+1][b]+square[a][b+1]+square[a+1][b+1] != 2:
possible =True
break
print("YES") if possible else print("NO")
|
Title: IQ Test
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the city of Ultima Thule job applicants are often offered an IQ test.
The test is as follows: the person gets a piece of squared paper with a 4<=×<=4 square painted on it. Some of the square's cells are painted black and others are painted white. Your task is to repaint at most one cell the other color so that the picture has a 2<=×<=2 square, completely consisting of cells of the same color. If the initial picture already has such a square, the person should just say so and the test will be completed.
Your task is to write a program that determines whether it is possible to pass the test. You cannot pass the test if either repainting any cell or no action doesn't result in a 2<=×<=2 square, consisting of cells of the same color.
Input Specification:
Four lines contain four characters each: the *j*-th character of the *i*-th line equals "." if the cell in the *i*-th row and the *j*-th column of the square is painted white, and "#", if the cell is black.
Output Specification:
Print "YES" (without the quotes), if the test can be passed and "NO" (without the quotes) otherwise.
Demo Input:
['####\n.#..\n####\n....\n', '####\n....\n####\n....\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first test sample it is enough to repaint the first cell in the second row. After such repainting the required 2 × 2 square is on the intersection of the 1-st and 2-nd row with the 1-st and 2-nd column.
|
```python
square = []
possible = False
for _ in range(0,4):
inp = input()
inp =inp.replace('.','1')
inp =inp.replace('#','0')
square.append( list(map(lambda x:int(inp[x]),range(0,4))))
for a in range(0,3):
if possible :
break
for b in range(0,3):
if square[a][b]+square[a+1][b]+square[a][b+1]+square[a+1][b+1] != 2:
possible =True
break
print("YES") if possible else print("NO")
```
| 3
|
|
437
|
A
|
The Child and Homework
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct.
Fortunately the child knows how to solve such complicated test. The child will follow the algorithm:
- If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice).
You are given a multiple-choice questions, can you predict child's choose?
|
The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length.
Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_".
|
Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes).
|
[
"A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n",
"A.ab\nB.abcde\nC.ab\nD.abc\n",
"A.c\nB.cc\nC.c\nD.c\n"
] |
[
"D\n",
"C\n",
"B\n"
] |
In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D.
In the second sample, no choice is great, so the child will choose the luckiest choice C.
In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
| 500
|
[
{
"input": "A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute",
"output": "D"
},
{
"input": "A.ab\nB.abcde\nC.ab\nD.abc",
"output": "C"
},
{
"input": "A.c\nB.cc\nC.c\nD.c",
"output": "B"
},
{
"input": "A.He_nan_de_yang_guang_zhao_yao_zhe_wo_men_mei_guo_ren_lian_shang_dou_xiao_kai_yan_wahaaaaaaaaaaaaaaaa\nB.Li_bai_li_bai_fei_liu_zhi_xia_san_qian_chi_yi_si_yin_he_luo_jiu_tian_li_bai_li_bai_li_bai_li_bai_shi\nC.Peng_yu_xiang_shi_zai_tai_shen_le_jian_zhi_jiu_shi_ye_jie_du_liu_a_si_mi_da_zhen_shi_tai_shen_le_a_a\nD.Wo_huo_le_si_shi_er_nian_zhen_de_shi_cong_lai_ye_mei_you_jian_guo_zhe_me_biao_zhun_de_yi_bai_ge_zi_a",
"output": "C"
},
{
"input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____",
"output": "C"
},
{
"input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_",
"output": "D"
},
{
"input": "A.a___FXIcs_gB____dxFFzst_p_P_Xp_vS__cS_C_ei_\nB.fmnmkS_SeZYx_tSys_d__Exbojv_a_YPEL_BPj__I_aYH\nC._nrPx_j\nD.o_A_UwmNbC_sZ_AXk_Y___i_SN_U_UxrBN_qo_____",
"output": "C"
},
{
"input": "A.G_R__iT_ow_Y__Sm_al__u_____l_ltK\nB.CWRe__h__cbCF\nC._QJ_dVHCL_g_WBsMO__LC____hMNE_DoO__xea_ec\nD.___Zh_",
"output": "D"
},
{
"input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h",
"output": "A"
},
{
"input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_",
"output": "C"
},
{
"input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg",
"output": "B"
},
{
"input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___",
"output": "D"
},
{
"input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS",
"output": "C"
},
{
"input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_",
"output": "C"
},
{
"input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi",
"output": "C"
},
{
"input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__",
"output": "C"
},
{
"input": "A.ejQ_E_E_G_e_SDjZ__lh_f_K__Z_i_B_U__S__S_EMD_ZEU_Sq\nB.o_JpInEdsrAY_T__D_S\nC.E_Vp_s\nD.a_AU_h",
"output": "A"
},
{
"input": "A.PN_m_P_qgOAMwDyxtbH__Yc__bPOh_wYH___n_Fv_qlZp_\nB._gLeDU__rr_vjrm__O_jl_R__DG___u_XqJjW_\nC.___sHLQzdTzT_tZ_Gs\nD.sZNcVa__M_To_bz_clFi_mH_",
"output": "C"
},
{
"input": "A.bR___cCYJg_Wbt____cxfXfC____c_O_\nB.guM\nC.__bzsH_Of__RjG__u_w_i__PXQL_U_Ow_U_n\nD._nHIuZsu_uU_stRC_k___vD_ZOD_u_z_c_Zf__p_iF_uD_Hdg",
"output": "B"
},
{
"input": "A.x_\nB.__RSiDT_\nC.Ci\nD.KLY_Hc_YN_xXg_DynydumheKTw_PFHo_vqXwm_DY_dA___OS_kG___",
"output": "D"
},
{
"input": "A.yYGJ_C__NYq_\nB.ozMUZ_cKKk_zVUPR_b_g_ygv_HoM__yAxvh__iE\nC.sgHJ___MYP__AWejchRvjSD_o\nD.gkfF_GiOqW_psMT_eS",
"output": "C"
},
{
"input": "A._LYm_nvl_E__RCFZ_IdO\nB.k__qIPO_ivvZyIG__L_\nC.D_SabLm_R___j_HS_t__\nD._adj_R_ngix____GSe_aw__SbOOl_",
"output": "C"
},
{
"input": "A.h_WiYTD_C_h___z_Gn_Th_uNh__g___jm\nB.__HeQaudCJcYfVi__Eg_vryuQrDkb_g__oy_BwX_Mu_\nC._MChdMhQA_UKrf_LGZk_ALTo_mnry_GNNza_X_D_u____ueJb__Y_h__CNUNDfmZATck_ad_XTbG\nD.NV___OoL__GfP_CqhD__RB_____v_T_xi",
"output": "C"
},
{
"input": "A.____JGWsfiU\nB.S_LMq__MpE_oFBs_P\nC.U_Rph_VHpUr____X_jWXbk__ElJTu_Z_wlBpKLTD\nD.p_ysvPNmbrF__",
"output": "C"
},
{
"input": "A.aaaaaa\nB.aaa\nC.aaa\nD.aaa",
"output": "A"
},
{
"input": "A.aaa\nB.aaaaaa\nC.aaaaaa\nD.aaaaaa",
"output": "A"
},
{
"input": "A.a\nB.b\nC.c\nD.d",
"output": "C"
},
{
"input": "A._\nB.__\nC.____\nD.________",
"output": "C"
},
{
"input": "A.____\nB.________\nC.________\nD._______",
"output": "C"
},
{
"input": "A.h\nB.asdf\nC.asqw\nD.qwertasdfg",
"output": "C"
},
{
"input": "A.aa\nB.aaaaa\nC.aaaaaa\nD.aaaaaaaaaaaaa",
"output": "C"
},
{
"input": "A.ccc\nB.ccccccc\nC.ccc\nD.c",
"output": "C"
},
{
"input": "A.c\nB.ccc\nC.cccccccccccccccccc\nD.cccccc",
"output": "C"
},
{
"input": "A.aa\nB.bb\nC.cc\nD.ddd",
"output": "C"
},
{
"input": "A.QW\nB.WERT\nC.QWER\nD.QWERTYUI",
"output": "C"
}
] | 1,578,164,826
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 27
| 140
| 0
|
arr = [input() for i in range(4)]
arr = sorted([[arr[i][:1], len(arr[i][2:])] for i in range(4)], key=lambda x: x[1])
if arr[0][1] * 2 <= arr[1][1]:
print(arr[0][0])
elif arr[3][1] >= arr[2][1]*2:
print(arr[3][0])
else:
print('C')
|
Title: The Child and Homework
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once upon a time a child got a test consisting of multiple-choice questions as homework. A multiple-choice question consists of four choices: A, B, C and D. Each choice has a description, and the child should find out the only one that is correct.
Fortunately the child knows how to solve such complicated test. The child will follow the algorithm:
- If there is some choice whose description at least twice shorter than all other descriptions, or at least twice longer than all other descriptions, then the child thinks the choice is great. - If there is exactly one great choice then the child chooses it. Otherwise the child chooses C (the child think it is the luckiest choice).
You are given a multiple-choice questions, can you predict child's choose?
Input Specification:
The first line starts with "A." (without quotes), then followed the description of choice A. The next three lines contains the descriptions of the other choices in the same format. They are given in order: B, C, D. Please note, that the description goes after prefix "X.", so the prefix mustn't be counted in description's length.
Each description is non-empty and consists of at most 100 characters. Each character can be either uppercase English letter or lowercase English letter, or "_".
Output Specification:
Print a single line with the child's choice: "A", "B", "C" or "D" (without quotes).
Demo Input:
['A.VFleaKing_is_the_author_of_this_problem\nB.Picks_is_the_author_of_this_problem\nC.Picking_is_the_author_of_this_problem\nD.Ftiasch_is_cute\n', 'A.ab\nB.abcde\nC.ab\nD.abc\n', 'A.c\nB.cc\nC.c\nD.c\n']
Demo Output:
['D\n', 'C\n', 'B\n']
Note:
In the first sample, the first choice has length 39, the second one has length 35, the third one has length 37, and the last one has length 15. The choice D (length 15) is twice shorter than all other choices', so it is great choice. There is no other great choices so the child will choose D.
In the second sample, no choice is great, so the child will choose the luckiest choice C.
In the third sample, the choice B (length 2) is twice longer than all other choices', so it is great choice. There is no other great choices so the child will choose B.
|
```python
arr = [input() for i in range(4)]
arr = sorted([[arr[i][:1], len(arr[i][2:])] for i in range(4)], key=lambda x: x[1])
if arr[0][1] * 2 <= arr[1][1]:
print(arr[0][0])
elif arr[3][1] >= arr[2][1]*2:
print(arr[3][0])
else:
print('C')
```
| 0
|
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,698,083,291
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
s=input("")
l=s.split("+")
v=sorted(l)
q="+".join(v)
print(q)
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
s=input("")
l=s.split("+")
v=sorted(l)
q="+".join(v)
print(q)
```
| 3
|
|
40
|
A
|
Find Color
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"geometry",
"implementation",
"math"
] |
A. Find Color
|
2
|
256
|
Not so long ago as a result of combat operations the main Berland place of interest — the magic clock — was damaged. The cannon's balls made several holes in the clock, that's why the residents are concerned about the repair. The magic clock can be represented as an infinite Cartesian plane, where the origin corresponds to the clock center. The clock was painted two colors as is shown in the picture:
The picture shows only the central part of the clock. This coloring naturally extends to infinity.
The balls can be taken to be points on the plane. Your task is to find the color of the area, damaged by the given ball.
All the points located on the border of one of the areas have to be considered painted black.
|
The first and single line contains two integers *x* and *y* — the coordinates of the hole made in the clock by the ball. Each of the numbers *x* and *y* has an absolute value that does not exceed 1000.
|
Find the required color.
All the points between which and the origin of coordinates the distance is integral-value are painted black.
|
[
"-2 1\n",
"2 1\n",
"4 3\n"
] |
[
"white\n",
"black\n",
"black\n"
] |
none
| 500
|
[
{
"input": "-2 1",
"output": "white"
},
{
"input": "2 1",
"output": "black"
},
{
"input": "4 3",
"output": "black"
},
{
"input": "3 3",
"output": "black"
},
{
"input": "4 4",
"output": "white"
},
{
"input": "-4 4",
"output": "black"
},
{
"input": "4 -4",
"output": "black"
},
{
"input": "-4 -4",
"output": "white"
},
{
"input": "0 0",
"output": "black"
},
{
"input": "0 1",
"output": "black"
},
{
"input": "0 2",
"output": "black"
},
{
"input": "0 1000",
"output": "black"
},
{
"input": "1000 0",
"output": "black"
},
{
"input": "-1000 0",
"output": "black"
},
{
"input": "0 -1000",
"output": "black"
},
{
"input": "1000 -1000",
"output": "white"
},
{
"input": "12 5",
"output": "black"
},
{
"input": "12 -5",
"output": "black"
},
{
"input": "-12 -35",
"output": "black"
},
{
"input": "20 -21",
"output": "black"
},
{
"input": "-677 492",
"output": "white"
},
{
"input": "-673 -270",
"output": "white"
},
{
"input": "-668 970",
"output": "black"
},
{
"input": "-220 208",
"output": "white"
},
{
"input": "-215 -996",
"output": "black"
},
{
"input": "-211 243",
"output": "black"
},
{
"input": "-206 -518",
"output": "white"
},
{
"input": "-201 278",
"output": "black"
},
{
"input": "-196 -484",
"output": "black"
},
{
"input": "902 479",
"output": "white"
},
{
"input": "-441 572",
"output": "white"
},
{
"input": "217 221",
"output": "white"
},
{
"input": "875 -129",
"output": "white"
},
{
"input": "-469 -36",
"output": "black"
},
{
"input": "189 -387",
"output": "white"
},
{
"input": "847 -294",
"output": "white"
},
{
"input": "-496 -644",
"output": "black"
},
{
"input": "-281 -552",
"output": "white"
},
{
"input": "377 -902",
"output": "black"
},
{
"input": "165 -738",
"output": "white"
},
{
"input": "61 -175",
"output": "black"
},
{
"input": "-42 389",
"output": "black"
},
{
"input": "-589 952",
"output": "black"
},
{
"input": "-693 -929",
"output": "white"
},
{
"input": "-796 -365",
"output": "white"
},
{
"input": "658 198",
"output": "white"
},
{
"input": "555 319",
"output": "black"
},
{
"input": "8 882",
"output": "black"
},
{
"input": "-96 -556",
"output": "black"
},
{
"input": "-129 489",
"output": "black"
},
{
"input": "207 -224",
"output": "black"
},
{
"input": "64 0",
"output": "black"
},
{
"input": "17 144",
"output": "black"
},
{
"input": "60 -448",
"output": "black"
},
{
"input": "-399 -40",
"output": "black"
},
{
"input": "128 -504",
"output": "black"
},
{
"input": "0 72",
"output": "black"
},
{
"input": "168 -26",
"output": "black"
},
{
"input": "72 -154",
"output": "black"
},
{
"input": "117 -44",
"output": "black"
},
{
"input": "-72 -646",
"output": "black"
},
{
"input": "253 -204",
"output": "black"
},
{
"input": "-40 198",
"output": "black"
},
{
"input": "-216 -90",
"output": "black"
},
{
"input": "15 -8",
"output": "black"
},
{
"input": "-180 -432",
"output": "black"
},
{
"input": "280 342",
"output": "black"
},
{
"input": "132 224",
"output": "black"
},
{
"input": "-192 -256",
"output": "black"
},
{
"input": "351 -280",
"output": "black"
}
] | 1,648,781,330
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
from math import hypot,floor
from sys import stdin
x, y = map(int,stdin.readline().split())
h = hypot(x,y)
print(h)
print(floor(h))
f_h = floor(h)
if (x>=0 and y>=0) or (x<0 and y<0):
if f_h == h or (f_h%2==0):
print('black')
else:
print('white')
print('DP')
else:
if f_h == h or (f_h%2==0):
print('white')
else:
print('black')
print('DS')
|
Title: Find Color
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Not so long ago as a result of combat operations the main Berland place of interest — the magic clock — was damaged. The cannon's balls made several holes in the clock, that's why the residents are concerned about the repair. The magic clock can be represented as an infinite Cartesian plane, where the origin corresponds to the clock center. The clock was painted two colors as is shown in the picture:
The picture shows only the central part of the clock. This coloring naturally extends to infinity.
The balls can be taken to be points on the plane. Your task is to find the color of the area, damaged by the given ball.
All the points located on the border of one of the areas have to be considered painted black.
Input Specification:
The first and single line contains two integers *x* and *y* — the coordinates of the hole made in the clock by the ball. Each of the numbers *x* and *y* has an absolute value that does not exceed 1000.
Output Specification:
Find the required color.
All the points between which and the origin of coordinates the distance is integral-value are painted black.
Demo Input:
['-2 1\n', '2 1\n', '4 3\n']
Demo Output:
['white\n', 'black\n', 'black\n']
Note:
none
|
```python
from math import hypot,floor
from sys import stdin
x, y = map(int,stdin.readline().split())
h = hypot(x,y)
print(h)
print(floor(h))
f_h = floor(h)
if (x>=0 and y>=0) or (x<0 and y<0):
if f_h == h or (f_h%2==0):
print('black')
else:
print('white')
print('DP')
else:
if f_h == h or (f_h%2==0):
print('white')
else:
print('black')
print('DS')
```
| 0
|
731
|
A
|
Night at the Museum
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
|
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
|
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
|
[
"zeus\n",
"map\n",
"ares\n"
] |
[
"18\n",
"35\n",
"34\n"
] |
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
| 500
|
[
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,687,091,340
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 46
| 0
|
a = "a" + input()
k = 0
for i in range(len(a)-1):
b = ord(a[i])
c = ord(a[i+1])
s = abs(b-c)
if s > 13:
k += 26-s
else:
k += s
print(k)
|
Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
|
```python
a = "a" + input()
k = 0
for i in range(len(a)-1):
b = ord(a[i])
c = ord(a[i+1])
s = abs(b-c)
if s > 13:
k += 26-s
else:
k += s
print(k)
```
| 3
|
|
451
|
B
|
Sort the Array
|
PROGRAMMING
| 1,300
|
[
"implementation",
"sortings"
] | null | null |
Being a programmer, you like arrays a lot. For your birthday, your friends have given you an array *a* consisting of *n* distinct integers.
Unfortunately, the size of *a* is too small. You want a bigger array! Your friends agree to give you a bigger array, but only if you are able to answer the following question correctly: is it possible to sort the array *a* (in increasing order) by reversing exactly one segment of *a*? See definitions of segment and reversing in the notes.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the size of array *a*.
The second line contains *n* distinct space-separated integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109).
|
Print "yes" or "no" (without quotes), depending on the answer.
If your answer is "yes", then also print two space-separated integers denoting start and end (start must not be greater than end) indices of the segment to be reversed. If there are multiple ways of selecting these indices, print any of them.
|
[
"3\n3 2 1\n",
"4\n2 1 3 4\n",
"4\n3 1 2 4\n",
"2\n1 2\n"
] |
[
"yes\n1 3\n",
"yes\n1 2\n",
"no\n",
"yes\n1 1\n"
] |
Sample 1. You can reverse the entire array to get [1, 2, 3], which is sorted.
Sample 3. No segment can be reversed such that the array will be sorted.
Definitions
A segment [*l*, *r*] of array *a* is the sequence *a*[*l*], *a*[*l* + 1], ..., *a*[*r*].
If you have an array *a* of size *n* and you reverse its segment [*l*, *r*], the array will become:
*a*[1], *a*[2], ..., *a*[*l* - 2], *a*[*l* - 1], *a*[*r*], *a*[*r* - 1], ..., *a*[*l* + 1], *a*[*l*], *a*[*r* + 1], *a*[*r* + 2], ..., *a*[*n* - 1], *a*[*n*].
| 1,000
|
[
{
"input": "3\n3 2 1",
"output": "yes\n1 3"
},
{
"input": "4\n2 1 3 4",
"output": "yes\n1 2"
},
{
"input": "4\n3 1 2 4",
"output": "no"
},
{
"input": "2\n1 2",
"output": "yes\n1 1"
},
{
"input": "2\n58 4",
"output": "yes\n1 2"
},
{
"input": "5\n69 37 27 4 2",
"output": "yes\n1 5"
},
{
"input": "9\n6 78 63 59 28 24 8 96 99",
"output": "yes\n2 7"
},
{
"input": "6\n19517752 43452931 112792556 68417469 779722934 921694415",
"output": "yes\n3 4"
},
{
"input": "6\n169793171 335736854 449917902 513287332 811627074 938727967",
"output": "yes\n1 1"
},
{
"input": "6\n509329 173849943 297546987 591032670 796346199 914588283",
"output": "yes\n1 1"
},
{
"input": "25\n46 45 37 35 26 25 21 19 11 3 1 51 54 55 57 58 59 62 66 67 76 85 88 96 100",
"output": "yes\n1 11"
},
{
"input": "46\n10 12 17 19 20 21 22 24 25 26 27 28 29 30 32 37 42 43 47 48 50 51 52 56 87 86 81 79 74 71 69 67 66 65 60 59 57 89 91 92 94 96 97 98 99 100",
"output": "yes\n25 37"
},
{
"input": "96\n1 2 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 68 69 70 71 72 73 74 75 76 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "yes\n3 22"
},
{
"input": "2\n404928771 698395106",
"output": "yes\n1 1"
},
{
"input": "2\n699573624 308238132",
"output": "yes\n1 2"
},
{
"input": "5\n75531609 242194958 437796493 433259361 942142185",
"output": "yes\n3 4"
},
{
"input": "5\n226959376 840957605 833410429 273566427 872976052",
"output": "yes\n2 4"
},
{
"input": "5\n373362086 994096202 767275079 734424844 515504383",
"output": "yes\n2 5"
},
{
"input": "5\n866379155 593548704 259097686 216134784 879911740",
"output": "yes\n1 4"
},
{
"input": "5\n738083041 719956102 420866851 307749161 257917459",
"output": "yes\n1 5"
},
{
"input": "5\n90786760 107075352 139104198 424911569 858427981",
"output": "yes\n1 1"
},
{
"input": "6\n41533825 525419745 636375901 636653266 879043107 967434399",
"output": "yes\n1 1"
},
{
"input": "40\n22993199 75843013 76710455 99749069 105296587 122559115 125881005 153961749 163646706 175409222 185819807 214465092 264449243 278246513 295514446 322935239 370349154 375773209 390474983 775646826 767329655 740310077 718820037 708508595 693119912 680958422 669537382 629123011 607511013 546574974 546572137 511951383 506996390 493995578 458256840 815612821 881161983 901337648 962275390 986568907",
"output": "yes\n20 35"
},
{
"input": "40\n3284161 23121669 24630274 33434127 178753820 231503277 271972002 272578266 346450638 355655265 372217434 376132047 386622863 387235708 389799554 427160037 466577363 491873718 492746058 502535866 535768673 551570285 557477055 583643014 586216753 588981593 592960633 605923775 611051145 643142759 632768011 634888864 736715552 750574599 867737742 924365786 927179496 934453020 954090860 977765165",
"output": "no"
},
{
"input": "40\n42131757 49645896 49957344 78716964 120937785 129116222 172128600 211446903 247833196 779340466 717548386 709969818 696716905 636153997 635635467 614115746 609201167 533608141 521874836 273044950 291514539 394083281 399369419 448830087 485128983 487192341 488673105 497678164 501864738 265305156 799595875 831638598 835155840 845617770 847736630 851436542 879757553 885618675 964068808 969215471",
"output": "no"
},
{
"input": "40\n25722567 28250400 47661056 108729970 119887370 142272261 145287693 178946020 182917658 187405805 209478929 278713296 312035195 393514697 403876943 410188367 413061616 420619615 477231590 511200584 560288373 571690007 603093961 615463729 631624043 723138759 726089658 728151980 756393077 785590533 809755752 823601179 828357990 866942019 869575503 877310377 881382070 901314141 929048602 947139655",
"output": "yes\n1 1"
},
{
"input": "40\n17927221 33153935 60257083 110553879 114654567 119809916 163899753 167741765 182812464 188486743 220036903 220127072 227545828 229552200 244963635 248298934 299478582 354141058 371400641 430054473 452548736 458695269 466968129 469000714 478004472 478693873 509342093 750631027 609759323 669427158 688490225 690701652 696893030 704668825 749028408 557906039 545356441 926901326 955586118 972642992",
"output": "no"
},
{
"input": "4\n1 4 2 3",
"output": "no"
},
{
"input": "6\n1 2 5 4 3 6",
"output": "yes\n3 5"
},
{
"input": "1\n1",
"output": "yes\n1 1"
},
{
"input": "6\n1 5 3 4 2 6",
"output": "no"
},
{
"input": "4\n3 4 1 2",
"output": "no"
},
{
"input": "5\n2 5 4 3 1",
"output": "no"
},
{
"input": "4\n2 1 4 3",
"output": "no"
},
{
"input": "6\n2 1 4 3 5 6",
"output": "no"
}
] | 1,677,672,444
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 77
| 0
|
n=int(input())
l1=list(map(int,input().split()))
l2=[]
f="yes"
for j in range(n-1):
if l1[j+1]-l1[j]==-1:
l2.append(j)
elif l1[j+1]<l1[j]:
f="no"
l2=[]
break
if len(l2)>1:
for i in range(len(l2)-1):
if l2[i+1]-l2[i]!=1:
f="no"
break
if f=="yes":
if len(l2)==0:
print(f)
print(1,1)
else:
print(f)
print(l2[0]+1,l2[-1]+2)
else:
print(f)
|
Title: Sort the Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Being a programmer, you like arrays a lot. For your birthday, your friends have given you an array *a* consisting of *n* distinct integers.
Unfortunately, the size of *a* is too small. You want a bigger array! Your friends agree to give you a bigger array, but only if you are able to answer the following question correctly: is it possible to sort the array *a* (in increasing order) by reversing exactly one segment of *a*? See definitions of segment and reversing in the notes.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=105) — the size of array *a*.
The second line contains *n* distinct space-separated integers: *a*[1],<=*a*[2],<=...,<=*a*[*n*] (1<=≤<=*a*[*i*]<=≤<=109).
Output Specification:
Print "yes" or "no" (without quotes), depending on the answer.
If your answer is "yes", then also print two space-separated integers denoting start and end (start must not be greater than end) indices of the segment to be reversed. If there are multiple ways of selecting these indices, print any of them.
Demo Input:
['3\n3 2 1\n', '4\n2 1 3 4\n', '4\n3 1 2 4\n', '2\n1 2\n']
Demo Output:
['yes\n1 3\n', 'yes\n1 2\n', 'no\n', 'yes\n1 1\n']
Note:
Sample 1. You can reverse the entire array to get [1, 2, 3], which is sorted.
Sample 3. No segment can be reversed such that the array will be sorted.
Definitions
A segment [*l*, *r*] of array *a* is the sequence *a*[*l*], *a*[*l* + 1], ..., *a*[*r*].
If you have an array *a* of size *n* and you reverse its segment [*l*, *r*], the array will become:
*a*[1], *a*[2], ..., *a*[*l* - 2], *a*[*l* - 1], *a*[*r*], *a*[*r* - 1], ..., *a*[*l* + 1], *a*[*l*], *a*[*r* + 1], *a*[*r* + 2], ..., *a*[*n* - 1], *a*[*n*].
|
```python
n=int(input())
l1=list(map(int,input().split()))
l2=[]
f="yes"
for j in range(n-1):
if l1[j+1]-l1[j]==-1:
l2.append(j)
elif l1[j+1]<l1[j]:
f="no"
l2=[]
break
if len(l2)>1:
for i in range(len(l2)-1):
if l2[i+1]-l2[i]!=1:
f="no"
break
if f=="yes":
if len(l2)==0:
print(f)
print(1,1)
else:
print(f)
print(l2[0]+1,l2[-1]+2)
else:
print(f)
```
| 0
|
|
377
|
A
|
Maze
|
PROGRAMMING
| 1,600
|
[
"dfs and similar"
] | null | null |
Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him.
|
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall.
|
Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them.
|
[
"3 4 2\n#..#\n..#.\n#...\n",
"5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n"
] |
[
"#.X#\nX.#.\n#...\n",
"#XXX\n#X#.\nX#..\n...#\n.#.#\n"
] |
none
| 500
|
[
{
"input": "5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#",
"output": "#XXX\n#X#.\nX#..\n...#\n.#.#"
},
{
"input": "3 3 2\n#.#\n...\n#.#",
"output": "#X#\nX..\n#.#"
},
{
"input": "7 7 18\n#.....#\n..#.#..\n.#...#.\n...#...\n.#...#.\n..#.#..\n#.....#",
"output": "#XXXXX#\nXX#X#X.\nX#XXX#.\nXXX#...\nX#...#.\nX.#.#..\n#.....#"
},
{
"input": "1 1 0\n.",
"output": "."
},
{
"input": "2 3 1\n..#\n#..",
"output": "X.#\n#.."
},
{
"input": "2 3 1\n#..\n..#",
"output": "#.X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n..#",
"output": "...\n.#X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n#..",
"output": "...\nX#.\n#.."
},
{
"input": "5 4 4\n#..#\n....\n.##.\n....\n#..#",
"output": "#XX#\nXX..\n.##.\n....\n#..#"
},
{
"input": "5 5 2\n.#..#\n..#.#\n#....\n##.#.\n###..",
"output": "X#..#\nX.#.#\n#....\n##.#.\n###.."
},
{
"input": "4 6 3\n#.....\n#.#.#.\n.#...#\n...#.#",
"output": "#.....\n#X#.#X\nX#...#\n...#.#"
},
{
"input": "7 5 4\n.....\n.#.#.\n#...#\n.#.#.\n.#...\n..#..\n....#",
"output": "X...X\nX#.#X\n#...#\n.#.#.\n.#...\n..#..\n....#"
},
{
"input": "16 14 19\n##############\n..############\n#.############\n#..###########\n....##########\n..############\n.#############\n.#.###########\n....##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###....#......\n#...#...##.###",
"output": "##############\nXX############\n#X############\n#XX###########\nXXXX##########\nXX############\nX#############\nX#.###########\nX...##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###...X#......\n#X..#XXX##.###"
},
{
"input": "10 17 32\n######.##########\n####.#.##########\n...#....#########\n.........########\n##.......########\n........#########\n#.....###########\n#################\n#################\n#################",
"output": "######X##########\n####X#X##########\nXXX#XXXX#########\nXXXXXXXXX########\n##XXX.XXX########\nXXXX...X#########\n#XX...###########\n#################\n#################\n#################"
},
{
"input": "16 10 38\n##########\n##########\n##########\n..########\n...#######\n...#######\n...#######\n....######\n.....####.\n......###.\n......##..\n.......#..\n.........#\n.........#\n.........#\n.........#",
"output": "##########\n##########\n##########\nXX########\nXXX#######\nXXX#######\nXXX#######\nXXXX######\nXXXXX####.\nXXXXX.###.\nXXXX..##..\nXXX....#..\nXXX......#\nXX.......#\nX........#\n.........#"
},
{
"input": "15 16 19\n########.....###\n########.....###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n.....#####.#..##\n................\n.#...........###\n###.########.###\n###.########.###",
"output": "########XXXXX###\n########XXXXX###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\nXXXX.#####.#..##\nXXX.............\nX#...........###\n###.########.###\n###X########.###"
},
{
"input": "12 19 42\n.........##########\n...................\n.##.##############.\n..################.\n..#################\n..#################\n..#################\n..#################\n..#################\n..#################\n..##########.######\n.............######",
"output": "XXXXXXXXX##########\nXXXXXXXXXXXXXXXXXXX\nX##X##############X\nXX################X\nXX#################\nXX#################\nXX#################\nX.#################\nX.#################\n..#################\n..##########.######\n.............######"
},
{
"input": "3 5 1\n#...#\n..#..\n..#..",
"output": "#...#\n..#..\nX.#.."
},
{
"input": "4 5 10\n.....\n.....\n..#..\n..#..",
"output": "XXX..\nXXX..\nXX#..\nXX#.."
},
{
"input": "3 5 3\n.....\n..#..\n..#..",
"output": ".....\nX.#..\nXX#.."
},
{
"input": "3 5 1\n#....\n..#..\n..###",
"output": "#....\n..#.X\n..###"
},
{
"input": "4 5 1\n.....\n.##..\n..#..\n..###",
"output": ".....\n.##..\n..#.X\n..###"
},
{
"input": "3 5 2\n..#..\n..#..\n....#",
"output": "X.#..\nX.#..\n....#"
},
{
"input": "10 10 1\n##########\n##......##\n#..#..#..#\n#..####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########",
"output": "##########\n##......##\n#..#..#..#\n#X.####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########"
},
{
"input": "10 10 3\n..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######..\n.#######..\n.####..###\n.......###",
"output": "..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######X.\n.#######XX\n.####..###\n.......###"
},
{
"input": "5 7 10\n..#....\n..#.#..\n.##.#..\n..#.#..\n....#..",
"output": "XX#....\nXX#.#..\nX##.#..\nXX#.#..\nXXX.#.."
},
{
"input": "5 7 10\n..#....\n..#.##.\n.##.##.\n..#.#..\n....#..",
"output": "XX#....\nXX#.##.\nX##.##.\nXX#.#..\nXXX.#.."
},
{
"input": "10 10 1\n##########\n##..##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########",
"output": "##########\n##.X##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########"
},
{
"input": "4 5 1\n.....\n.###.\n..#..\n..#..",
"output": ".....\n.###.\n..#..\n.X#.."
},
{
"input": "2 5 2\n###..\n###..",
"output": "###X.\n###X."
},
{
"input": "2 5 3\n.....\n..#..",
"output": "X....\nXX#.."
},
{
"input": "12 12 3\n############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######..#\n#.#######..#\n#.####..####\n#.......####\n############",
"output": "############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######X.#\n#.#######XX#\n#.####..####\n#.......####\n############"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n#####",
"output": ".....\n.##.X\n..###\n..###\n#####"
},
{
"input": "4 4 1\n....\n.#..\n..##\n..##",
"output": "....\n.#.X\n..##\n..##"
},
{
"input": "5 5 1\n....#\n.##..\n.##..\n...##\n...##",
"output": "....#\n.##..\n.##.X\n...##\n...##"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n..###",
"output": ".....\n.##.X\n..###\n..###\n..###"
},
{
"input": "4 5 1\n#....\n#.#..\n..###\n..###",
"output": "#....\n#.#.X\n..###\n..###"
},
{
"input": "4 4 3\n....\n.#..\n..##\n..##",
"output": "...X\n.#XX\n..##\n..##"
},
{
"input": "4 7 6\n.......\n....#..\n.##.#..\n....#..",
"output": "X......\nX...#..\nX##.#..\nXXX.#.."
},
{
"input": "8 8 7\n........\n.##.....\n.#######\n..######\n..######\n..######\n..######\n..######",
"output": ".....XXX\n.##.XXXX\n.#######\n..######\n..######\n..######\n..######\n..######"
}
] | 1,682,432,834
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
from collections import deque
di=[-1,0,1,0]
dj=[0,-1,0,1]
n,m,k= list(map(int,input().split()))
nb=0
maze=[]
for i in range(n):
s=input()
l=[]
for s1 in s :
for j in s1:
l.append(j)
if j=='.' : nb+=1
maze.append(l)
seen=[[False]* m for _ in range(n)]
nb-=k
def canMove(i,j):
return i>=0 and i<n and j>=0 and j<m
def get_neighbors(pi,pj):
neighbors=[]
for d in range (4):
neighi=pi+di[d]
neighj=pj+dj[d]
if canMove(neighi,neighj)and maze[neighi][neighj]=='.':
neighbors.append([neighi,neighj])
return neighbors
def dfs(pi,pj,nb):
stack=deque()
stack.append([pi,pj])
seen[pi][pj]=True
while(stack):
nb-=1
#print('nb= ',nb)
if nb==1:
return
pi,pj=stack.pop()
for neighbor in get_neighbors(pi,pj):
neighi,neighj=neighbor
if not seen[neighi][neighj]:
#print(neighbor)
seen[neighi][neighj]=True
stack.append(neighbor)
#print(str(neighi)+' '+str(neighj))
def first(maze):
for x in range(n):
for y in range(m):
if maze[x][y]=='.':
return [x,y]
def fill(k):
x,y=first(maze)
dfs(x,y,nb)
for i in range(n):
for j in range(m):
if not seen[i][j] and maze[i][j]=='.':
maze[i][j]='x'
k-=1
if k==0:
return
fill(k)
for i in range(n):
for j in range(m):
print(maze[i][j],end="")
print()
|
Title: Maze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall.
Output Specification:
Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them.
Demo Input:
['3 4 2\n#..#\n..#.\n#...\n', '5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n']
Demo Output:
['#.X#\nX.#.\n#...\n', '#XXX\n#X#.\nX#..\n...#\n.#.#\n']
Note:
none
|
```python
from collections import deque
di=[-1,0,1,0]
dj=[0,-1,0,1]
n,m,k= list(map(int,input().split()))
nb=0
maze=[]
for i in range(n):
s=input()
l=[]
for s1 in s :
for j in s1:
l.append(j)
if j=='.' : nb+=1
maze.append(l)
seen=[[False]* m for _ in range(n)]
nb-=k
def canMove(i,j):
return i>=0 and i<n and j>=0 and j<m
def get_neighbors(pi,pj):
neighbors=[]
for d in range (4):
neighi=pi+di[d]
neighj=pj+dj[d]
if canMove(neighi,neighj)and maze[neighi][neighj]=='.':
neighbors.append([neighi,neighj])
return neighbors
def dfs(pi,pj,nb):
stack=deque()
stack.append([pi,pj])
seen[pi][pj]=True
while(stack):
nb-=1
#print('nb= ',nb)
if nb==1:
return
pi,pj=stack.pop()
for neighbor in get_neighbors(pi,pj):
neighi,neighj=neighbor
if not seen[neighi][neighj]:
#print(neighbor)
seen[neighi][neighj]=True
stack.append(neighbor)
#print(str(neighi)+' '+str(neighj))
def first(maze):
for x in range(n):
for y in range(m):
if maze[x][y]=='.':
return [x,y]
def fill(k):
x,y=first(maze)
dfs(x,y,nb)
for i in range(n):
for j in range(m):
if not seen[i][j] and maze[i][j]=='.':
maze[i][j]='x'
k-=1
if k==0:
return
fill(k)
for i in range(n):
for j in range(m):
print(maze[i][j],end="")
print()
```
| 0
|
|
186
|
A
|
Comparing Strings
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
|
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
|
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
|
[
"ab\nba\n",
"aa\nab\n"
] |
[
"YES\n",
"NO\n"
] |
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
| 500
|
[
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "aa\nab",
"output": "NO"
},
{
"input": "a\nza",
"output": "NO"
},
{
"input": "vvea\nvvae",
"output": "YES"
},
{
"input": "rtfabanpc\natfabrnpc",
"output": "YES"
},
{
"input": "mt\ntm",
"output": "YES"
},
{
"input": "qxolmbkkt\naovlajmlf",
"output": "NO"
},
{
"input": "b\ng",
"output": "NO"
},
{
"input": "ab\naba",
"output": "NO"
},
{
"input": "ba\na",
"output": "NO"
},
{
"input": "a\nab",
"output": "NO"
},
{
"input": "a\naa",
"output": "NO"
},
{
"input": "a\nz",
"output": "NO"
},
{
"input": "aabb\nbbaa",
"output": "NO"
},
{
"input": "ab\nbd",
"output": "NO"
},
{
"input": "bac\ndae",
"output": "NO"
},
{
"input": "abc\nakl",
"output": "NO"
},
{
"input": "cb\naa",
"output": "NO"
},
{
"input": "abaab\naabba",
"output": "NO"
},
{
"input": "aab\naaa",
"output": "NO"
},
{
"input": "abcde\nedcba",
"output": "NO"
},
{
"input": "abab\nbaba",
"output": "NO"
},
{
"input": "ab\nbac",
"output": "NO"
},
{
"input": "abcd\naqcb",
"output": "NO"
},
{
"input": "abc\nbad",
"output": "NO"
},
{
"input": "ab\nca",
"output": "NO"
},
{
"input": "abc\nab",
"output": "NO"
},
{
"input": "ab\nbae",
"output": "NO"
},
{
"input": "aaaabcccca\naaaadccccb",
"output": "NO"
},
{
"input": "acaa\nabca",
"output": "NO"
},
{
"input": "aba\naab",
"output": "YES"
},
{
"input": "ah\nla",
"output": "NO"
},
{
"input": "aab\naa",
"output": "NO"
},
{
"input": "abab\nabcd",
"output": "NO"
},
{
"input": "ed\nab",
"output": "NO"
}
] | 1,627,716,723
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 26
| 218
| 8,192,000
|
a = input()
b = input()
a = list(a)
b = list(b)
a.sort()
b.sort()
flag = False
genome = ''
for x in b:
genome += x
string = ''
for i in a:
string += i
if string == genome:
flag = True
break
if flag:
print("YES")
else:
print("NO")
|
Title: Comparing Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
Input Specification:
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Output Specification:
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
Demo Input:
['ab\nba\n', 'aa\nab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
|
```python
a = input()
b = input()
a = list(a)
b = list(b)
a.sort()
b.sort()
flag = False
genome = ''
for x in b:
genome += x
string = ''
for i in a:
string += i
if string == genome:
flag = True
break
if flag:
print("YES")
else:
print("NO")
```
| 0
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,677,860,804
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 46
| 0
|
n, m, a = map(int, input().split())
b = 0
if n <= 1 or m <= 1:
b -= 1
if n % a != 0:
b += n//a + 1
else:
b += n//a
if m % a != 0:
b += m//a + 1
else:
b += m//a
print(b)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
n, m, a = map(int, input().split())
b = 0
if n <= 1 or m <= 1:
b -= 1
if n % a != 0:
b += n//a + 1
else:
b += n//a
if m % a != 0:
b += m//a + 1
else:
b += m//a
print(b)
```
| 0
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,672,642,687
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 46
| 0
|
a,b,c=map(int,input().split())
max1=max(a,b,c)
min1=min(a,b,c)
mid1=a+b+c-min1-max1
print(abs(mid1-min1)+abs(mid1-max1))
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
a,b,c=map(int,input().split())
max1=max(a,b,c)
min1=min(a,b,c)
mid1=a+b+c-min1-max1
print(abs(mid1-min1)+abs(mid1-max1))
```
| 3
|
|
414
|
B
|
Mashmokh and ACM
|
PROGRAMMING
| 1,400
|
[
"combinatorics",
"dp",
"number theory"
] | null | null |
Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following.
A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1).
Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7).
|
The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000).
|
Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7).
|
[
"3 2\n",
"6 4\n",
"2 1\n"
] |
[
"5\n",
"39\n",
"2\n"
] |
In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
| 1,000
|
[
{
"input": "3 2",
"output": "5"
},
{
"input": "6 4",
"output": "39"
},
{
"input": "2 1",
"output": "2"
},
{
"input": "1478 194",
"output": "312087753"
},
{
"input": "1415 562",
"output": "953558593"
},
{
"input": "1266 844",
"output": "735042656"
},
{
"input": "680 1091",
"output": "351905328"
},
{
"input": "1229 1315",
"output": "100240813"
},
{
"input": "1766 1038",
"output": "435768250"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "2000 100",
"output": "983281065"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2000 1000",
"output": "228299266"
},
{
"input": "1928 1504",
"output": "81660104"
},
{
"input": "2000 2000",
"output": "585712681"
},
{
"input": "29 99",
"output": "23125873"
},
{
"input": "56 48",
"output": "20742237"
},
{
"input": "209 370",
"output": "804680894"
},
{
"input": "83 37",
"output": "22793555"
},
{
"input": "49 110",
"output": "956247348"
},
{
"input": "217 3",
"output": "4131"
},
{
"input": "162 161",
"output": "591739753"
},
{
"input": "273 871",
"output": "151578252"
},
{
"input": "43 1640",
"output": "173064407"
},
{
"input": "1472 854",
"output": "748682383"
},
{
"input": "1639 1056",
"output": "467464129"
},
{
"input": "359 896",
"output": "770361185"
},
{
"input": "1544 648",
"output": "9278889"
},
{
"input": "436 1302",
"output": "874366220"
},
{
"input": "1858 743",
"output": "785912917"
},
{
"input": "991 1094",
"output": "483493131"
},
{
"input": "1013 1550",
"output": "613533467"
},
{
"input": "675 741",
"output": "474968598"
},
{
"input": "1420 1223",
"output": "922677437"
},
{
"input": "1544 1794",
"output": "933285446"
},
{
"input": "1903 1612",
"output": "620810276"
},
{
"input": "500 1304",
"output": "706176027"
},
{
"input": "525 314",
"output": "245394744"
},
{
"input": "39 1930",
"output": "992125404"
},
{
"input": "1895 753",
"output": "180474828"
},
{
"input": "1722 1474",
"output": "742424590"
},
{
"input": "1153 1823",
"output": "791493066"
},
{
"input": "1409 734",
"output": "627413973"
},
{
"input": "478 1301",
"output": "476483030"
},
{
"input": "1887 1729",
"output": "730033374"
},
{
"input": "1610 774",
"output": "50897314"
},
{
"input": "1770 679",
"output": "235295539"
},
{
"input": "987 1292",
"output": "560110556"
},
{
"input": "1707 1117",
"output": "237674323"
},
{
"input": "1424 1431",
"output": "184145444"
},
{
"input": "86 1078",
"output": "252515343"
},
{
"input": "1066 995",
"output": "180753612"
},
{
"input": "1024 133",
"output": "392603027"
},
{
"input": "659 974",
"output": "397026719"
},
{
"input": "1349 1606",
"output": "522392901"
},
{
"input": "473 211",
"output": "809550224"
},
{
"input": "634 1825",
"output": "438513382"
},
{
"input": "22 373",
"output": "907321755"
},
{
"input": "531 147",
"output": "242883376"
},
{
"input": "1307 1247",
"output": "21512331"
},
{
"input": "415 735",
"output": "393705804"
},
{
"input": "1659 1501",
"output": "225266660"
},
{
"input": "1454 296",
"output": "750032659"
},
{
"input": "158 772",
"output": "850911301"
},
{
"input": "2000 1",
"output": "2000"
}
] | 1,588,722,393
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 3
| 1,000
| 0
|
n,k=map(int,input().split())
num=n
m= 1000000007
arr=[1]*n
for _ in range(k-1):
for i in range(1,n+1):
for j in range(i+1,n+1):
if j%i==0:
arr[i-1]=(arr[i-1]%m+arr[j-1]%m)%m
print(sum(arr)%m)
|
Title: Mashmokh and ACM
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mashmokh's boss, Bimokh, didn't like Mashmokh. So he fired him. Mashmokh decided to go to university and participate in ACM instead of finding a new job. He wants to become a member of Bamokh's team. In order to join he was given some programming tasks and one week to solve them. Mashmokh is not a very experienced programmer. Actually he is not a programmer at all. So he wasn't able to solve them. That's why he asked you to help him with these tasks. One of these tasks is the following.
A sequence of *l* integers *b*1,<=*b*2,<=...,<=*b**l* (1<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**l*<=≤<=*n*) is called good if each number divides (without a remainder) by the next number in the sequence. More formally for all *i* (1<=≤<=*i*<=≤<=*l*<=-<=1).
Given *n* and *k* find the number of good sequences of length *k*. As the answer can be rather large print it modulo 1000000007 (109<=+<=7).
Input Specification:
The first line of input contains two space-separated integers *n*,<=*k* (1<=≤<=*n*,<=*k*<=≤<=2000).
Output Specification:
Output a single integer — the number of good sequences of length *k* modulo 1000000007 (109<=+<=7).
Demo Input:
['3 2\n', '6 4\n', '2 1\n']
Demo Output:
['5\n', '39\n', '2\n']
Note:
In the first sample the good sequences are: [1, 1], [2, 2], [3, 3], [1, 2], [1, 3].
|
```python
n,k=map(int,input().split())
num=n
m= 1000000007
arr=[1]*n
for _ in range(k-1):
for i in range(1,n+1):
for j in range(i+1,n+1):
if j%i==0:
arr[i-1]=(arr[i-1]%m+arr[j-1]%m)%m
print(sum(arr)%m)
```
| 0
|
|
155
|
A
|
I_love_\%username\%
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500
|
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,691,307,321
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 62
| 0
|
def amazing_performances(points):
n = len(points)
if n <= 1:
return 0
best = worst = points[0]
amazing_count = 0
for i in range(1, n):
if points[i] > best:
best = points[i]
amazing_count += 1
elif points[i] < worst:
worst = points[i]
amazing_count += 1
return amazing_count
# Example usage:
if __name__ == "__main__":
n = int(input())
points = list(map(int, input().split()))
print(amazing_performances(points))
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
def amazing_performances(points):
n = len(points)
if n <= 1:
return 0
best = worst = points[0]
amazing_count = 0
for i in range(1, n):
if points[i] > best:
best = points[i]
amazing_count += 1
elif points[i] < worst:
worst = points[i]
amazing_count += 1
return amazing_count
# Example usage:
if __name__ == "__main__":
n = int(input())
points = list(map(int, input().split()))
print(amazing_performances(points))
```
| 3
|
|
493
|
D
|
Vasya and Chess
|
PROGRAMMING
| 1,700
|
[
"constructive algorithms",
"games",
"math"
] | null | null |
Vasya decided to learn to play chess. Classic chess doesn't seem interesting to him, so he plays his own sort of chess.
The queen is the piece that captures all squares on its vertical, horizontal and diagonal lines. If the cell is located on the same vertical, horizontal or diagonal line with queen, and the cell contains a piece of the enemy color, the queen is able to move to this square. After that the enemy's piece is removed from the board. The queen cannot move to a cell containing an enemy piece if there is some other piece between it and the queen.
There is an *n*<=×<=*n* chessboard. We'll denote a cell on the intersection of the *r*-th row and *c*-th column as (*r*,<=*c*). The square (1,<=1) contains the white queen and the square (1,<=*n*) contains the black queen. All other squares contain green pawns that don't belong to anyone.
The players move in turns. The player that moves first plays for the white queen, his opponent plays for the black queen.
On each move the player has to capture some piece with his queen (that is, move to a square that contains either a green pawn or the enemy queen). The player loses if either he cannot capture any piece during his move or the opponent took his queen during the previous move.
Help Vasya determine who wins if both players play with an optimal strategy on the board *n*<=×<=*n*.
|
The input contains a single number *n* (2<=≤<=*n*<=≤<=109) — the size of the board.
|
On the first line print the answer to problem — string "white" or string "black", depending on who wins if the both players play optimally.
If the answer is "white", then you should also print two integers *r* and *c* representing the cell (*r*,<=*c*), where the first player should make his first move to win. If there are multiple such cells, print the one with the minimum *r*. If there are still multiple squares, print the one with the minimum *c*.
|
[
"2\n",
"3\n"
] |
[
"white\n1 2\n",
"black\n"
] |
In the first sample test the white queen can capture the black queen at the first move, so the white player wins.
In the second test from the statement if the white queen captures the green pawn located on the central vertical line, then it will be captured by the black queen during the next move. So the only move for the white player is to capture the green pawn located at (2, 1).
Similarly, the black queen doesn't have any other options but to capture the green pawn located at (2, 3), otherwise if it goes to the middle vertical line, it will be captured by the white queen.
During the next move the same thing happens — neither the white, nor the black queen has other options rather than to capture green pawns situated above them. Thus, the white queen ends up on square (3, 1), and the black queen ends up on square (3, 3).
In this situation the white queen has to capture any of the green pawns located on the middle vertical line, after that it will be captured by the black queen. Thus, the player who plays for the black queen wins.
| 1,500
|
[
{
"input": "2",
"output": "white\n1 2"
},
{
"input": "3",
"output": "black"
},
{
"input": "4",
"output": "white\n1 2"
},
{
"input": "6",
"output": "white\n1 2"
},
{
"input": "10",
"output": "white\n1 2"
},
{
"input": "16",
"output": "white\n1 2"
},
{
"input": "100",
"output": "white\n1 2"
},
{
"input": "10006",
"output": "white\n1 2"
},
{
"input": "99966246",
"output": "white\n1 2"
},
{
"input": "1000000000",
"output": "white\n1 2"
},
{
"input": "999999999",
"output": "black"
},
{
"input": "999999997",
"output": "black"
},
{
"input": "900001",
"output": "black"
},
{
"input": "775681",
"output": "black"
},
{
"input": "666666",
"output": "white\n1 2"
},
{
"input": "12345",
"output": "black"
},
{
"input": "111111",
"output": "black"
},
{
"input": "346367",
"output": "black"
},
{
"input": "13",
"output": "black"
},
{
"input": "11",
"output": "black"
},
{
"input": "9",
"output": "black"
},
{
"input": "7",
"output": "black"
},
{
"input": "5",
"output": "black"
},
{
"input": "19",
"output": "black"
},
{
"input": "939698497",
"output": "black"
},
{
"input": "999999996",
"output": "white\n1 2"
}
] | 1,680,633,905
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 26
| 77
| 0
|
print(["white\n1 2", "black"][int(input())%2])
|
Title: Vasya and Chess
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya decided to learn to play chess. Classic chess doesn't seem interesting to him, so he plays his own sort of chess.
The queen is the piece that captures all squares on its vertical, horizontal and diagonal lines. If the cell is located on the same vertical, horizontal or diagonal line with queen, and the cell contains a piece of the enemy color, the queen is able to move to this square. After that the enemy's piece is removed from the board. The queen cannot move to a cell containing an enemy piece if there is some other piece between it and the queen.
There is an *n*<=×<=*n* chessboard. We'll denote a cell on the intersection of the *r*-th row and *c*-th column as (*r*,<=*c*). The square (1,<=1) contains the white queen and the square (1,<=*n*) contains the black queen. All other squares contain green pawns that don't belong to anyone.
The players move in turns. The player that moves first plays for the white queen, his opponent plays for the black queen.
On each move the player has to capture some piece with his queen (that is, move to a square that contains either a green pawn or the enemy queen). The player loses if either he cannot capture any piece during his move or the opponent took his queen during the previous move.
Help Vasya determine who wins if both players play with an optimal strategy on the board *n*<=×<=*n*.
Input Specification:
The input contains a single number *n* (2<=≤<=*n*<=≤<=109) — the size of the board.
Output Specification:
On the first line print the answer to problem — string "white" or string "black", depending on who wins if the both players play optimally.
If the answer is "white", then you should also print two integers *r* and *c* representing the cell (*r*,<=*c*), where the first player should make his first move to win. If there are multiple such cells, print the one with the minimum *r*. If there are still multiple squares, print the one with the minimum *c*.
Demo Input:
['2\n', '3\n']
Demo Output:
['white\n1 2\n', 'black\n']
Note:
In the first sample test the white queen can capture the black queen at the first move, so the white player wins.
In the second test from the statement if the white queen captures the green pawn located on the central vertical line, then it will be captured by the black queen during the next move. So the only move for the white player is to capture the green pawn located at (2, 1).
Similarly, the black queen doesn't have any other options but to capture the green pawn located at (2, 3), otherwise if it goes to the middle vertical line, it will be captured by the white queen.
During the next move the same thing happens — neither the white, nor the black queen has other options rather than to capture green pawns situated above them. Thus, the white queen ends up on square (3, 1), and the black queen ends up on square (3, 3).
In this situation the white queen has to capture any of the green pawns located on the middle vertical line, after that it will be captured by the black queen. Thus, the player who plays for the black queen wins.
|
```python
print(["white\n1 2", "black"][int(input())%2])
```
| 3
|
|
160
|
A
|
Twins
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] | null | null |
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
|
In the single line print the single number — the minimum needed number of coins.
|
[
"2\n3 3\n",
"3\n2 1 2\n"
] |
[
"2\n",
"2\n"
] |
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
| 500
|
[
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "5\n4 2 2 2 2",
"output": "3"
},
{
"input": "7\n1 10 1 2 1 1 1",
"output": "1"
},
{
"input": "5\n3 2 3 3 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "4"
},
{
"input": "7\n10 10 5 5 5 5 1",
"output": "3"
},
{
"input": "20\n2 1 2 2 2 1 1 2 1 2 2 1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "20\n4 2 4 4 3 4 2 2 4 2 3 1 1 2 2 3 3 3 1 4",
"output": "8"
},
{
"input": "20\n35 26 41 40 45 46 22 26 39 23 11 15 47 42 18 15 27 10 45 40",
"output": "8"
},
{
"input": "20\n7 84 100 10 31 35 41 2 63 44 57 4 63 11 23 49 98 71 16 90",
"output": "6"
},
{
"input": "50\n19 2 12 26 17 27 10 26 17 17 5 24 11 15 3 9 16 18 19 1 25 23 18 6 2 7 25 7 21 25 13 29 16 9 25 3 14 30 18 4 10 28 6 10 8 2 2 4 8 28",
"output": "14"
},
{
"input": "70\n2 18 18 47 25 5 14 9 19 46 36 49 33 32 38 23 32 39 8 29 31 17 24 21 10 15 33 37 46 21 22 11 20 35 39 13 11 30 28 40 39 47 1 17 24 24 21 46 12 2 20 43 8 16 44 11 45 10 13 44 31 45 45 46 11 10 33 35 23 42",
"output": "22"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "51"
},
{
"input": "100\n1 2 2 1 2 1 1 2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 1 1 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 1 1 2 1 1 1 1 2 2 2 2",
"output": "37"
},
{
"input": "100\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2",
"output": "36"
},
{
"input": "100\n5 5 4 3 5 1 2 5 1 1 3 5 4 4 1 1 1 1 5 4 4 5 1 5 5 1 2 1 3 1 5 1 3 3 3 2 2 2 1 1 5 1 3 4 1 1 3 2 5 2 2 5 5 4 4 1 3 4 3 3 4 5 3 3 3 1 2 1 4 2 4 4 1 5 1 3 5 5 5 5 3 4 4 3 1 2 5 2 3 5 4 2 4 5 3 2 4 2 4 3",
"output": "33"
},
{
"input": "100\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2",
"output": "30"
},
{
"input": "100\n16 9 11 8 11 4 9 17 4 8 4 10 9 10 6 3 3 15 1 6 1 15 12 18 6 14 13 18 1 7 18 4 10 7 10 12 3 16 14 4 10 8 10 7 19 13 15 1 4 8 16 10 6 4 3 16 11 10 7 3 4 16 1 20 1 11 4 16 10 7 7 12 18 19 3 17 19 3 4 19 2 12 11 3 18 20 2 2 14 4 20 13 13 11 16 20 19 14 7 2",
"output": "29"
},
{
"input": "100\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1",
"output": "30"
},
{
"input": "100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52",
"output": "29"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "30"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n4 1 2 3",
"output": "2"
},
{
"input": "5\n2 2 2 4 4",
"output": "2"
},
{
"input": "4\n100 99 99 100",
"output": "2"
}
] | 1,687,284,408
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 92
| 0
|
n = int(input())
lst = []
ai = input().split()
ai = list(map(int,ai))
lst.extend(ai)
lst.sort(reverse = True)
for z in range(len(lst)):
if (sum(lst[0:(z+1)])) > (sum(lst)-sum(lst[0:(z+1)])):
H = (z+1)
break
print(H)
|
Title: Twins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
Output Specification:
In the single line print the single number — the minimum needed number of coins.
Demo Input:
['2\n3 3\n', '3\n2 1 2\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
|
```python
n = int(input())
lst = []
ai = input().split()
ai = list(map(int,ai))
lst.extend(ai)
lst.sort(reverse = True)
for z in range(len(lst)):
if (sum(lst[0:(z+1)])) > (sum(lst)-sum(lst[0:(z+1)])):
H = (z+1)
break
print(H)
```
| 3
|
|
231
|
A
|
Team
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy"
] | null | null |
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
|
Print a single integer — the number of problems the friends will implement on the contest.
|
[
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] |
[
"2\n",
"1\n"
] |
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
| 500
|
[
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,696,435,882
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
n=int(input())
count=0
for _ in range(n):
p,v,t=map(int,input().split())
if p+v+t>=2:
count+=1
print(count)
|
Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution.
|
```python
n=int(input())
count=0
for _ in range(n):
p,v,t=map(int,input().split())
if p+v+t>=2:
count+=1
print(count)
```
| 3
|
|
102
|
B
|
Sum of Digits
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
B. Sum of Digits
|
2
|
265
|
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
|
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
|
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
|
[
"0\n",
"10\n",
"991\n"
] |
[
"0\n",
"1\n",
"3\n"
] |
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
| 1,000
|
[
{
"input": "0",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "991",
"output": "3"
},
{
"input": "99",
"output": "2"
},
{
"input": "100",
"output": "1"
},
{
"input": "123456789",
"output": "2"
},
{
"input": "32",
"output": "1"
},
{
"input": "86",
"output": "2"
},
{
"input": "2",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "34",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "28",
"output": "2"
},
{
"input": "23",
"output": "1"
},
{
"input": "57",
"output": "2"
},
{
"input": "29",
"output": "2"
},
{
"input": "353869285",
"output": "3"
},
{
"input": "549548646",
"output": "2"
},
{
"input": "858893424",
"output": "2"
},
{
"input": "644818852",
"output": "3"
},
{
"input": "360322525",
"output": "3"
},
{
"input": "122937520",
"output": "2"
},
{
"input": "288403032",
"output": "2"
},
{
"input": "677257481",
"output": "3"
},
{
"input": "58059561",
"output": "3"
},
{
"input": "211288847",
"output": "2"
},
{
"input": "339900034079539584",
"output": "2"
},
{
"input": "784084029310269952",
"output": "3"
},
{
"input": "774730557264864000",
"output": "3"
},
{
"input": "478233807148352256",
"output": "3"
},
{
"input": "165646874056812544",
"output": "3"
},
{
"input": "477533739511673792",
"output": "3"
},
{
"input": "660119944377002240",
"output": "3"
},
{
"input": "448375218506078080",
"output": "3"
},
{
"input": "77213334785795616",
"output": "3"
},
{
"input": "165767221702271872",
"output": "3"
},
{
"input": "1",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561",
"output": "3"
},
{
"input": "9",
"output": "0"
}
] | 1,621,607,283
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 51
| 1,028
| 7,884,800
|
def sum(a):
c = 0
for el in a:
c+=int(el)
return str(c)
def main():
c = 0
a = input()
if int(a) < 9:
print(0)
return
while int(a)>9:
a = sum(a)
c+=1
print(c)
main()
|
Title: Sum of Digits
Time Limit: 2 seconds
Memory Limit: 265 megabytes
Problem Description:
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
Input Specification:
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Output Specification:
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
Demo Input:
['0\n', '10\n', '991\n']
Demo Output:
['0\n', '1\n', '3\n']
Note:
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
|
```python
def sum(a):
c = 0
for el in a:
c+=int(el)
return str(c)
def main():
c = 0
a = input()
if int(a) < 9:
print(0)
return
while int(a)>9:
a = sum(a)
c+=1
print(c)
main()
```
| 3.728812
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,695,282,928
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
s = input()
ko=list(map(int, s.split('+')))
ko.sort()
res= '+'.join(map(str, summands))
print(res)
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
s = input()
ko=list(map(int, s.split('+')))
ko.sort()
res= '+'.join(map(str, summands))
print(res)
```
| -1
|
|
439
|
A
|
Devu, the Singer and Churu, the Joker
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
|
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
|
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
|
[
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] |
[
"5\n",
"-1\n"
] |
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
| 500
|
[
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,539,266,158
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 93
| 0
|
n,d = map(int,input().split())
list1 = []
t = list(map(int,input().split()))
time = 0
jokes = 0
for i in range(len(t)):
if d - t[i] > 0:
d = d-t[i]
list1.append(0)
if d - 10 > 0:
d-=10
jokes+=2
else:
if d%5==0:
k = d//5
jokes+=k
if len(list1)!=len(t):
print(-1)
else:
print(jokes)
|
Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
|
```python
n,d = map(int,input().split())
list1 = []
t = list(map(int,input().split()))
time = 0
jokes = 0
for i in range(len(t)):
if d - t[i] > 0:
d = d-t[i]
list1.append(0)
if d - 10 > 0:
d-=10
jokes+=2
else:
if d%5==0:
k = d//5
jokes+=k
if len(list1)!=len(t):
print(-1)
else:
print(jokes)
```
| 0
|
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,691,076,140
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
input();l=list(map(int,input().split()));print(sum(l)/len(l))
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
input();l=list(map(int,input().split()));print(sum(l)/len(l))
```
| 3
|
|
157
|
B
|
Trace
|
PROGRAMMING
| 1,000
|
[
"geometry",
"sortings"
] | null | null |
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
|
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
|
[
"1\n1\n",
"3\n1 4 2\n"
] |
[
"3.1415926536\n",
"40.8407044967\n"
] |
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
| 1,000
|
[
{
"input": "1\n1",
"output": "3.1415926536"
},
{
"input": "3\n1 4 2",
"output": "40.8407044967"
},
{
"input": "4\n4 1 3 2",
"output": "31.4159265359"
},
{
"input": "4\n100 10 2 1",
"output": "31111.1920484997"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "172.7875959474"
},
{
"input": "1\n1000",
"output": "3141592.6535897931"
},
{
"input": "8\n8 1 7 2 6 3 5 4",
"output": "113.0973355292"
},
{
"input": "100\n1000 999 998 997 996 995 994 993 992 991 990 989 988 987 986 985 984 983 982 981 980 979 978 977 976 975 974 973 972 971 970 969 968 967 966 965 964 963 962 961 960 959 958 957 956 955 954 953 952 951 950 949 948 947 946 945 944 943 942 941 940 939 938 937 936 935 934 933 932 931 930 929 928 927 926 925 924 923 922 921 920 919 918 917 916 915 914 913 912 911 910 909 908 907 906 905 904 903 902 901",
"output": "298608.3817237098"
},
{
"input": "6\n109 683 214 392 678 10",
"output": "397266.9574170437"
},
{
"input": "2\n151 400",
"output": "431023.3704798660"
},
{
"input": "6\n258 877 696 425 663 934",
"output": "823521.3902487604"
},
{
"input": "9\n635 707 108 234 52 180 910 203 782",
"output": "1100144.9065826489"
},
{
"input": "8\n885 879 891 428 522 176 135 983",
"output": "895488.9947571954"
},
{
"input": "3\n269 918 721",
"output": "1241695.6467754442"
},
{
"input": "7\n920 570 681 428 866 935 795",
"output": "1469640.1849419588"
},
{
"input": "2\n517 331",
"output": "495517.1260654109"
},
{
"input": "2\n457 898",
"output": "1877274.3981158488"
},
{
"input": "8\n872 704 973 612 183 274 739 253",
"output": "1780774.0965755312"
},
{
"input": "74\n652 446 173 457 760 847 670 25 196 775 998 279 656 809 883 148 969 884 792 502 641 800 663 938 362 339 545 608 107 184 834 666 149 458 864 72 199 658 618 987 126 723 806 643 689 958 626 904 944 415 427 498 628 331 636 261 281 276 478 220 513 595 510 384 354 561 469 462 799 449 747 109 903 456",
"output": "1510006.5089479341"
},
{
"input": "76\n986 504 673 158 87 332 124 218 714 235 212 122 878 370 938 81 686 323 386 348 410 468 875 107 50 960 82 834 234 663 651 422 794 633 294 771 945 607 146 913 950 858 297 88 882 725 247 872 645 749 799 987 115 394 380 382 971 429 593 426 652 353 351 233 868 598 889 116 71 376 916 464 414 976 138 903",
"output": "1528494.7817143100"
},
{
"input": "70\n12 347 748 962 514 686 192 159 990 4 10 788 602 542 946 215 523 727 799 717 955 796 529 465 897 103 181 515 495 153 710 179 747 145 16 585 943 998 923 708 156 399 770 547 775 285 9 68 713 722 570 143 913 416 663 624 925 218 64 237 797 138 942 213 188 818 780 840 480 758",
"output": "1741821.4892636713"
},
{
"input": "26\n656 508 45 189 561 366 96 486 547 386 703 570 780 689 264 26 11 74 466 76 421 48 982 886 215 650",
"output": "1818821.9252031571"
},
{
"input": "52\n270 658 808 249 293 707 700 78 791 167 92 772 807 502 830 991 945 102 968 376 556 578 326 980 688 368 280 853 646 256 666 638 424 737 321 996 925 405 199 680 953 541 716 481 727 143 577 919 892 355 346 298",
"output": "1272941.9273080483"
},
{
"input": "77\n482 532 200 748 692 697 171 863 586 547 301 149 326 812 147 698 303 691 527 805 681 387 619 947 598 453 167 799 840 508 893 688 643 974 998 341 804 230 538 669 271 404 477 759 943 596 949 235 880 160 151 660 832 82 969 539 708 889 258 81 224 655 790 144 462 582 646 256 445 52 456 920 67 819 631 484 534",
"output": "2045673.1891262225"
},
{
"input": "27\n167 464 924 575 775 97 944 390 297 315 668 296 533 829 851 406 702 366 848 512 71 197 321 900 544 529 116",
"output": "1573959.9105970615"
},
{
"input": "38\n488 830 887 566 720 267 583 102 65 200 884 220 263 858 510 481 316 804 754 568 412 166 374 869 356 977 145 421 500 58 664 252 745 70 381 927 670 772",
"output": "1479184.3434235646"
},
{
"input": "64\n591 387 732 260 840 397 563 136 571 876 831 953 799 493 579 13 559 872 53 678 256 232 969 993 847 14 837 365 547 997 604 199 834 529 306 443 739 49 19 276 343 835 904 588 900 870 439 576 975 955 518 117 131 347 800 83 432 882 869 709 32 950 314 450",
"output": "1258248.6984672088"
},
{
"input": "37\n280 281 169 68 249 389 977 101 360 43 448 447 368 496 125 507 747 392 338 270 916 150 929 428 118 266 589 470 774 852 263 644 187 817 808 58 637",
"output": "1495219.0323274869"
},
{
"input": "97\n768 569 306 968 437 779 227 561 412 60 44 807 234 645 169 858 580 396 343 145 842 723 416 80 456 247 81 150 297 116 760 964 312 558 101 850 549 650 299 868 121 435 579 705 118 424 302 812 970 397 659 565 916 183 933 459 6 593 518 717 326 305 744 470 75 981 824 221 294 324 194 293 251 446 481 215 338 861 528 829 921 945 540 89 450 178 24 460 990 392 148 219 934 615 932 340 937",
"output": "1577239.7333274092"
},
{
"input": "94\n145 703 874 425 277 652 239 496 458 658 339 842 564 699 893 352 625 980 432 121 798 872 499 859 850 721 414 825 543 843 304 111 342 45 219 311 50 748 465 902 781 822 504 985 919 656 280 310 917 438 464 527 491 713 906 329 635 777 223 810 501 535 156 252 806 112 971 719 103 443 165 98 579 554 244 996 221 560 301 51 977 422 314 858 528 772 448 626 185 194 536 66 577 677",
"output": "1624269.3753516484"
},
{
"input": "97\n976 166 649 81 611 927 480 231 998 711 874 91 969 521 531 414 993 790 317 981 9 261 437 332 173 573 904 777 882 990 658 878 965 64 870 896 271 732 431 53 761 943 418 602 708 949 930 130 512 240 363 458 673 319 131 784 224 48 919 126 208 212 911 59 677 535 450 273 479 423 79 807 336 18 72 290 724 28 123 605 287 228 350 897 250 392 885 655 746 417 643 114 813 378 355 635 905",
"output": "1615601.7212203942"
},
{
"input": "91\n493 996 842 9 748 178 1 807 841 519 796 998 84 670 778 143 707 208 165 893 154 943 336 150 761 881 434 112 833 55 412 682 552 945 758 189 209 600 354 325 440 844 410 20 136 665 88 791 688 17 539 821 133 236 94 606 483 446 429 60 960 476 915 134 137 852 754 908 276 482 117 252 297 903 981 203 829 811 471 135 188 667 710 393 370 302 874 872 551 457 692",
"output": "1806742.5014501044"
},
{
"input": "95\n936 736 17 967 229 607 589 291 242 244 29 698 800 566 630 667 90 416 11 94 812 838 668 520 678 111 490 823 199 973 681 676 683 721 262 896 682 713 402 691 874 44 95 704 56 322 822 887 639 433 406 35 988 61 176 496 501 947 440 384 372 959 577 370 754 802 1 945 427 116 746 408 308 391 397 730 493 183 203 871 831 862 461 565 310 344 504 378 785 137 279 123 475 138 415",
"output": "1611115.5269110680"
},
{
"input": "90\n643 197 42 218 582 27 66 704 195 445 641 675 285 639 503 686 242 327 57 955 848 287 819 992 756 749 363 48 648 736 580 117 752 921 923 372 114 313 202 337 64 497 399 25 883 331 24 871 917 8 517 486 323 529 325 92 891 406 864 402 263 773 931 253 625 31 17 271 140 131 232 586 893 525 846 54 294 562 600 801 214 55 768 683 389 738 314 284 328 804",
"output": "1569819.2914796301"
},
{
"input": "98\n29 211 984 75 333 96 840 21 352 168 332 433 130 944 215 210 620 442 363 877 91 491 513 955 53 82 351 19 998 706 702 738 770 453 344 117 893 590 723 662 757 16 87 546 312 669 568 931 224 374 927 225 751 962 651 587 361 250 256 240 282 600 95 64 384 589 813 783 39 918 412 648 506 283 886 926 443 173 946 241 310 33 622 565 261 360 547 339 943 367 354 25 479 743 385 485 896 741",
"output": "2042921.1539616778"
},
{
"input": "93\n957 395 826 67 185 4 455 880 683 654 463 84 258 878 553 592 124 585 9 133 20 609 43 452 725 125 801 537 700 685 771 155 566 376 19 690 383 352 174 208 177 416 304 1000 533 481 87 509 358 233 681 22 507 659 36 859 952 259 138 271 594 779 576 782 119 69 608 758 283 616 640 523 710 751 34 106 774 92 874 568 864 660 998 992 474 679 180 409 15 297 990 689 501",
"output": "1310703.8710041976"
},
{
"input": "97\n70 611 20 30 904 636 583 262 255 501 604 660 212 128 199 138 545 576 506 528 12 410 77 888 783 972 431 188 338 485 148 793 907 678 281 922 976 680 252 724 253 920 177 361 721 798 960 572 99 622 712 466 608 49 612 345 266 751 63 594 40 695 532 789 520 930 825 929 48 59 405 135 109 735 508 186 495 772 375 587 201 324 447 610 230 947 855 318 856 956 313 810 931 175 668 183 688",
"output": "1686117.9099228707"
},
{
"input": "96\n292 235 391 180 840 172 218 997 166 287 329 20 886 325 400 471 182 356 448 337 417 319 58 106 366 764 393 614 90 831 924 314 667 532 64 874 3 434 350 352 733 795 78 640 967 63 47 879 635 272 145 569 468 792 153 761 770 878 281 467 209 208 298 37 700 18 334 93 5 750 412 779 523 517 360 649 447 328 311 653 57 578 767 460 647 663 50 670 151 13 511 580 625 907 227 89",
"output": "1419726.5608617242"
},
{
"input": "100\n469 399 735 925 62 153 707 723 819 529 200 624 57 708 245 384 889 11 639 638 260 419 8 142 403 298 204 169 887 388 241 983 885 267 643 943 417 237 452 562 6 839 149 742 832 896 100 831 712 754 679 743 135 222 445 680 210 955 220 63 960 487 514 824 481 584 441 997 795 290 10 45 510 678 844 503 407 945 850 84 858 934 500 320 936 663 736 592 161 670 606 465 864 969 293 863 868 393 899 744",
"output": "1556458.0979239127"
},
{
"input": "100\n321 200 758 415 190 710 920 992 873 898 814 259 359 66 971 210 838 545 663 652 684 277 36 756 963 459 335 484 462 982 532 423 131 703 307 229 391 938 253 847 542 975 635 928 220 980 222 567 557 181 366 824 900 180 107 979 112 564 525 413 300 422 876 615 737 343 902 8 654 628 469 913 967 785 893 314 909 215 912 262 20 709 363 915 997 954 986 454 596 124 74 159 660 550 787 418 895 786 293 50",
"output": "1775109.8050211088"
},
{
"input": "100\n859 113 290 762 701 63 188 431 810 485 671 673 99 658 194 227 511 435 941 212 551 124 89 222 42 321 657 815 898 171 216 482 707 567 724 491 414 942 820 351 48 653 685 312 586 24 20 627 602 498 533 173 463 262 621 466 119 299 580 964 510 987 40 698 521 998 847 651 746 215 808 563 785 837 631 772 404 923 682 244 232 214 390 350 968 771 517 900 70 543 934 554 681 368 642 575 891 728 478 317",
"output": "1447969.4788174964"
},
{
"input": "100\n941 283 349 457 52 837 299 284 796 305 893 624 101 972 738 204 121 70 17 704 836 791 95 111 162 952 472 724 733 580 878 177 705 804 11 211 463 417 288 409 410 485 896 755 921 267 164 656 505 765 539 439 535 19 991 689 220 474 114 944 884 144 926 849 486 566 117 35 749 499 797 303 362 905 690 890 976 66 590 183 234 683 39 297 769 787 376 541 571 759 495 200 261 352 73 493 831 442 273 339",
"output": "1597889.4218394549"
},
{
"input": "100\n110 868 147 888 291 282 916 542 917 337 235 595 498 621 814 249 261 713 445 666 142 275 319 49 900 543 333 606 487 670 620 769 852 258 230 867 603 491 714 839 879 37 21 74 590 190 397 506 499 967 152 862 200 107 145 23 614 167 857 475 79 598 270 906 626 116 89 59 651 846 723 201 50 699 522 408 634 132 226 414 824 764 513 586 526 238 556 162 667 173 684 415 527 743 10 442 552 274 350 822",
"output": "1567230.6191330721"
},
{
"input": "100\n901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000",
"output": "298608.3817237098"
}
] | 1,445,645,828
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 122
| 0
|
range=int(input())
rad=(input())
red=0.0
neg=5
for x in rad:
if x!=" ":
z=int(x)
if neg==0 or neg==5:
red=(red+((3.141592654)*(int(x)*int(x))))
if neg==5:
neg=0
else:
neg=1
else:
red=(red-((3.141592654)*(int(x)*int(x))))
neg=0
print(str(red))
|
Title: Trace
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, as Sherlock Holmes was tracking down one very important criminal, he found a wonderful painting on the wall. This wall could be represented as a plane. The painting had several concentric circles that divided the wall into several parts. Some parts were painted red and all the other were painted blue. Besides, any two neighboring parts were painted different colors, that is, the red and the blue color were alternating, i. e. followed one after the other. The outer area of the wall (the area that lied outside all circles) was painted blue. Help Sherlock Holmes determine the total area of red parts of the wall.
Let us remind you that two circles are called concentric if their centers coincide. Several circles are called concentric if any two of them are concentric.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=100). The second line contains *n* space-separated integers *r**i* (1<=≤<=*r**i*<=≤<=1000) — the circles' radii. It is guaranteed that all circles are different.
Output Specification:
Print the single real number — total area of the part of the wall that is painted red. The answer is accepted if absolute or relative error doesn't exceed 10<=-<=4.
Demo Input:
['1\n1\n', '3\n1 4 2\n']
Demo Output:
['3.1415926536\n', '40.8407044967\n']
Note:
In the first sample the picture is just one circle of radius 1. Inner part of the circle is painted red. The area of the red part equals π × 1<sup class="upper-index">2</sup> = π.
In the second sample there are three circles of radii 1, 4 and 2. Outside part of the second circle is painted blue. Part between the second and the third circles is painted red. Part between the first and the third is painted blue. And, finally, the inner part of the first circle is painted red. Overall there are two red parts: the ring between the second and the third circles and the inner part of the first circle. Total area of the red parts is equal (π × 4<sup class="upper-index">2</sup> - π × 2<sup class="upper-index">2</sup>) + π × 1<sup class="upper-index">2</sup> = π × 12 + π = 13π
|
```python
range=int(input())
rad=(input())
red=0.0
neg=5
for x in rad:
if x!=" ":
z=int(x)
if neg==0 or neg==5:
red=(red+((3.141592654)*(int(x)*int(x))))
if neg==5:
neg=0
else:
neg=1
else:
red=(red-((3.141592654)*(int(x)*int(x))))
neg=0
print(str(red))
```
| 0
|
|
234
|
A
|
Lefthanders and Righthanders
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
One fine October day a mathematics teacher Vasily Petrov went to a class and saw there *n* pupils who sat at the desks, two people at each desk. Vasily quickly realized that number *n* is even. Like all true mathematicians, Vasily has all students numbered from 1 to *n*.
But Vasily Petrov did not like the way the children were seated at the desks. According to him, the students whose numbers differ by 1, can not sit together, as they talk to each other all the time, distract others and misbehave.
On the other hand, if a righthanded student sits at the left end of the desk and a lefthanded student sits at the right end of the desk, they hit elbows all the time and distract each other. In other cases, the students who sit at the same desk, do not interfere with each other.
Vasily knows very well which students are lefthanders and which ones are righthanders, and he asks you to come up with any order that meets these two uncomplicated conditions (students do not talk to each other and do not bump their elbows). It is guaranteed that the input is such that at least one way to seat the students always exists.
|
The first input line contains a single even integer *n* (4<=≤<=*n*<=≤<=100) — the number of students in the class. The second line contains exactly *n* capital English letters "L" and "R". If the *i*-th letter at the second line equals "L", then the student number *i* is a lefthander, otherwise he is a righthander.
|
Print integer pairs, one pair per line. In the *i*-th line print the numbers of students that will sit at the *i*-th desk. The first number in the pair stands for the student who is sitting to the left, and the second number stands for the student who is sitting to the right. Separate the numbers in the pairs by spaces. If there are multiple solutions, print any of them.
|
[
"6\nLLRLLL\n",
"4\nRRLL\n"
] |
[
"1 4\n2 5\n6 3\n",
"3 1\n4 2\n"
] |
none
| 0
|
[
{
"input": "6\nLLRLLL",
"output": "1 4\n2 5\n6 3"
},
{
"input": "4\nRRLL",
"output": "3 1\n4 2"
},
{
"input": "4\nLLRR",
"output": "1 3\n2 4"
},
{
"input": "6\nRLLRRL",
"output": "1 4\n2 5\n3 6"
},
{
"input": "8\nLRLRLLLR",
"output": "1 5\n6 2\n3 7\n4 8"
},
{
"input": "10\nRLLRLRRRLL",
"output": "1 6\n2 7\n3 8\n9 4\n5 10"
},
{
"input": "12\nLRRRRRLRRRRL",
"output": "1 7\n2 8\n3 9\n4 10\n5 11\n12 6"
},
{
"input": "14\nRLLRLLLLRLLLRL",
"output": "8 1\n2 9\n3 10\n11 4\n5 12\n6 13\n7 14"
},
{
"input": "16\nLLLRRRLRRLLRRLLL",
"output": "1 9\n2 10\n3 11\n4 12\n5 13\n14 6\n7 15\n16 8"
},
{
"input": "18\nRRRLLLLRRRLRLRLLRL",
"output": "1 10\n11 2\n3 12\n4 13\n5 14\n6 15\n7 16\n8 17\n18 9"
},
{
"input": "20\nRLRLLRLRRLLRRRRRRLRL",
"output": "11 1\n2 12\n3 13\n4 14\n5 15\n6 16\n7 17\n18 8\n9 19\n10 20"
},
{
"input": "22\nRLLLRLLLRRLRRRLRLLLLLL",
"output": "1 12\n2 13\n3 14\n4 15\n5 16\n6 17\n7 18\n8 19\n20 9\n21 10\n11 22"
},
{
"input": "24\nLRRRLRLLRLRRRRLLLLRRLRLR",
"output": "1 13\n2 14\n15 3\n16 4\n5 17\n18 6\n7 19\n8 20\n21 9\n10 22\n23 11\n12 24"
},
{
"input": "26\nRLRRLLRRLLRLRRLLRLLRRLRLRR",
"output": "1 14\n2 15\n16 3\n4 17\n5 18\n6 19\n7 20\n8 21\n9 22\n10 23\n24 11\n12 25\n13 26"
},
{
"input": "28\nLLLRRRRRLRRLRRRLRLRLRRLRLRRL",
"output": "1 15\n2 16\n3 17\n18 4\n5 19\n20 6\n7 21\n8 22\n9 23\n10 24\n25 11\n12 26\n13 27\n28 14"
},
{
"input": "30\nLRLLRLRRLLRLRLLRRRRRLRLRLRLLLL",
"output": "1 16\n2 17\n3 18\n4 19\n5 20\n6 21\n7 22\n23 8\n9 24\n10 25\n11 26\n12 27\n28 13\n14 29\n15 30"
},
{
"input": "32\nRLRLLRRLLRRLRLLRLRLRLLRLRRRLLRRR",
"output": "17 1\n2 18\n19 3\n4 20\n5 21\n22 6\n7 23\n8 24\n9 25\n10 26\n11 27\n12 28\n29 13\n14 30\n15 31\n16 32"
},
{
"input": "34\nLRRLRLRLLRRRRLLRLRRLRRLRLRRLRRRLLR",
"output": "1 18\n2 19\n20 3\n4 21\n5 22\n6 23\n7 24\n8 25\n9 26\n10 27\n28 11\n12 29\n13 30\n14 31\n15 32\n33 16\n17 34"
},
{
"input": "36\nRRLLLRRRLLLRRLLLRRLLRLLRLRLLRLRLRLLL",
"output": "19 1\n20 2\n3 21\n4 22\n5 23\n6 24\n25 7\n8 26\n9 27\n10 28\n11 29\n30 12\n13 31\n14 32\n15 33\n16 34\n35 17\n36 18"
},
{
"input": "38\nLLRRRLLRRRLRRLRLRRLRRLRLRLLRRRRLLLLRLL",
"output": "1 20\n2 21\n22 3\n4 23\n24 5\n6 25\n7 26\n27 8\n9 28\n10 29\n11 30\n12 31\n32 13\n14 33\n34 15\n16 35\n17 36\n37 18\n19 38"
},
{
"input": "40\nLRRRRRLRLLRRRLLRRLRLLRLRRLRRLLLRRLRRRLLL",
"output": "1 21\n2 22\n23 3\n4 24\n5 25\n26 6\n7 27\n8 28\n9 29\n10 30\n31 11\n12 32\n13 33\n14 34\n15 35\n16 36\n17 37\n18 38\n39 19\n20 40"
},
{
"input": "42\nRLRRLLLLLLLRRRLRLLLRRRLRLLLRLRLRLLLRLRLRRR",
"output": "1 22\n2 23\n3 24\n25 4\n5 26\n6 27\n7 28\n8 29\n9 30\n10 31\n11 32\n33 12\n34 13\n35 14\n15 36\n37 16\n17 38\n18 39\n19 40\n20 41\n21 42"
},
{
"input": "44\nLLLLRRLLRRLLRRLRLLRRRLRLRLLRLRLRRLLRLRRLLLRR",
"output": "1 23\n2 24\n3 25\n4 26\n27 5\n6 28\n7 29\n8 30\n31 9\n10 32\n11 33\n12 34\n35 13\n14 36\n15 37\n16 38\n17 39\n18 40\n41 19\n42 20\n21 43\n22 44"
},
{
"input": "46\nRRRLLLLRRLRLRRRRRLRLLRLRRLRLLLLLLLLRRLRLRLRLLL",
"output": "1 24\n2 25\n26 3\n4 27\n5 28\n6 29\n7 30\n31 8\n32 9\n10 33\n34 11\n12 35\n13 36\n14 37\n38 15\n16 39\n40 17\n18 41\n42 19\n20 43\n21 44\n45 22\n23 46"
},
{
"input": "48\nLLLLRRLRRRRLRRRLRLLLLLRRLLRLLRLLRRLRRLLRLRLRRRRL",
"output": "1 25\n2 26\n3 27\n4 28\n29 5\n6 30\n7 31\n32 8\n9 33\n10 34\n35 11\n12 36\n13 37\n38 14\n39 15\n16 40\n41 17\n18 42\n19 43\n20 44\n21 45\n22 46\n23 47\n48 24"
},
{
"input": "50\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 26\n2 27\n3 28\n4 29\n5 30\n6 31\n7 32\n8 33\n9 34\n10 35\n11 36\n12 37\n13 38\n14 39\n15 40\n16 41\n17 42\n18 43\n19 44\n20 45\n21 46\n22 47\n23 48\n24 49\n25 50"
},
{
"input": "52\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 27\n2 28\n3 29\n4 30\n5 31\n6 32\n7 33\n8 34\n9 35\n10 36\n11 37\n12 38\n13 39\n14 40\n15 41\n16 42\n17 43\n18 44\n19 45\n20 46\n21 47\n22 48\n23 49\n24 50\n25 51\n26 52"
},
{
"input": "54\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 28\n2 29\n3 30\n4 31\n5 32\n6 33\n7 34\n8 35\n9 36\n10 37\n11 38\n12 39\n13 40\n14 41\n15 42\n16 43\n17 44\n18 45\n19 46\n20 47\n21 48\n22 49\n23 50\n24 51\n25 52\n26 53\n27 54"
},
{
"input": "56\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 29\n2 30\n3 31\n4 32\n5 33\n6 34\n7 35\n8 36\n9 37\n10 38\n11 39\n12 40\n13 41\n14 42\n15 43\n16 44\n17 45\n18 46\n19 47\n20 48\n21 49\n22 50\n23 51\n24 52\n25 53\n26 54\n27 55\n28 56"
},
{
"input": "58\nRRRLLLRLLLLRRLRRRLLRLLRLRLLRLRRRRLLLLLLRLRRLRLRRRLRLRRLRRL",
"output": "1 30\n2 31\n3 32\n4 33\n5 34\n6 35\n36 7\n8 37\n9 38\n10 39\n11 40\n41 12\n13 42\n14 43\n44 15\n16 45\n46 17\n18 47\n19 48\n20 49\n21 50\n22 51\n52 23\n24 53\n25 54\n26 55\n27 56\n28 57\n29 58"
},
{
"input": "60\nRLLLLRRLLRRRLLLLRRRRRLRRRLRRRLLLRLLLRLRRRLRLLLRLLRRLLRRRRRLL",
"output": "31 1\n2 32\n3 33\n4 34\n5 35\n36 6\n7 37\n8 38\n9 39\n10 40\n11 41\n42 12\n13 43\n14 44\n15 45\n16 46\n17 47\n48 18\n49 19\n20 50\n21 51\n22 52\n53 23\n24 54\n25 55\n26 56\n27 57\n28 58\n59 29\n30 60"
},
{
"input": "62\nLRRLRLRLLLLRRLLLLRRRLRLLLLRRRLLLLLLRRRLLLLRRLRRLRLLLLLLLLRRLRR",
"output": "1 32\n33 2\n34 3\n4 35\n5 36\n6 37\n7 38\n8 39\n9 40\n10 41\n11 42\n12 43\n13 44\n14 45\n15 46\n16 47\n17 48\n18 49\n50 19\n51 20\n21 52\n53 22\n23 54\n24 55\n25 56\n26 57\n27 58\n28 59\n60 29\n30 61\n31 62"
},
{
"input": "64\nRLLLLRRRLRLLRRRRLRLLLRRRLLLRRRLLRLLRLRLRRRLLRRRRLRLRRRLLLLRRLLLL",
"output": "1 33\n2 34\n3 35\n4 36\n5 37\n6 38\n39 7\n8 40\n9 41\n10 42\n11 43\n12 44\n13 45\n14 46\n15 47\n16 48\n17 49\n18 50\n19 51\n20 52\n21 53\n22 54\n55 23\n56 24\n25 57\n26 58\n27 59\n28 60\n61 29\n62 30\n31 63\n32 64"
},
{
"input": "66\nLLRRRLLRLRLLRRRRRRRLLLLRRLLLLLLRLLLRLLLLLLRRRLRRLLRRRRRLRLLRLLLLRR",
"output": "1 34\n2 35\n3 36\n37 4\n38 5\n6 39\n7 40\n41 8\n9 42\n10 43\n11 44\n12 45\n46 13\n14 47\n15 48\n49 16\n50 17\n18 51\n19 52\n20 53\n21 54\n22 55\n23 56\n24 57\n58 25\n26 59\n27 60\n28 61\n29 62\n30 63\n31 64\n32 65\n33 66"
},
{
"input": "68\nRRLRLRLLRLRLRRRRRRLRRRLLLLRLLRLRLRLRRRRLRLRLLRRRRLRRLLRLRRLLRLRRLRRL",
"output": "35 1\n2 36\n3 37\n4 38\n5 39\n40 6\n7 41\n8 42\n9 43\n10 44\n45 11\n12 46\n13 47\n14 48\n15 49\n50 16\n17 51\n18 52\n19 53\n54 20\n21 55\n56 22\n23 57\n24 58\n25 59\n26 60\n27 61\n28 62\n29 63\n30 64\n31 65\n32 66\n33 67\n68 34"
},
{
"input": "70\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 36\n2 37\n3 38\n4 39\n5 40\n6 41\n7 42\n8 43\n9 44\n10 45\n11 46\n12 47\n13 48\n14 49\n15 50\n16 51\n17 52\n18 53\n19 54\n20 55\n21 56\n22 57\n23 58\n24 59\n25 60\n26 61\n27 62\n28 63\n29 64\n30 65\n31 66\n32 67\n33 68\n34 69\n35 70"
},
{
"input": "72\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 37\n2 38\n3 39\n4 40\n5 41\n6 42\n7 43\n8 44\n9 45\n10 46\n11 47\n12 48\n13 49\n14 50\n15 51\n16 52\n17 53\n18 54\n19 55\n20 56\n21 57\n22 58\n23 59\n24 60\n25 61\n26 62\n27 63\n28 64\n29 65\n30 66\n31 67\n32 68\n33 69\n34 70\n35 71\n36 72"
},
{
"input": "74\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 38\n2 39\n3 40\n4 41\n5 42\n6 43\n7 44\n8 45\n9 46\n10 47\n11 48\n12 49\n13 50\n14 51\n15 52\n16 53\n17 54\n18 55\n19 56\n20 57\n21 58\n22 59\n23 60\n24 61\n25 62\n26 63\n27 64\n28 65\n29 66\n30 67\n31 68\n32 69\n33 70\n34 71\n35 72\n36 73\n37 74"
},
{
"input": "76\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 39\n2 40\n3 41\n4 42\n5 43\n6 44\n7 45\n8 46\n9 47\n10 48\n11 49\n12 50\n13 51\n14 52\n15 53\n16 54\n17 55\n18 56\n19 57\n20 58\n21 59\n22 60\n23 61\n24 62\n25 63\n26 64\n27 65\n28 66\n29 67\n30 68\n31 69\n32 70\n33 71\n34 72\n35 73\n36 74\n37 75\n38 76"
},
{
"input": "78\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "1 40\n2 41\n3 42\n4 43\n5 44\n6 45\n7 46\n8 47\n9 48\n10 49\n11 50\n12 51\n13 52\n14 53\n15 54\n16 55\n17 56\n18 57\n19 58\n20 59\n21 60\n22 61\n23 62\n24 63\n25 64\n26 65\n27 66\n28 67\n29 68\n30 69\n31 70\n32 71\n33 72\n34 73\n35 74\n36 75\n37 76\n38 77\n39 78"
},
{
"input": "80\nLRLRRRRLRRRRLLLLRLLRLRLLRRLRLLLRRLLLLRLLLRLRLLRRRLRRRLRLRRRRRLRLLRLLRRLLLRLRRRLL",
"output": "1 41\n2 42\n3 43\n4 44\n45 5\n46 6\n7 47\n8 48\n9 49\n50 10\n11 51\n12 52\n13 53\n14 54\n15 55\n16 56\n17 57\n18 58\n19 59\n20 60\n21 61\n62 22\n23 63\n24 64\n65 25\n26 66\n27 67\n68 28\n29 69\n30 70\n31 71\n72 32\n73 33\n34 74\n35 75\n36 76\n37 77\n38 78\n39 79\n40 80"
},
{
"input": "82\nRLRRLLRLRLRLLLRLLLRRLLRRLRRRRLLRLLLLRRRRRLLLRRRLLLLRLRRLRRRLRLLLLRRRLRLRLLLRLLLLLR",
"output": "42 1\n2 43\n44 3\n4 45\n5 46\n6 47\n48 7\n8 49\n50 9\n10 51\n11 52\n12 53\n13 54\n14 55\n56 15\n16 57\n17 58\n18 59\n60 19\n20 61\n21 62\n22 63\n64 23\n65 24\n25 66\n26 67\n27 68\n69 28\n29 70\n30 71\n31 72\n73 32\n33 74\n34 75\n35 76\n36 77\n78 37\n79 38\n80 39\n81 40\n41 82"
},
{
"input": "84\nLRLRRRRRRLLLRLRLLLLLRRLRLRLRRRLLRLLLRLRLLLRRRLRLRRLRLRLLLLLLLLRRRRRRLLLRRLRLRLLLRLRR",
"output": "1 43\n2 44\n3 45\n46 4\n5 47\n48 6\n7 49\n8 50\n51 9\n10 52\n11 53\n12 54\n55 13\n14 56\n57 15\n16 58\n17 59\n18 60\n19 61\n20 62\n21 63\n22 64\n23 65\n24 66\n25 67\n26 68\n27 69\n70 28\n71 29\n30 72\n31 73\n32 74\n33 75\n34 76\n35 77\n36 78\n79 37\n38 80\n39 81\n40 82\n41 83\n42 84"
},
{
"input": "86\nRRRLLLRLLRLLRLRLRLLLRLRLRRLLRLLLRLLLLLLRRRLRLLRLLLRRRLRLLLLRLLRLRRLLRLLLRRRLLRLRLLRLLR",
"output": "1 44\n45 2\n46 3\n4 47\n5 48\n6 49\n50 7\n8 51\n9 52\n10 53\n11 54\n12 55\n56 13\n14 57\n58 15\n16 59\n17 60\n18 61\n19 62\n20 63\n64 21\n22 65\n23 66\n24 67\n68 25\n26 69\n27 70\n28 71\n72 29\n30 73\n31 74\n32 75\n76 33\n34 77\n35 78\n36 79\n37 80\n38 81\n39 82\n40 83\n84 41\n85 42\n43 86"
},
{
"input": "88\nLLRLRLRLLLLRRRRRRLRRLLLLLRRLRRLLLLLRLRLRLLLLLRLRLRRLRLRRLRLLRRLRLLLRLLLLRRLLRRLRLRLRRLRR",
"output": "1 45\n2 46\n47 3\n4 48\n49 5\n6 50\n7 51\n8 52\n9 53\n10 54\n11 55\n12 56\n57 13\n14 58\n59 15\n60 16\n17 61\n18 62\n63 19\n20 64\n21 65\n22 66\n23 67\n24 68\n25 69\n70 26\n71 27\n28 72\n29 73\n30 74\n31 75\n32 76\n33 77\n34 78\n35 79\n36 80\n37 81\n38 82\n39 83\n40 84\n41 85\n42 86\n43 87\n44 88"
},
{
"input": "90\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 46\n2 47\n3 48\n4 49\n5 50\n6 51\n7 52\n8 53\n9 54\n10 55\n11 56\n12 57\n13 58\n14 59\n15 60\n16 61\n17 62\n18 63\n19 64\n20 65\n21 66\n22 67\n23 68\n24 69\n25 70\n26 71\n27 72\n28 73\n29 74\n30 75\n31 76\n32 77\n33 78\n34 79\n35 80\n36 81\n37 82\n38 83\n39 84\n40 85\n41 86\n42 87\n43 88\n44 89\n45 90"
},
{
"input": "92\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 47\n2 48\n3 49\n4 50\n5 51\n6 52\n7 53\n8 54\n9 55\n10 56\n11 57\n12 58\n13 59\n14 60\n15 61\n16 62\n17 63\n18 64\n19 65\n20 66\n21 67\n22 68\n23 69\n24 70\n25 71\n26 72\n27 73\n28 74\n29 75\n30 76\n31 77\n32 78\n33 79\n34 80\n35 81\n36 82\n37 83\n38 84\n39 85\n40 86\n41 87\n42 88\n43 89\n44 90\n45 91\n46 92"
},
{
"input": "94\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 48\n2 49\n3 50\n4 51\n5 52\n6 53\n7 54\n8 55\n9 56\n10 57\n11 58\n12 59\n13 60\n14 61\n15 62\n16 63\n17 64\n18 65\n19 66\n20 67\n21 68\n22 69\n23 70\n24 71\n25 72\n26 73\n27 74\n28 75\n29 76\n30 77\n31 78\n32 79\n33 80\n34 81\n35 82\n36 83\n37 84\n38 85\n39 86\n40 87\n41 88\n42 89\n43 90\n44 91\n45 92\n46 93\n47 94"
},
{
"input": "96\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 49\n2 50\n3 51\n4 52\n5 53\n6 54\n7 55\n8 56\n9 57\n10 58\n11 59\n12 60\n13 61\n14 62\n15 63\n16 64\n17 65\n18 66\n19 67\n20 68\n21 69\n22 70\n23 71\n24 72\n25 73\n26 74\n27 75\n28 76\n29 77\n30 78\n31 79\n32 80\n33 81\n34 82\n35 83\n36 84\n37 85\n38 86\n39 87\n40 88\n41 89\n42 90\n43 91\n44 92\n45 93\n46 94\n47 95\n48 96"
},
{
"input": "98\nLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL",
"output": "1 50\n2 51\n3 52\n4 53\n5 54\n6 55\n7 56\n8 57\n9 58\n10 59\n11 60\n12 61\n13 62\n14 63\n15 64\n16 65\n17 66\n18 67\n19 68\n20 69\n21 70\n22 71\n23 72\n24 73\n25 74\n26 75\n27 76\n28 77\n29 78\n30 79\n31 80\n32 81\n33 82\n34 83\n35 84\n36 85\n37 86\n38 87\n39 88\n40 89\n41 90\n42 91\n43 92\n44 93\n45 94\n46 95\n47 96\n48 97\n49 98"
},
{
"input": "100\nRLRRRRLLLLRRRRLRRRRRRRRLRLRRLLRRRRRRRRLRRRRLLLLRRRRLRRLRLRRRLLRRLRRLLLRLRRLLLLLLRLRLRLRRLRLRLRRRLLLR",
"output": "1 51\n2 52\n3 53\n4 54\n55 5\n6 56\n7 57\n8 58\n9 59\n10 60\n61 11\n62 12\n13 63\n14 64\n15 65\n16 66\n17 67\n68 18\n69 19\n70 20\n21 71\n72 22\n23 73\n24 74\n75 25\n26 76\n77 27\n78 28\n29 79\n30 80\n31 81\n82 32\n33 83\n84 34\n35 85\n86 36\n37 87\n38 88\n39 89\n40 90\n91 41\n42 92\n93 43\n44 94\n45 95\n46 96\n47 97\n98 48\n99 49\n50 100"
},
{
"input": "100\nLRLLLLRLLLLRRRRRLRRRRLRRLRRLRLLRRLRRRRLLRRRLLLRLLLRRRRLLRLRLRRLRLLRRLLRRLRRLRRRRRLRRLRLRLRLLLLLLLLRL",
"output": "1 51\n2 52\n3 53\n4 54\n5 55\n6 56\n7 57\n8 58\n9 59\n10 60\n11 61\n12 62\n63 13\n14 64\n65 15\n66 16\n17 67\n18 68\n69 19\n70 20\n21 71\n22 72\n73 23\n24 74\n25 75\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n82 32\n33 83\n34 84\n85 35\n36 86\n87 37\n38 88\n39 89\n40 90\n91 41\n92 42\n93 43\n44 94\n45 95\n46 96\n97 47\n48 98\n49 99\n50 100"
},
{
"input": "100\nLLLRRLLRLRLLLRLLLRLRLLRRRLRRLLLRLRLRRLLRLRRRLLLRRLLRLLRRLLRRRRRLRLRRLRLRRLRLRRLLRLRLLRLLLRLLRLLLLRLL",
"output": "1 51\n2 52\n3 53\n54 4\n5 55\n6 56\n7 57\n58 8\n9 59\n10 60\n11 61\n12 62\n13 63\n64 14\n15 65\n16 66\n17 67\n18 68\n19 69\n20 70\n21 71\n22 72\n23 73\n74 24\n25 75\n26 76\n27 77\n28 78\n29 79\n30 80\n31 81\n82 32\n33 83\n84 34\n35 85\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n92 42\n43 93\n94 44\n45 95\n46 96\n47 97\n48 98\n99 49\n50 100"
},
{
"input": "100\nRLLLLRRLLLLRRRRLLRLRRRLLLRLLRLLLLLRRLLLLLLRRLRRRRRLRLLRLRRRLLLRLRLRLLLRRRLLLLLRRRRRLRRLLLLRLLLRRLLLL",
"output": "51 1\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n9 59\n10 60\n11 61\n62 12\n13 63\n64 14\n15 65\n16 66\n17 67\n68 18\n19 69\n70 20\n21 71\n22 72\n23 73\n24 74\n25 75\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n93 43\n94 44\n45 95\n46 96\n97 47\n98 48\n99 49\n100 50"
},
{
"input": "100\nRLRRLRLRRLRLLRLLRRRLRRLLLLLRLRLRRRRRRRLLRRRLLRLRLLLRRRLLRRRLLRLRLLLLRRLRLLRLLRLLLLRRLRLRRLRLLLLRLRRR",
"output": "51 1\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n9 59\n10 60\n61 11\n12 62\n13 63\n14 64\n15 65\n16 66\n67 17\n68 18\n19 69\n20 70\n71 21\n22 72\n23 73\n24 74\n25 75\n26 76\n27 77\n28 78\n29 79\n80 30\n31 81\n82 32\n33 83\n34 84\n85 35\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n92 42\n93 43\n44 94\n45 95\n46 96\n47 97\n48 98\n49 99\n50 100"
},
{
"input": "100\nLRRLRLRRRRRRLRRLRRLLLLLLRRLLRRLLRLLLLLLRRRLLRLRRRLLRLLRRLRRRLLRLRLLRRLRRRLLLRRRRLLRRRLLLRRRRRLLLLLLR",
"output": "1 51\n2 52\n53 3\n4 54\n5 55\n6 56\n57 7\n8 58\n9 59\n10 60\n61 11\n62 12\n13 63\n64 14\n15 65\n16 66\n67 17\n18 68\n19 69\n20 70\n21 71\n22 72\n23 73\n24 74\n75 25\n76 26\n27 77\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n44 94\n95 45\n46 96\n97 47\n98 48\n99 49\n50 100"
},
{
"input": "100\nRRLRRLRLRLRRRRLLRRLLRLRRLLRRRLLRLRRLRLRRLLLRRLLRRRRRRLLLRRRLLRRLLLLLLRLLLLLLRLLLRRRLRLLRRRRRLLRLLRRR",
"output": "1 51\n2 52\n3 53\n54 4\n55 5\n6 56\n7 57\n8 58\n9 59\n10 60\n61 11\n12 62\n13 63\n64 14\n15 65\n16 66\n67 17\n68 18\n19 69\n20 70\n71 21\n22 72\n73 23\n74 24\n25 75\n26 76\n27 77\n78 28\n79 29\n30 80\n31 81\n32 82\n33 83\n84 34\n35 85\n36 86\n87 37\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n94 44\n45 95\n46 96\n47 97\n48 98\n49 99\n50 100"
},
{
"input": "100\nRRLLLRLRRLRLLRRLRRRLLRRRLRRLLLLLLLLLRRRLLRLRRLRRLRRLRRLRLLLLRLLRRRLLLLRLRRRLLRRRRLRRLLRRRRLRRRLRLLLR",
"output": "1 51\n52 2\n3 53\n4 54\n5 55\n6 56\n7 57\n58 8\n59 9\n10 60\n11 61\n12 62\n13 63\n14 64\n15 65\n16 66\n67 17\n68 18\n69 19\n20 70\n21 71\n72 22\n23 73\n24 74\n25 75\n76 26\n77 27\n28 78\n29 79\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n40 90\n41 91\n42 92\n43 93\n44 94\n95 45\n46 96\n97 47\n98 48\n49 99\n50 100"
},
{
"input": "100\nLLLLLRRLRRRRRRRLLRRRRRLRRLRLRLLRLRRLLLRRRRLLRRLRLLRLLLRLRLLRRRRRRRRRLRLLLRLRLLLLLRLRRRRLRLLRLRLRLRRL",
"output": "1 51\n2 52\n3 53\n4 54\n5 55\n56 6\n7 57\n8 58\n59 9\n10 60\n11 61\n12 62\n13 63\n14 64\n15 65\n16 66\n17 67\n18 68\n69 19\n20 70\n71 21\n72 22\n23 73\n24 74\n75 25\n26 76\n77 27\n28 78\n79 29\n30 80\n31 81\n32 82\n33 83\n34 84\n35 85\n36 86\n37 87\n38 88\n39 89\n90 40\n91 41\n42 92\n43 93\n44 94\n95 45\n46 96\n47 97\n48 98\n49 99\n50 100"
},
{
"input": "100\nLLRRRLLLRLLLLRLRLRLRRRLLLRRRLRLLRLLLRRRRRLRRLRRLRRRLRRLRRLLLRLRLLRRRRLRLRRRRRLRRLRLLRRRRLLLRRRRRLLLL",
"output": "1 51\n2 52\n3 53\n4 54\n55 5\n6 56\n7 57\n8 58\n59 9\n10 60\n11 61\n12 62\n13 63\n64 14\n15 65\n16 66\n17 67\n18 68\n19 69\n70 20\n21 71\n72 22\n23 73\n24 74\n25 75\n26 76\n27 77\n78 28\n29 79\n30 80\n31 81\n32 82\n83 33\n34 84\n35 85\n36 86\n37 87\n38 88\n89 39\n90 40\n91 41\n42 92\n43 93\n44 94\n45 95\n46 96\n97 47\n48 98\n99 49\n100 50"
}
] | 1,620,673,209
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 6,656,000
|
N = input()
N = int(N)
n = int(N/2)
S = input()
S = str(S)
for i in range(0,n):
if S[i] == "R" and S[i+n] == "L":
print(S[i+n], S[i])
else:
print(S[i], S[i+n])
|
Title: Lefthanders and Righthanders
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One fine October day a mathematics teacher Vasily Petrov went to a class and saw there *n* pupils who sat at the desks, two people at each desk. Vasily quickly realized that number *n* is even. Like all true mathematicians, Vasily has all students numbered from 1 to *n*.
But Vasily Petrov did not like the way the children were seated at the desks. According to him, the students whose numbers differ by 1, can not sit together, as they talk to each other all the time, distract others and misbehave.
On the other hand, if a righthanded student sits at the left end of the desk and a lefthanded student sits at the right end of the desk, they hit elbows all the time and distract each other. In other cases, the students who sit at the same desk, do not interfere with each other.
Vasily knows very well which students are lefthanders and which ones are righthanders, and he asks you to come up with any order that meets these two uncomplicated conditions (students do not talk to each other and do not bump their elbows). It is guaranteed that the input is such that at least one way to seat the students always exists.
Input Specification:
The first input line contains a single even integer *n* (4<=≤<=*n*<=≤<=100) — the number of students in the class. The second line contains exactly *n* capital English letters "L" and "R". If the *i*-th letter at the second line equals "L", then the student number *i* is a lefthander, otherwise he is a righthander.
Output Specification:
Print integer pairs, one pair per line. In the *i*-th line print the numbers of students that will sit at the *i*-th desk. The first number in the pair stands for the student who is sitting to the left, and the second number stands for the student who is sitting to the right. Separate the numbers in the pairs by spaces. If there are multiple solutions, print any of them.
Demo Input:
['6\nLLRLLL\n', '4\nRRLL\n']
Demo Output:
['1 4\n2 5\n6 3\n', '3 1\n4 2\n']
Note:
none
|
```python
N = input()
N = int(N)
n = int(N/2)
S = input()
S = str(S)
for i in range(0,n):
if S[i] == "R" and S[i+n] == "L":
print(S[i+n], S[i])
else:
print(S[i], S[i+n])
```
| -1
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,678,121,020
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 92
| 0
|
n=int(input(""))
posn=[0,0,0]
flag=0
if n>=1 and n<=100:
for i in range(n):
a,b,c=map(int,input().split())
if a<-100 or a>100 or b<-100 or b>100 or c<-100 or c>100:
flag=1
posn[0]+=a
posn[1]+=b
posn[2]+=c
for i in range(3):
if posn[i]!=0:
flag=1
if flag!=0:
print("NO")
else:
print("YES")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n=int(input(""))
posn=[0,0,0]
flag=0
if n>=1 and n<=100:
for i in range(n):
a,b,c=map(int,input().split())
if a<-100 or a>100 or b<-100 or b>100 or c<-100 or c>100:
flag=1
posn[0]+=a
posn[1]+=b
posn[2]+=c
for i in range(3):
if posn[i]!=0:
flag=1
if flag!=0:
print("NO")
else:
print("YES")
```
| 3.977
|
5
|
A
|
Chat Servers Outgoing Traffic
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Chat Server's Outgoing Traffic
|
1
|
64
|
Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem.
|
Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive.
|
Print a single number — answer to the problem.
|
[
"+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n",
"+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n"
] |
[
"9\n",
"14\n"
] |
none
| 0
|
[
{
"input": "+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate",
"output": "9"
},
{
"input": "+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate",
"output": "14"
},
{
"input": "+Dmitry\n+Mike\nDmitry:All letters will be used\nDmitry:qwertyuiopasdfghjklzxcvbnm QWERTYUIOPASDFGHJKLZXCVBNM\nDmitry:And digits too\nDmitry:1234567890 0987654321\n-Dmitry",
"output": "224"
},
{
"input": "+Dmitry\n+Mike\n+Kate\nDmitry:",
"output": "0"
},
{
"input": "+Dmitry\nDmitry:No phrases with spaces at the beginning and at the end\n+Mike\nDmitry:spaces spaces\n-Dmitry",
"output": "86"
},
{
"input": "+XqD\n+aT537\nXqD:x6ZPjMR1DDKG2\nXqD:lLCriywPnB\n-XqD",
"output": "46"
},
{
"input": "+8UjgAJ\n8UjgAJ:02hR7UBc1tqqfL\n-8UjgAJ\n+zdi\n-zdi",
"output": "14"
},
{
"input": "+6JPKkgXDrA\n+j6JHjv70An\n+QGtsceK0zJ\n6JPKkgXDrA:o4\n+CSmwi9zDra\nQGtsceK0zJ:Zl\nQGtsceK0zJ:0\nj6JHjv70An:7\nj6JHjv70An:B\nQGtsceK0zJ:OO",
"output": "34"
},
{
"input": "+1aLNq9S7uLV\n-1aLNq9S7uLV\n+O9ykq3xDJv\n-O9ykq3xDJv\n+54Yq1xJq14F\n+0zJ5Vo0RDZ\n-54Yq1xJq14F\n-0zJ5Vo0RDZ\n+lxlH7sdolyL\n-lxlH7sdolyL",
"output": "0"
},
{
"input": "+qlHEc2AuYy\nqlHEc2AuYy:YYRwD0 edNZgpE nGfOguRWnMYpTpGUVM aXDKGXo1Gv1tHL9\nqlHEc2AuYy:yvh3GsPcImqrvoUcBNQcP6ezwpU0 xAVltaKZp94VKiNao\nqlHEc2AuYy:zuCO6Opey L eu7lTwysaSk00zjpv zrDfbt8l hpHfu\n+pErDMxgVgh\nqlHEc2AuYy:I1FLis mmQbZtd8Ui7y 1vcax6yZBMhVRdD6Ahlq7MNCw\nqlHEc2AuYy:lz MFUNJZhlqBYckHUDlNhLiEkmecRh1o0t7alXBvCRVEFVx\npErDMxgVgh:jCyMbu1dkuEj5TzbBOjyUhpfC50cL8R900Je3R KxRgAI dT\nqlHEc2AuYy:62b47eabo2hf vSUD7KioN ZHki6WB6gh3u GKv5rgwyfF\npErDMxgVgh:zD5 9 ympl4wR gy7a7eAGAn5xVdGP9FbL6hRCZAR6O4pT6zb",
"output": "615"
},
{
"input": "+adabacaba0",
"output": "0"
},
{
"input": "+acabadab\n+caba0aba",
"output": "0"
},
{
"input": "+dabaca\n-dabaca\n+aba0ab",
"output": "0"
},
{
"input": "+cab\n+abac\n-abac\n+baca",
"output": "0"
},
{
"input": "+cabadabac\n-cabadabac\n+abacaba1ab\n-abacaba1ab\n+ba0abaca",
"output": "0"
},
{
"input": "+adabacaba\n-adabacaba\n+aca\naca:caba\n-aca\n+bacaba\n-bacaba\n+aba\n-aba\n+bad",
"output": "4"
},
{
"input": "+acabadab\n-acabadab\n+aba0abacab\n+baca\n+abacaba0ab\n-baca\n-abacaba0ab\n-aba0abacab\n+cab\n-cab\n+abacabada\n-abacabada\n+badabaca\n-badabaca\n+badaba",
"output": "0"
},
{
"input": "+badabac\nbadabac:abacabad\n-badabac\n+0ab\n-0ab\n+dabacab\n-dabacab\n+a0ab\n-a0ab\n+0abaca\n-0abaca\n+dabac\n-dabac\n+abaca\n-abaca\n+bacabada\n-bacabada\n+aca\n-aca\n+abadabaca\n-abadabaca\n+acaba\n-acaba\n+abacabadab\n-abacabadab",
"output": "8"
}
] | 1,508,125,374
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 92
| 0
|
list=[]
output=0
with open('input.txt', 'r') as f1:
content=f1.readlines()
content=[x.strip('\n') for x in content]
for i in range(len(content)):
if content[i][0:1]=='+':
list.append(content[i][1:])
elif content[i][0:1]=='-':
list.remove(content[i][1:])
elif ':' in content[i]:
index1=content[i].index(':')
output+=(len(content[i])-index1-1)*len(list)
print(output)
|
Title: Chat Servers Outgoing Traffic
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem.
Input Specification:
Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive.
Output Specification:
Print a single number — answer to the problem.
Demo Input:
['+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n', '+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n']
Demo Output:
['9\n', '14\n']
Note:
none
|
```python
list=[]
output=0
with open('input.txt', 'r') as f1:
content=f1.readlines()
content=[x.strip('\n') for x in content]
for i in range(len(content)):
if content[i][0:1]=='+':
list.append(content[i][1:])
elif content[i][0:1]=='-':
list.remove(content[i][1:])
elif ':' in content[i]:
index1=content[i].index(':')
output+=(len(content[i])-index1-1)*len(list)
print(output)
```
| -1
|
723
|
E
|
One-Way Reform
|
PROGRAMMING
| 2,200
|
[
"constructive algorithms",
"dfs and similar",
"flows",
"graphs",
"greedy"
] | null | null |
There are *n* cities and *m* two-way roads in Berland, each road connects two cities. It is known that there is no more than one road connecting each pair of cities, and there is no road which connects the city with itself. It is possible that there is no way to get from one city to some other city using only these roads.
The road minister decided to make a reform in Berland and to orient all roads in the country, i.e. to make each road one-way. The minister wants to maximize the number of cities, for which the number of roads that begins in the city equals to the number of roads that ends in it.
|
The first line contains a positive integer *t* (1<=≤<=*t*<=≤<=200) — the number of testsets in the input.
Each of the testsets is given in the following way. The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=200, 0<=≤<=*m*<=≤<=*n*·(*n*<=-<=1)<=/<=2) — the number of cities and the number of roads in Berland.
The next *m* lines contain the description of roads in Berland. Each line contains two integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*) — the cities the corresponding road connects. It's guaranteed that there are no self-loops and multiple roads. It is possible that there is no way along roads between a pair of cities.
It is guaranteed that the total number of cities in all testset of input data doesn't exceed 200.
Pay attention that for hacks, you can only use tests consisting of one testset, so *t* should be equal to one.
|
For each testset print the maximum number of such cities that the number of roads that begins in the city, is equal to the number of roads that ends in it.
In the next *m* lines print oriented roads. First print the number of the city where the road begins and then the number of the city where the road ends. If there are several answers, print any of them. It is allowed to print roads in each test in arbitrary order. Each road should be printed exactly once.
|
[
"2\n5 5\n2 1\n4 5\n2 3\n1 3\n3 5\n7 2\n3 7\n4 2\n"
] |
[
"3\n1 3\n3 5\n5 4\n3 2\n2 1\n3\n2 4\n3 7\n"
] |
none
| 2,500
|
[
{
"input": "2\n5 5\n2 1\n4 5\n2 3\n1 3\n3 5\n7 2\n3 7\n4 2",
"output": "3\n1 3\n3 5\n5 4\n3 2\n2 1\n3\n2 4\n3 7"
},
{
"input": "4\n9 17\n3 6\n2 6\n6 9\n4 1\n2 8\n1 9\n7 9\n8 5\n1 7\n4 9\n6 7\n3 4\n9 3\n8 4\n2 1\n3 8\n2 7\n5 6\n2 5\n3 4\n1 3\n4 5\n5 3\n2 3\n12 8\n10 2\n9 2\n6 9\n10 6\n8 2\n4 10\n11 2\n4 11\n19 10\n6 2\n3 12\n17 7\n2 19\n17 4\n1 13\n7 1\n13 7\n6 8\n11 7",
"output": "7\n1 9\n9 7\n7 6\n6 9\n5 8\n8 4\n4 9\n9 3\n3 8\n8 2\n2 7\n7 1\n1 4\n4 3\n3 6\n6 2\n2 1\n3\n5 4\n4 3\n3 5\n5 2\n2 3\n3 1\n10\n2 11\n11 4\n4 10\n10 6\n6 9\n9 2\n2 10\n8 2\n13\n1 13\n13 7\n7 17\n17 4\n11 7\n7 1\n2 19\n8 6\n6 2\n3 12"
},
{
"input": "1\n200 0",
"output": "200"
},
{
"input": "1\n13 9\n13 12\n3 11\n12 10\n12 9\n2 11\n3 8\n1 3\n2 13\n13 11",
"output": "5\n1 3\n3 11\n11 13\n11 2\n2 13\n13 12\n12 10\n12 9\n8 3"
},
{
"input": "1\n4 6\n1 3\n4 1\n3 2\n1 2\n4 3\n4 2",
"output": "0\n1 4\n4 2\n4 3\n3 1\n3 2\n2 1"
},
{
"input": "1\n6 7\n3 2\n3 1\n6 4\n1 2\n5 4\n3 4\n5 6",
"output": "4\n1 3\n3 4\n4 6\n6 5\n5 4\n3 2\n2 1"
},
{
"input": "1\n5 4\n1 2\n2 3\n2 4\n2 5",
"output": "1\n3 2\n2 5\n4 2\n2 1"
}
] | 1,691,959,363
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
print("_RANDOM_GUESS_1691959363.175796")# 1691959363.1758132
|
Title: One-Way Reform
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities and *m* two-way roads in Berland, each road connects two cities. It is known that there is no more than one road connecting each pair of cities, and there is no road which connects the city with itself. It is possible that there is no way to get from one city to some other city using only these roads.
The road minister decided to make a reform in Berland and to orient all roads in the country, i.e. to make each road one-way. The minister wants to maximize the number of cities, for which the number of roads that begins in the city equals to the number of roads that ends in it.
Input Specification:
The first line contains a positive integer *t* (1<=≤<=*t*<=≤<=200) — the number of testsets in the input.
Each of the testsets is given in the following way. The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=200, 0<=≤<=*m*<=≤<=*n*·(*n*<=-<=1)<=/<=2) — the number of cities and the number of roads in Berland.
The next *m* lines contain the description of roads in Berland. Each line contains two integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*) — the cities the corresponding road connects. It's guaranteed that there are no self-loops and multiple roads. It is possible that there is no way along roads between a pair of cities.
It is guaranteed that the total number of cities in all testset of input data doesn't exceed 200.
Pay attention that for hacks, you can only use tests consisting of one testset, so *t* should be equal to one.
Output Specification:
For each testset print the maximum number of such cities that the number of roads that begins in the city, is equal to the number of roads that ends in it.
In the next *m* lines print oriented roads. First print the number of the city where the road begins and then the number of the city where the road ends. If there are several answers, print any of them. It is allowed to print roads in each test in arbitrary order. Each road should be printed exactly once.
Demo Input:
['2\n5 5\n2 1\n4 5\n2 3\n1 3\n3 5\n7 2\n3 7\n4 2\n']
Demo Output:
['3\n1 3\n3 5\n5 4\n3 2\n2 1\n3\n2 4\n3 7\n']
Note:
none
|
```python
print("_RANDOM_GUESS_1691959363.175796")# 1691959363.1758132
```
| 0
|
|
452
|
A
|
Eevee
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon.
You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.
|
First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string.
Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).
|
Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).
|
[
"7\nj......\n",
"7\n...feon\n",
"7\n.l.r.o.\n"
] |
[
"jolteon\n",
"leafeon\n",
"flareon\n"
] |
Here's a set of names in a form you can paste into your solution:
["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
{"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
| 500
|
[
{
"input": "7\n...feon",
"output": "leafeon"
},
{
"input": "7\n.l.r.o.",
"output": "flareon"
},
{
"input": "6\n.s..o.",
"output": "espeon"
},
{
"input": "7\nglaceon",
"output": "glaceon"
},
{
"input": "8\n.a.o.e.n",
"output": "vaporeon"
},
{
"input": "7\n.laceon",
"output": "glaceon"
},
{
"input": "7\n..lveon",
"output": "sylveon"
},
{
"input": "7\n.l.ceon",
"output": "glaceon"
},
{
"input": "7\n..areon",
"output": "flareon"
}
] | 1,678,971,287
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 62
| 0
|
s=["vaporeon8", "jolteon7", "flareon7", "espeon6", "umbreon7", "leafeon7", "glaceon7", "sylveon7"]
k={8:["vaporeon"],7:["jolteon","flareon","umbreon","leafeon","glaceon","sylveon"],6:["espeon"]}
n=int(input())
l=input()
if n==8:
print(k[8][0])
if n == 6 :
print(k[6][0])
m=dict()
if n ==7:
j=0
for i in l:
if i.islower():
m[j]=i
j+=1
#print(m)
p=list(m.keys())
flag=0
res=""
for i in k[7]:
for j in range(len(p)):
#print(i,m)
if i[p[j]]==m[p[j]]:
flag=1
#print(i,m)
else:
flag=0
break
if flag ==1:
res=i
break
print(res)
|
Title: Eevee
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon.
You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.
Input Specification:
First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string.
Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).
Output Specification:
Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).
Demo Input:
['7\nj......\n', '7\n...feon\n', '7\n.l.r.o.\n']
Demo Output:
['jolteon\n', 'leafeon\n', 'flareon\n']
Note:
Here's a set of names in a form you can paste into your solution:
["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
{"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
|
```python
s=["vaporeon8", "jolteon7", "flareon7", "espeon6", "umbreon7", "leafeon7", "glaceon7", "sylveon7"]
k={8:["vaporeon"],7:["jolteon","flareon","umbreon","leafeon","glaceon","sylveon"],6:["espeon"]}
n=int(input())
l=input()
if n==8:
print(k[8][0])
if n == 6 :
print(k[6][0])
m=dict()
if n ==7:
j=0
for i in l:
if i.islower():
m[j]=i
j+=1
#print(m)
p=list(m.keys())
flag=0
res=""
for i in k[7]:
for j in range(len(p)):
#print(i,m)
if i[p[j]]==m[p[j]]:
flag=1
#print(i,m)
else:
flag=0
break
if flag ==1:
res=i
break
print(res)
```
| 3
|
|
14
|
B
|
Young Photographer
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
B. Young Photographer
|
2
|
64
|
Among other things, Bob is keen on photography. Especially he likes to take pictures of sportsmen. That was the reason why he placed himself in position *x*0 of a long straight racetrack and got ready to take pictures. But the problem was that not all the runners passed him. The total amount of sportsmen, training at that racetrack, equals *n*. And each of them regularly runs distances within a particular segment of the racetrack, which is the same for each sportsman. For example, the first sportsman runs from position *a*1 to position *b*1, the second — from *a*2 to *b*2
What is the minimum distance that Bob should move to have a chance to take pictures of each sportsman? Bob can take a picture of a sportsman, if he stands within the segment that this sportsman covers on the racetrack.
|
The first line of the input file contains integers *n* and *x*0 (1<=≤<=*n*<=≤<=100; 0<=≤<=*x*0<=≤<=1000). The following *n* lines contain pairs of integers *a**i*,<=*b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000; *a**i*<=≠<=*b**i*).
|
Output the required minimum distance in the same units as the positions on the racetrack. If there is no such a position, output -1.
|
[
"3 3\n0 7\n14 2\n4 6\n"
] |
[
"1\n"
] |
none
| 0
|
[
{
"input": "3 3\n0 7\n14 2\n4 6",
"output": "1"
},
{
"input": "1 1\n0 10",
"output": "0"
},
{
"input": "2 2\n1 2\n3 2",
"output": "0"
},
{
"input": "3 2\n1 2\n2 3\n3 4",
"output": "-1"
},
{
"input": "2 4\n10 4\n1 5",
"output": "0"
},
{
"input": "1 10\n1 9",
"output": "1"
},
{
"input": "1 10\n123 12",
"output": "2"
},
{
"input": "1 17\n10 17",
"output": "0"
},
{
"input": "1 22\n22 33",
"output": "0"
},
{
"input": "1 3\n1 2",
"output": "1"
},
{
"input": "2 5\n0 3\n2 1",
"output": "3"
},
{
"input": "3 3\n7 3\n6 4\n3 7",
"output": "1"
},
{
"input": "4 9\n8 6\n11 5\n5 11\n8 3",
"output": "1"
},
{
"input": "2 4\n1 4\n4 0",
"output": "0"
},
{
"input": "3 7\n5 8\n7 5\n4 7",
"output": "0"
},
{
"input": "4 7\n8 2\n5 7\n8 2\n5 8",
"output": "0"
},
{
"input": "2 3\n4 1\n4 1",
"output": "0"
},
{
"input": "3 8\n7 2\n3 7\n5 2",
"output": "3"
},
{
"input": "4 0\n9 1\n8 1\n8 4\n4 5",
"output": "4"
},
{
"input": "4 7\n2 5\n3 6\n3 5\n7 4",
"output": "2"
},
{
"input": "10 16\n4 18\n6 19\n22 1\n23 0\n1 22\n9 22\n4 19\n0 14\n6 14\n0 16",
"output": "2"
},
{
"input": "20 1\n35 8\n40 6\n49 5\n48 18\n46 16\n45 16\n44 10\n16 44\n8 46\n2 45\n38 3\n42 1\n13 35\n35 18\n12 33\n32 11\n31 3\n50 20\n47 6\n38 2",
"output": "19"
},
{
"input": "30 43\n17 72\n75 26\n23 69\n83 30\n15 82\n4 67\n83 27\n33 62\n26 83\n70 26\n69 25\n16 67\n77 26\n66 33\n7 88\n70 9\n10 79\n76 9\n30 77\n77 28\n21 68\n81 14\n13 72\n88 15\n60 29\n87 28\n16 58\n6 58\n71 9\n83 18",
"output": "0"
},
{
"input": "40 69\n29 109\n28 87\n52 106\n101 34\n32 92\n91 60\n90 47\n62 102\n33 72\n27 87\n45 78\n103 37\n94 33\n56 98\n38 79\n31 83\n105 53\n47 89\n50 83\n93 62\n96 49\n47 75\n89 47\n89 61\n93 54\n46 100\n110 41\n103 28\n101 57\n100 62\n71 37\n65 80\n86 28\n73 42\n96 44\n33 111\n98 39\n87 55\n108 65\n31 101",
"output": "0"
},
{
"input": "50 77\n95 55\n113 33\n101 17\n109 56\n117 7\n77 12\n14 84\n57 101\n96 28\n108 22\n105 12\n17 114\n51 115\n18 112\n104 25\n50 115\n14 111\n55 113\n124 20\n101 37\n18 121\n41 90\n77 41\n117 16\n8 83\n92 45\n48 86\n16 84\n13 98\n40 107\n14 94\n23 111\n36 121\n50 100\n35 90\n103 37\n96 51\n109 15\n13 117\n117 42\n112 45\n88 36\n51 121\n127 49\n112 15\n9 95\n122 46\n126 40\n57 93\n56 88",
"output": "0"
},
{
"input": "5 12\n2 7\n7 5\n3 10\n11 3\n2 11",
"output": "5"
},
{
"input": "15 15\n12 37\n40 4\n38 8\n5 36\n11 31\n21 33\n9 37\n4 38\n8 33\n5 39\n7 39\n38 16\n16 41\n38 9\n5 32",
"output": "6"
},
{
"input": "25 40\n66 26\n56 19\n64 38\n64 23\n25 49\n51 26\n67 20\n65 35\n33 66\n28 63\n27 57\n40 56\n59 26\n35 56\n39 67\n30 63\n69 22\n21 63\n67 22\n20 66\n26 65\n64 26\n44 57\n57 41\n35 50",
"output": "4"
},
{
"input": "50 77\n24 119\n43 119\n102 22\n117 30\n127 54\n93 19\n120 9\n118 27\n98 16\n17 105\n22 127\n109 52\n115 40\n11 121\n12 120\n113 30\n13 108\n33 124\n31 116\n112 39\n37 108\n127 28\n127 39\n120 29\n19 114\n103 18\n106 16\n24 121\n93 10\n36 112\n104 40\n39 100\n36 97\n83 9\n14 114\n126 12\n85 47\n25 84\n105 29\n35 113\n102 19\n8 110\n111 28\n94 12\n11 115\n40 124\n39 85\n47 93\n94 31\n17 121",
"output": "0"
},
{
"input": "1 21\n973 373",
"output": "352"
},
{
"input": "2 212\n831 551\n810 753",
"output": "541"
},
{
"input": "3 404\n690 728\n820 260\n186 402",
"output": "-1"
},
{
"input": "4 906\n548 906\n830 457\n228 638\n464 167",
"output": "-1"
},
{
"input": "5 97\n97 393\n840 965\n269 183\n596 49\n975 62",
"output": "-1"
},
{
"input": "3 183\n416 335\n773 648\n434 198",
"output": "-1"
},
{
"input": "3 868\n251 927\n862 464\n157 756",
"output": "112"
},
{
"input": "3 242\n397 208\n951 279\n570 622",
"output": "-1"
},
{
"input": "3 618\n543 800\n38 94\n293 179",
"output": "-1"
},
{
"input": "3 993\n378 81\n127 911\n16 737",
"output": "615"
},
{
"input": "5 12\n11 1\n9 6\n1 11\n3 8\n874 842",
"output": "-1"
},
{
"input": "15 16\n11 40\n5 32\n5 31\n36 10\n34 9\n43 6\n28 6\n34 8\n43 15\n9 28\n14 34\n34 6\n7 31\n31 14\n68 478",
"output": "-1"
},
{
"input": "25 57\n47 31\n64 21\n43 56\n47 19\n70 27\n28 61\n41 61\n39 45\n46 21\n55 35\n70 22\n22 69\n30 67\n55 42\n37 58\n50 28\n57 42\n35 48\n68 40\n38 50\n62 20\n31 52\n38 70\n64 35\n666 393",
"output": "-1"
},
{
"input": "50 118\n83 55\n101 33\n89 17\n97 56\n105 7\n65 12\n14 72\n57 89\n84 28\n96 22\n93 12\n17 102\n51 103\n18 100\n92 25\n50 103\n14 99\n55 101\n112 20\n89 37\n18 109\n41 78\n65 41\n105 16\n8 71\n80 45\n48 74\n16 72\n13 86\n40 95\n14 82\n23 99\n36 109\n50 88\n35 78\n91 37\n84 51\n97 15\n13 105\n105 42\n100 45\n76 36\n51 109\n115 49\n100 15\n9 83\n110 46\n114 40\n57 81\n528 348",
"output": "-1"
},
{
"input": "1 21\n0 1000",
"output": "0"
}
] | 1,680,222,761
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 124
| 0
|
n, x = map(int, input().split())
min_right = float('inf')
max_left = float('-inf')
for _ in range(n):
l, r = map(int, input().split())
min_right = min(min_right, max(l, r))
max_left = max(max_left, min(l, r))
if max_left > min_right:
print(-1)
else:
if x < max_left:
print(max_left - x)
elif x > min_right:
print(x - min_right)
else:
print(0)
|
Title: Young Photographer
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Among other things, Bob is keen on photography. Especially he likes to take pictures of sportsmen. That was the reason why he placed himself in position *x*0 of a long straight racetrack and got ready to take pictures. But the problem was that not all the runners passed him. The total amount of sportsmen, training at that racetrack, equals *n*. And each of them regularly runs distances within a particular segment of the racetrack, which is the same for each sportsman. For example, the first sportsman runs from position *a*1 to position *b*1, the second — from *a*2 to *b*2
What is the minimum distance that Bob should move to have a chance to take pictures of each sportsman? Bob can take a picture of a sportsman, if he stands within the segment that this sportsman covers on the racetrack.
Input Specification:
The first line of the input file contains integers *n* and *x*0 (1<=≤<=*n*<=≤<=100; 0<=≤<=*x*0<=≤<=1000). The following *n* lines contain pairs of integers *a**i*,<=*b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000; *a**i*<=≠<=*b**i*).
Output Specification:
Output the required minimum distance in the same units as the positions on the racetrack. If there is no such a position, output -1.
Demo Input:
['3 3\n0 7\n14 2\n4 6\n']
Demo Output:
['1\n']
Note:
none
|
```python
n, x = map(int, input().split())
min_right = float('inf')
max_left = float('-inf')
for _ in range(n):
l, r = map(int, input().split())
min_right = min(min_right, max(l, r))
max_left = max(max_left, min(l, r))
if max_left > min_right:
print(-1)
else:
if x < max_left:
print(max_left - x)
elif x > min_right:
print(x - min_right)
else:
print(0)
```
| 3.969
|
260
|
B
|
Ancient Prophesy
|
PROGRAMMING
| 1,600
|
[
"brute force",
"implementation",
"strings"
] | null | null |
A recently found Ancient Prophesy is believed to contain the exact Apocalypse date. The prophesy is a string that only consists of digits and characters "-".
We'll say that some date is mentioned in the Prophesy if there is a substring in the Prophesy that is the date's record in the format "dd-mm-yyyy". We'll say that the number of the date's occurrences is the number of such substrings in the Prophesy. For example, the Prophesy "0012-10-2012-10-2012" mentions date 12-10-2012 twice (first time as "0012-10-2012-10-2012", second time as "0012-10-2012-10-2012").
The date of the Apocalypse is such correct date that the number of times it is mentioned in the Prophesy is strictly larger than that of any other correct date.
A date is correct if the year lies in the range from 2013 to 2015, the month is from 1 to 12, and the number of the day is strictly more than a zero and doesn't exceed the number of days in the current month. Note that a date is written in the format "dd-mm-yyyy", that means that leading zeroes may be added to the numbers of the months or days if needed. In other words, date "1-1-2013" isn't recorded in the format "dd-mm-yyyy", and date "01-01-2013" is recorded in it.
Notice, that any year between 2013 and 2015 is not a leap year.
|
The first line contains the Prophesy: a non-empty string that only consists of digits and characters "-". The length of the Prophesy doesn't exceed 105 characters.
|
In a single line print the date of the Apocalypse. It is guaranteed that such date exists and is unique.
|
[
"777-444---21-12-2013-12-2013-12-2013---444-777\n"
] |
[
"13-12-2013"
] |
none
| 1,000
|
[
{
"input": "777-444---21-12-2013-12-2013-12-2013---444-777",
"output": "13-12-2013"
},
{
"input": "30-12-201429-15-208830-12-2014",
"output": "30-12-2014"
},
{
"input": "14-08-201314-08-201314-08-201381-16-20172406414-08-201314-08-201314-08-20134237014-08-201314-08-2013",
"output": "14-08-2013"
},
{
"input": "15-11-201413-02-20147-86-25-298813-02-201413-02-201434615-11-201415-11-201415-11-201415-11-2014",
"output": "15-11-2014"
},
{
"input": "19-07-201419-07-201424-06-201719-07-201419-07-201413-10-201419-07-201468-01-201619-07-20142",
"output": "19-07-2014"
},
{
"input": "01-04-201425-08-201386-04-201525-10-2014878-04-20102-06-201501-04-2014-08-20159533-45-00-1212",
"output": "01-04-2014"
},
{
"input": "23-11-201413-07-201412-06-2015124-03-20140-19-201323-11-201424-03-2014537523-11-20143575015-10-2014",
"output": "23-11-2014"
},
{
"input": "15-04-201413-08-201589-09-201013-08-20130-74-28-201620-8497-14-1063713-08-2013813-02-201513-08-2013",
"output": "13-08-2013"
},
{
"input": "13-05-201412-11-2013-12-11-201314-12-201329-05-201306-24-188814-07-201312-11-201312-04-2010",
"output": "12-11-2013"
},
{
"input": "14-01-201402-04-201514-01-201485-26-1443948-14-278314-01-2014615259-09-178413-06-201314-05-2014",
"output": "14-01-2014"
},
{
"input": "31-12-201331-11-201331-11-2013",
"output": "31-12-2013"
},
{
"input": "01-01-2014",
"output": "01-01-2014"
},
{
"input": "32-13-2100-32-13-2100-32-13-2100-12-12-2013",
"output": "12-12-2013"
},
{
"input": "15-1--201315-1--201301-01-2013",
"output": "01-01-2013"
},
{
"input": "00-12-2014-00-12-2014-00-12-2014-12-12-2014",
"output": "12-12-2014"
},
{
"input": "120110201311-10-20151201102013",
"output": "11-10-2015"
},
{
"input": "31-08-2013---31-08-2013---03-03-2013",
"output": "31-08-2013"
},
{
"input": "12-12-201312-12-201312-12-201313--12-201313--12-201313--12-201313--12-201313--12-201313--12-201313--12-201313--12-2013",
"output": "12-12-2013"
},
{
"input": "21-12-201221-12-201221-12-201221-12-201213-12-2013",
"output": "13-12-2013"
},
{
"input": "29-02-2013-02-2013-29-02-2013",
"output": "13-02-2013"
},
{
"input": "20-12-2012----20-12-2012-----01-01-2013",
"output": "01-01-2013"
},
{
"input": "01-2-02013---01-2-02013----13-02-2014",
"output": "13-02-2014"
},
{
"input": "11111111111111111111---21-12-2013",
"output": "21-12-2013"
},
{
"input": "29-02-2014--29-02-2014--28-02-2014",
"output": "28-02-2014"
},
{
"input": "29-02-201329-02-201321-12-2013",
"output": "21-12-2013"
},
{
"input": "01--01--2013-12-2013-01--01--2013",
"output": "13-12-2013"
},
{
"input": "10-10-2023-10-10-2023-10-10-2013",
"output": "10-10-2013"
}
] | 1,629,542,479
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 39
| 280
| 30,412,800
|
import sys
from functools import lru_cache, cmp_to_key
from heapq import merge, heapify, heappop, heappush
from math import *
from collections import defaultdict as dd, deque, Counter as C
from itertools import combinations as comb, permutations as perm
from bisect import bisect_left as bl, bisect_right as br, bisect, insort
from time import perf_counter
from fractions import Fraction
import copy
from copy import deepcopy
import time
starttime = time.time()
mod = int(pow(10, 9) + 7)
mod2 = 998244353
def data(): return sys.stdin.readline().strip()
def out(*var, end="\n"): sys.stdout.write(' '.join(map(str, var))+end)
def L(): return list(sp())
def sl(): return list(ssp())
def sp(): return map(int, data().split())
def ssp(): return map(str, data().split())
def l1d(n, val=0): return [val for i in range(n)]
def l2d(n, m, val=0): return [l1d(n, val) for j in range(m)]
try:
# sys.setrecursionlimit(int(pow(10,6)))
sys.stdin = open("input.txt", "r")
# sys.stdout = open("output.txt", "w")
except:
pass
def pmat(A):
for ele in A: print(*ele,end="\n")
from collections import Counter
numbers = '0123456789'
days = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
def check(s):
if s[2] != '-' or s[5] != '-':
return False
if any(c not in numbers for (i, c) in enumerate(s) if i != 2 and i != 5):
return False
d = int(s[:2])
m = int(s[3:5])
y = int(s[6:])
if y < 2013 or y > 2015:
return False
if m == 0 or m > 12:
return False
return d != 0 and d <= days[m - 1]
s = input()
print(Counter(s[i:i+10] for i in range(len(s) - 9) if check(s[i:i+10])).most_common(1)[0][0])
|
Title: Ancient Prophesy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A recently found Ancient Prophesy is believed to contain the exact Apocalypse date. The prophesy is a string that only consists of digits and characters "-".
We'll say that some date is mentioned in the Prophesy if there is a substring in the Prophesy that is the date's record in the format "dd-mm-yyyy". We'll say that the number of the date's occurrences is the number of such substrings in the Prophesy. For example, the Prophesy "0012-10-2012-10-2012" mentions date 12-10-2012 twice (first time as "0012-10-2012-10-2012", second time as "0012-10-2012-10-2012").
The date of the Apocalypse is such correct date that the number of times it is mentioned in the Prophesy is strictly larger than that of any other correct date.
A date is correct if the year lies in the range from 2013 to 2015, the month is from 1 to 12, and the number of the day is strictly more than a zero and doesn't exceed the number of days in the current month. Note that a date is written in the format "dd-mm-yyyy", that means that leading zeroes may be added to the numbers of the months or days if needed. In other words, date "1-1-2013" isn't recorded in the format "dd-mm-yyyy", and date "01-01-2013" is recorded in it.
Notice, that any year between 2013 and 2015 is not a leap year.
Input Specification:
The first line contains the Prophesy: a non-empty string that only consists of digits and characters "-". The length of the Prophesy doesn't exceed 105 characters.
Output Specification:
In a single line print the date of the Apocalypse. It is guaranteed that such date exists and is unique.
Demo Input:
['777-444---21-12-2013-12-2013-12-2013---444-777\n']
Demo Output:
['13-12-2013']
Note:
none
|
```python
import sys
from functools import lru_cache, cmp_to_key
from heapq import merge, heapify, heappop, heappush
from math import *
from collections import defaultdict as dd, deque, Counter as C
from itertools import combinations as comb, permutations as perm
from bisect import bisect_left as bl, bisect_right as br, bisect, insort
from time import perf_counter
from fractions import Fraction
import copy
from copy import deepcopy
import time
starttime = time.time()
mod = int(pow(10, 9) + 7)
mod2 = 998244353
def data(): return sys.stdin.readline().strip()
def out(*var, end="\n"): sys.stdout.write(' '.join(map(str, var))+end)
def L(): return list(sp())
def sl(): return list(ssp())
def sp(): return map(int, data().split())
def ssp(): return map(str, data().split())
def l1d(n, val=0): return [val for i in range(n)]
def l2d(n, m, val=0): return [l1d(n, val) for j in range(m)]
try:
# sys.setrecursionlimit(int(pow(10,6)))
sys.stdin = open("input.txt", "r")
# sys.stdout = open("output.txt", "w")
except:
pass
def pmat(A):
for ele in A: print(*ele,end="\n")
from collections import Counter
numbers = '0123456789'
days = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
def check(s):
if s[2] != '-' or s[5] != '-':
return False
if any(c not in numbers for (i, c) in enumerate(s) if i != 2 and i != 5):
return False
d = int(s[:2])
m = int(s[3:5])
y = int(s[6:])
if y < 2013 or y > 2015:
return False
if m == 0 or m > 12:
return False
return d != 0 and d <= days[m - 1]
s = input()
print(Counter(s[i:i+10] for i in range(len(s) - 9) if check(s[i:i+10])).most_common(1)[0][0])
```
| 3
|
|
755
|
A
|
PolandBall and Hypothesis
|
PROGRAMMING
| 800
|
[
"brute force",
"graphs",
"math",
"number theory"
] | null | null |
PolandBall is a young, clever Ball. He is interested in prime numbers. He has stated a following hypothesis: "There exists such a positive integer *n* that for each positive integer *m* number *n*·*m*<=+<=1 is a prime number".
Unfortunately, PolandBall is not experienced yet and doesn't know that his hypothesis is incorrect. Could you prove it wrong? Write a program that finds a counterexample for any *n*.
|
The only number in the input is *n* (1<=≤<=*n*<=≤<=1000) — number from the PolandBall's hypothesis.
|
Output such *m* that *n*·*m*<=+<=1 is not a prime number. Your answer will be considered correct if you output any suitable *m* such that 1<=≤<=*m*<=≤<=103. It is guaranteed the the answer exists.
|
[
"3\n",
"4\n"
] |
[
"1",
"2"
] |
A prime number (or a prime) is a natural number greater than 1 that has no positive divisors other than 1 and itself.
For the first sample testcase, 3·1 + 1 = 4. We can output 1.
In the second sample testcase, 4·1 + 1 = 5. We cannot output 1 because 5 is prime. However, *m* = 2 is okay since 4·2 + 1 = 9, which is not a prime number.
| 500
|
[
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "2"
},
{
"input": "10",
"output": "2"
},
{
"input": "153",
"output": "1"
},
{
"input": "1000",
"output": "1"
},
{
"input": "1",
"output": "3"
},
{
"input": "2",
"output": "4"
},
{
"input": "5",
"output": "1"
},
{
"input": "6",
"output": "4"
},
{
"input": "7",
"output": "1"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "1"
},
{
"input": "11",
"output": "1"
},
{
"input": "998",
"output": "1"
},
{
"input": "996",
"output": "3"
},
{
"input": "36",
"output": "4"
},
{
"input": "210",
"output": "4"
},
{
"input": "270",
"output": "4"
},
{
"input": "306",
"output": "4"
},
{
"input": "330",
"output": "5"
},
{
"input": "336",
"output": "4"
},
{
"input": "600",
"output": "4"
},
{
"input": "726",
"output": "4"
},
{
"input": "988",
"output": "1"
},
{
"input": "12",
"output": "2"
},
{
"input": "987",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "986",
"output": "1"
},
{
"input": "14",
"output": "1"
},
{
"input": "985",
"output": "1"
},
{
"input": "15",
"output": "1"
},
{
"input": "984",
"output": "1"
},
{
"input": "16",
"output": "2"
},
{
"input": "983",
"output": "1"
},
{
"input": "17",
"output": "1"
},
{
"input": "982",
"output": "2"
},
{
"input": "18",
"output": "3"
},
{
"input": "981",
"output": "1"
},
{
"input": "19",
"output": "1"
},
{
"input": "980",
"output": "1"
},
{
"input": "20",
"output": "1"
},
{
"input": "979",
"output": "1"
},
{
"input": "21",
"output": "1"
},
{
"input": "978",
"output": "1"
},
{
"input": "22",
"output": "2"
},
{
"input": "977",
"output": "1"
},
{
"input": "23",
"output": "1"
},
{
"input": "976",
"output": "2"
},
{
"input": "24",
"output": "1"
},
{
"input": "975",
"output": "1"
},
{
"input": "25",
"output": "1"
},
{
"input": "2",
"output": "4"
},
{
"input": "6",
"output": "4"
},
{
"input": "996",
"output": "3"
},
{
"input": "8",
"output": "1"
},
{
"input": "998",
"output": "1"
},
{
"input": "330",
"output": "5"
},
{
"input": "18",
"output": "3"
},
{
"input": "12",
"output": "2"
},
{
"input": "24",
"output": "1"
},
{
"input": "999",
"output": "1"
},
{
"input": "726",
"output": "4"
},
{
"input": "876",
"output": "3"
}
] | 1,611,203,054
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 1
| 2,000
| 0
|
def is_prime(n):
if n in (2,3):
return True
elif n%2==0 or n%3==0:
return False
else:
i=5
while i*i<=n:
if n%i == 0 or n%(i+2)==0:
return False
i+=6
return True
n=int(input())
m=1
while True:
if not is_prime(n*m+1):
print(m)
break
|
Title: PolandBall and Hypothesis
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
PolandBall is a young, clever Ball. He is interested in prime numbers. He has stated a following hypothesis: "There exists such a positive integer *n* that for each positive integer *m* number *n*·*m*<=+<=1 is a prime number".
Unfortunately, PolandBall is not experienced yet and doesn't know that his hypothesis is incorrect. Could you prove it wrong? Write a program that finds a counterexample for any *n*.
Input Specification:
The only number in the input is *n* (1<=≤<=*n*<=≤<=1000) — number from the PolandBall's hypothesis.
Output Specification:
Output such *m* that *n*·*m*<=+<=1 is not a prime number. Your answer will be considered correct if you output any suitable *m* such that 1<=≤<=*m*<=≤<=103. It is guaranteed the the answer exists.
Demo Input:
['3\n', '4\n']
Demo Output:
['1', '2']
Note:
A prime number (or a prime) is a natural number greater than 1 that has no positive divisors other than 1 and itself.
For the first sample testcase, 3·1 + 1 = 4. We can output 1.
In the second sample testcase, 4·1 + 1 = 5. We cannot output 1 because 5 is prime. However, *m* = 2 is okay since 4·2 + 1 = 9, which is not a prime number.
|
```python
def is_prime(n):
if n in (2,3):
return True
elif n%2==0 or n%3==0:
return False
else:
i=5
while i*i<=n:
if n%i == 0 or n%(i+2)==0:
return False
i+=6
return True
n=int(input())
m=1
while True:
if not is_prime(n*m+1):
print(m)
break
```
| 0
|
|
399
|
B
|
Red and Blue Balls
|
PROGRAMMING
| 0
|
[] | null | null |
User ainta has a stack of *n* red and blue balls. He can apply a certain operation which changes the colors of the balls inside the stack.
- While the top ball inside the stack is red, pop the ball from the top of the stack. - Then replace the blue ball on the top with a red ball. - And finally push some blue balls to the stack until the stack has total of *n* balls inside.
If there are no blue balls inside the stack, ainta can't apply this operation. Given the initial state of the stack, ainta wants to know the maximum number of operations he can repeatedly apply.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=50) — the number of balls inside the stack.
The second line contains a string *s* (|*s*|<==<=*n*) describing the initial state of the stack. The *i*-th character of the string *s* denotes the color of the *i*-th ball (we'll number the balls from top to bottom of the stack). If the character is "R", the color is red. If the character is "B", the color is blue.
|
Print the maximum number of operations ainta can repeatedly apply.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"3\nRBR\n",
"4\nRBBR\n",
"5\nRBBRR\n"
] |
[
"2\n",
"6\n",
"6\n"
] |
The first example is depicted below.
The explanation how user ainta applies the first operation. He pops out one red ball, changes the color of the ball in the middle from blue to red, and pushes one blue ball.
The explanation how user ainta applies the second operation. He will not pop out red balls, he simply changes the color of the ball on the top from blue to red.
From now on, ainta can't apply any operation because there are no blue balls inside the stack. ainta applied two operations, so the answer is 2.
The second example is depicted below. The blue arrow denotes a single operation.
| 1,000
|
[
{
"input": "3\nRBR",
"output": "2"
},
{
"input": "4\nRBBR",
"output": "6"
},
{
"input": "5\nRBBRR",
"output": "6"
},
{
"input": "5\nRBRBR",
"output": "10"
},
{
"input": "10\nRRBRRBBRRR",
"output": "100"
},
{
"input": "10\nBRBRRRRRRR",
"output": "5"
},
{
"input": "10\nBRRRRRRRRR",
"output": "1"
},
{
"input": "20\nBRBRRRRRRRRRRRRRRRRR",
"output": "5"
},
{
"input": "30\nRRBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1073741820"
},
{
"input": "50\nBRRRBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1125899906842609"
},
{
"input": "20\nRRRBRBBBBBRRRRRRRRRR",
"output": "1000"
},
{
"input": "20\nRRBRBBBBBRRRRRRRRRRR",
"output": "500"
},
{
"input": "1\nR",
"output": "0"
},
{
"input": "1\nB",
"output": "1"
},
{
"input": "2\nRR",
"output": "0"
},
{
"input": "2\nBR",
"output": "1"
},
{
"input": "50\nRRRRRRRRRRBBBBBBRRBBRRRBRRBBBRRRRRRRRRRRRRRRRRRRRR",
"output": "479001600"
},
{
"input": "50\nRBRRRRRBRBRRBBBBBBRRRBRRRRRBBBRRBRRRRRBBBRRRRRRRRR",
"output": "1929382195842"
},
{
"input": "48\nRBRBRRRRBRBRRBRRRRRRRBBBRRBRBRRRBBRRRRRRRRRRRRRR",
"output": "13235135754"
},
{
"input": "30\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "0"
},
{
"input": "50\nRRBBBBBBBBBBBBBBBBRBRRBBBRBBRBBBRRBRBBBBBRBBRBBRBR",
"output": "402373705727996"
},
{
"input": "50\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "1125899906842623"
},
{
"input": "19\nRRRRRBRRBRRRRBRBBBB",
"output": "500000"
},
{
"input": "32\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBR",
"output": "2147483647"
},
{
"input": "3\nBBB",
"output": "7"
},
{
"input": "3\nBBR",
"output": "3"
},
{
"input": "3\nBRB",
"output": "5"
},
{
"input": "3\nBRR",
"output": "1"
},
{
"input": "3\nRBB",
"output": "6"
},
{
"input": "3\nRBR",
"output": "2"
},
{
"input": "3\nRRB",
"output": "4"
},
{
"input": "3\nRRR",
"output": "0"
},
{
"input": "2\nRB",
"output": "2"
},
{
"input": "2\nBB",
"output": "3"
}
] | 1,583,743,813
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 500
| 3,481,600
|
def remove_top_reds(stack):
if len(stack) < 1:
return stack
while len(stack) and stack[-1] == 'R':
stack = stack[:-1]
return stack
def change_top_blue(stack):
if len(stack) > 0 and stack[-1] == 'B':
stack[-1] = 'R'
return stack
def fill_with_blues(stack, size):
while len(stack) < size:
stack.append('B')
return stack
def check_if_done(stack):
return all(['R' == i for i in stack])
size = int(input())
stack = list(input().strip())[::-1]
cnt = 0
while not check_if_done(stack):
stack = remove_top_reds(stack)
stack = change_top_blue(stack)
stack = fill_with_blues(stack, size)
cnt += 1
print(cnt)
|
Title: Red and Blue Balls
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
User ainta has a stack of *n* red and blue balls. He can apply a certain operation which changes the colors of the balls inside the stack.
- While the top ball inside the stack is red, pop the ball from the top of the stack. - Then replace the blue ball on the top with a red ball. - And finally push some blue balls to the stack until the stack has total of *n* balls inside.
If there are no blue balls inside the stack, ainta can't apply this operation. Given the initial state of the stack, ainta wants to know the maximum number of operations he can repeatedly apply.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=50) — the number of balls inside the stack.
The second line contains a string *s* (|*s*|<==<=*n*) describing the initial state of the stack. The *i*-th character of the string *s* denotes the color of the *i*-th ball (we'll number the balls from top to bottom of the stack). If the character is "R", the color is red. If the character is "B", the color is blue.
Output Specification:
Print the maximum number of operations ainta can repeatedly apply.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['3\nRBR\n', '4\nRBBR\n', '5\nRBBRR\n']
Demo Output:
['2\n', '6\n', '6\n']
Note:
The first example is depicted below.
The explanation how user ainta applies the first operation. He pops out one red ball, changes the color of the ball in the middle from blue to red, and pushes one blue ball.
The explanation how user ainta applies the second operation. He will not pop out red balls, he simply changes the color of the ball on the top from blue to red.
From now on, ainta can't apply any operation because there are no blue balls inside the stack. ainta applied two operations, so the answer is 2.
The second example is depicted below. The blue arrow denotes a single operation.
|
```python
def remove_top_reds(stack):
if len(stack) < 1:
return stack
while len(stack) and stack[-1] == 'R':
stack = stack[:-1]
return stack
def change_top_blue(stack):
if len(stack) > 0 and stack[-1] == 'B':
stack[-1] = 'R'
return stack
def fill_with_blues(stack, size):
while len(stack) < size:
stack.append('B')
return stack
def check_if_done(stack):
return all(['R' == i for i in stack])
size = int(input())
stack = list(input().strip())[::-1]
cnt = 0
while not check_if_done(stack):
stack = remove_top_reds(stack)
stack = change_top_blue(stack)
stack = fill_with_blues(stack, size)
cnt += 1
print(cnt)
```
| 0
|
|
479
|
A
|
Expression
|
PROGRAMMING
| 1,000
|
[
"brute force",
"math"
] | null | null |
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
|
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
|
Print the maximum value of the expression that you can obtain.
|
[
"1\n2\n3\n",
"2\n10\n3\n"
] |
[
"9\n",
"60\n"
] |
none
| 500
|
[
{
"input": "1\n2\n3",
"output": "9"
},
{
"input": "2\n10\n3",
"output": "60"
},
{
"input": "1\n1\n1",
"output": "3"
},
{
"input": "1\n2\n1",
"output": "4"
},
{
"input": "10\n10\n10",
"output": "1000"
},
{
"input": "5\n1\n3",
"output": "20"
},
{
"input": "3\n1\n5",
"output": "20"
},
{
"input": "6\n7\n1",
"output": "48"
},
{
"input": "1\n8\n3",
"output": "27"
},
{
"input": "9\n7\n2",
"output": "126"
},
{
"input": "1\n1\n10",
"output": "20"
},
{
"input": "9\n1\n1",
"output": "18"
},
{
"input": "10\n5\n6",
"output": "300"
},
{
"input": "8\n9\n7",
"output": "504"
},
{
"input": "4\n2\n10",
"output": "80"
},
{
"input": "2\n8\n3",
"output": "48"
},
{
"input": "3\n5\n7",
"output": "105"
},
{
"input": "1\n10\n1",
"output": "12"
},
{
"input": "2\n2\n2",
"output": "8"
},
{
"input": "5\n6\n1",
"output": "35"
},
{
"input": "10\n1\n1",
"output": "20"
},
{
"input": "1\n6\n1",
"output": "8"
},
{
"input": "1\n9\n1",
"output": "11"
},
{
"input": "2\n1\n2",
"output": "6"
},
{
"input": "2\n6\n1",
"output": "14"
},
{
"input": "9\n2\n1",
"output": "27"
},
{
"input": "1\n9\n2",
"output": "20"
},
{
"input": "1\n3\n1",
"output": "5"
},
{
"input": "2\n1\n1",
"output": "4"
}
] | 1,696,959,359
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 0
|
# Read input
a = int(input())
b = int(input())
c = int(input())
# Initialize the maximum value to a*b*c (no operations)
max_value = a * b * c
# a*(b+c)
temp = a * (b + c)
if temp > max_value:
max_value = temp
temp = (a + b) * c
if temp > max_value:
max_value = temp
temp = a + b * c
if temp > max_value:
max_value = temp
temp = a * b + c
if temp > max_value:
max_value = temp
print(max_value)
|
Title: Expression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
Input Specification:
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
Output Specification:
Print the maximum value of the expression that you can obtain.
Demo Input:
['1\n2\n3\n', '2\n10\n3\n']
Demo Output:
['9\n', '60\n']
Note:
none
|
```python
# Read input
a = int(input())
b = int(input())
c = int(input())
# Initialize the maximum value to a*b*c (no operations)
max_value = a * b * c
# a*(b+c)
temp = a * (b + c)
if temp > max_value:
max_value = temp
temp = (a + b) * c
if temp > max_value:
max_value = temp
temp = a + b * c
if temp > max_value:
max_value = temp
temp = a * b + c
if temp > max_value:
max_value = temp
print(max_value)
```
| 0
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,601,393,425
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 218
| 0
|
n = int(input())
sx,sy,sz=0,0,0
for i in range(n):
x,y,z= [int(i) for i in input().split()]
sx= sx+x
sy= sy+y
sz= sz+z
if sx==0 and sy==0 and sz==0:
print("YES")
else:
print('NO')
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n = int(input())
sx,sy,sz=0,0,0
for i in range(n):
x,y,z= [int(i) for i in input().split()]
sx= sx+x
sy= sy+y
sz= sz+z
if sx==0 and sy==0 and sz==0:
print("YES")
else:
print('NO')
```
| 3.9455
|
939
|
A
|
Love Triangle
|
PROGRAMMING
| 800
|
[
"graphs"
] | null | null |
As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*.
We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes.
The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th.
|
Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO».
You can output any letter in lower case or in upper case.
|
[
"5\n2 4 5 1 3\n",
"5\n5 5 5 5 1\n"
] |
[
"YES\n",
"NO\n"
] |
In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle.
In second example there are no love triangles.
| 500
|
[
{
"input": "5\n2 4 5 1 3",
"output": "YES"
},
{
"input": "5\n5 5 5 5 1",
"output": "NO"
},
{
"input": "3\n3 1 2",
"output": "YES"
},
{
"input": "10\n4 10 9 5 3 1 5 10 6 4",
"output": "NO"
},
{
"input": "10\n5 5 4 9 10 9 9 5 3 1",
"output": "YES"
},
{
"input": "100\n50 40 60 87 39 58 44 84 46 68 16 57 77 87 92 95 42 31 74 15 36 84 30 3 47 15 87 90 76 66 6 63 74 19 40 49 6 84 41 9 77 34 7 12 11 73 58 24 81 14 81 29 65 100 1 85 64 32 38 4 54 67 32 81 80 7 100 71 29 80 4 52 47 7 78 56 52 75 81 37 16 41 27 28 58 60 62 47 29 40 37 14 59 91 12 54 25 58 12 43",
"output": "NO"
},
{
"input": "100\n25 6 46 37 87 99 70 31 46 12 94 40 87 56 28 8 94 39 13 12 67 13 71 39 83 48 40 14 62 41 16 71 20 41 83 41 68 98 23 82 62 83 62 35 49 22 31 21 66 98 54 39 34 52 11 28 47 89 25 44 68 36 91 46 82 86 88 48 27 93 7 9 53 36 16 100 84 84 44 25 58 66 16 46 72 21 91 78 4 17 44 17 47 67 93 89 75 44 56 50",
"output": "YES"
},
{
"input": "2\n2 1",
"output": "NO"
},
{
"input": "3\n2 3 1",
"output": "YES"
},
{
"input": "5\n2 1 4 5 3",
"output": "YES"
},
{
"input": "5\n5 4 5 5 2",
"output": "YES"
}
] | 1,681,442,921
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
n=int(input())
l=list(map(int,input().split()))
test=False
for i in range(n-2):
for j in range(1,n-1):
for k in range(2,n):
if l[i]+1==l[j] and l[j+1]==l[k]:
test=True
break
if test:break
if test:break
if test:print('YES')
else: print('NO')
|
Title: Love Triangle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*.
We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes.
The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th.
Output Specification:
Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO».
You can output any letter in lower case or in upper case.
Demo Input:
['5\n2 4 5 1 3\n', '5\n5 5 5 5 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle.
In second example there are no love triangles.
|
```python
n=int(input())
l=list(map(int,input().split()))
test=False
for i in range(n-2):
for j in range(1,n-1):
for k in range(2,n):
if l[i]+1==l[j] and l[j+1]==l[k]:
test=True
break
if test:break
if test:break
if test:print('YES')
else: print('NO')
```
| 0
|
|
109
|
A
|
Lucky Sum of Digits
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] |
A. Lucky Sum of Digits
|
2
|
256
|
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
|
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
|
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
|
[
"11\n",
"10\n"
] |
[
"47\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "11",
"output": "47"
},
{
"input": "10",
"output": "-1"
},
{
"input": "64",
"output": "4477777777"
},
{
"input": "1",
"output": "-1"
},
{
"input": "4",
"output": "4"
},
{
"input": "7",
"output": "7"
},
{
"input": "12",
"output": "444"
},
{
"input": "1000000",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "47",
"output": "44477777"
},
{
"input": "100",
"output": "4444777777777777"
},
{
"input": "700",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "485",
"output": "44447777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "111",
"output": "444447777777777777"
},
{
"input": "85",
"output": "4477777777777"
},
{
"input": "114",
"output": "444477777777777777"
},
{
"input": "474",
"output": "444777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "74",
"output": "47777777777"
},
{
"input": "1000",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "1024",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "4444",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "45784",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10000",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9854",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "186",
"output": "477777777777777777777777777"
},
{
"input": "10416",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10417",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "3840",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "100000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9876",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "99999",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "777777",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "854759",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "11000",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "18951",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999999",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "888887",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999998",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "40008",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10691",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "-1"
},
{
"input": "9",
"output": "-1"
},
{
"input": "8",
"output": "44"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "-1"
},
{
"input": "999997",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999996",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999990",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999980",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "800000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "980000",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
}
] | 1,655,792,486
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 60
| 0
|
n = int(input())
for i in range(n):
x = (n - i*7)/4
if x < 0:
print(-1)
break
elif x == int(x):
val = int(x)*'4' + i*'7'
print(int(val))
break
|
Title: Lucky Sum of Digits
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
Output Specification:
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
Demo Input:
['11\n', '10\n']
Demo Output:
['47\n', '-1\n']
Note:
none
|
```python
n = int(input())
for i in range(n):
x = (n - i*7)/4
if x < 0:
print(-1)
break
elif x == int(x):
val = int(x)*'4' + i*'7'
print(int(val))
break
```
| 0
|
624
|
B
|
Making a String
|
PROGRAMMING
| 1,100
|
[
"greedy",
"sortings"
] | null | null |
You are given an alphabet consisting of *n* letters, your task is to make a string of the maximum possible length so that the following conditions are satisfied:
- the *i*-th letter occurs in the string no more than *a**i* times; - the number of occurrences of each letter in the string must be distinct for all the letters that occurred in the string at least once.
|
The first line of the input contains a single integer *n* (2<=<=≤<=<=*n*<=<=≤<=<=26) — the number of letters in the alphabet.
The next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — *i*-th of these integers gives the limitation on the number of occurrences of the *i*-th character in the string.
|
Print a single integer — the maximum length of the string that meets all the requirements.
|
[
"3\n2 5 5\n",
"3\n1 1 2\n"
] |
[
"11\n",
"3\n"
] |
For convenience let's consider an alphabet consisting of three letters: "a", "b", "c". In the first sample, some of the optimal strings are: "cccaabbccbb", "aabcbcbcbcb". In the second sample some of the optimal strings are: "acc", "cbc".
| 1,000
|
[
{
"input": "3\n2 5 5",
"output": "11"
},
{
"input": "3\n1 1 2",
"output": "3"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "3\n1 1000000000 2",
"output": "1000000003"
},
{
"input": "26\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "25999999675"
},
{
"input": "2\n559476582 796461544",
"output": "1355938126"
},
{
"input": "2\n257775227 621811272",
"output": "879586499"
},
{
"input": "10\n876938317 219479349 703839299 977218449 116819315 752405530 393874852 286326991 592978634 155758306",
"output": "5075639042"
},
{
"input": "26\n72 49 87 47 94 96 36 91 43 11 19 83 36 38 10 93 95 81 4 96 60 38 97 37 36 41",
"output": "1478"
},
{
"input": "26\n243 364 768 766 633 535 502 424 502 283 592 877 137 891 837 990 681 898 831 487 595 604 747 856 805 688",
"output": "16535"
},
{
"input": "26\n775 517 406 364 548 951 680 984 466 141 960 513 660 849 152 250 176 601 199 370 971 554 141 224 724 543",
"output": "13718"
},
{
"input": "26\n475 344 706 807 925 813 974 166 578 226 624 591 419 894 574 909 544 597 170 990 893 785 399 172 792 748",
"output": "16115"
},
{
"input": "26\n130 396 985 226 487 671 188 706 106 649 38 525 210 133 298 418 953 431 577 69 12 982 264 373 283 266",
"output": "10376"
},
{
"input": "26\n605 641 814 935 936 547 524 702 133 674 173 102 318 620 248 523 77 718 318 635 322 362 306 86 8 442",
"output": "11768"
},
{
"input": "26\n220 675 725 888 725 654 546 806 379 182 604 667 734 394 889 731 572 193 850 651 844 734 163 671 820 887",
"output": "16202"
},
{
"input": "26\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "25675"
},
{
"input": "26\n1001 1001 1000 1000 1001 1000 1001 1001 1001 1000 1000 1001 1001 1000 1000 1000 1000 1001 1000 1001 1001 1000 1001 1001 1001 1000",
"output": "25701"
},
{
"input": "26\n1000 1001 1000 1001 1000 1001 1001 1000 1001 1002 1002 1000 1001 1000 1000 1000 1001 1002 1001 1000 1000 1001 1000 1002 1001 1002",
"output": "25727"
},
{
"input": "26\n1003 1002 1002 1003 1000 1000 1000 1003 1000 1001 1003 1003 1000 1002 1002 1002 1001 1003 1000 1001 1000 1001 1001 1000 1003 1003",
"output": "25753"
},
{
"input": "26\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "26\n8717 9417 1409 7205 3625 6247 8626 9486 464 4271 1698 8449 4551 1528 7456 9198 4886 2889 7534 506 7867 9410 1635 4955 2580 2580",
"output": "137188"
},
{
"input": "26\n197464663 125058028 622449215 11119637 587496049 703992162 219591040 965159268 229879004 278894000 841629744 616893922 218779915 362575332 844188865 342411376 369680019 43823059 921419789 999588082 943769007 35365522 301907919 758302419 427454397 807507709",
"output": "12776400142"
},
{
"input": "26\n907247856 970380443 957324066 929910532 947150618 944189007 998282297 988343406 981298600 943026596 953932265 972691398 950024048 923033790 996423650 972134755 946404759 918183059 902987271 965507679 906967700 982106487 933997242 972594441 977736332 928874832",
"output": "24770753129"
},
{
"input": "26\n999999061 999999688 999999587 999999429 999999110 999999563 999999120 999999111 999999794 999999890 999999004 999999448 999999770 999999543 999999460 999999034 999999361 999999305 999999201 999999778 999999432 999999844 999999133 999999342 999999600 999999319",
"output": "25999984927"
},
{
"input": "3\n587951561 282383259 612352726",
"output": "1482687546"
},
{
"input": "4\n111637338 992238139 787658714 974622806",
"output": "2866156997"
},
{
"input": "5\n694257603 528073418 726928894 596328666 652863391",
"output": "3198451972"
},
{
"input": "6\n217943380 532900593 902234882 513005821 369342573 495810412",
"output": "3031237661"
},
{
"input": "7\n446656860 478792281 77541870 429682977 85821755 826122363 563802405",
"output": "2908420511"
},
{
"input": "8\n29278125 778590752 252847858 51388836 802299938 215370803 901540149 242074772",
"output": "3273391233"
},
{
"input": "9\n552962902 724482439 133182550 673093696 518779120 604618242 534250189 847695567 403066553",
"output": "4992131258"
},
{
"input": "10\n600386086 862479376 284190454 781950823 672077209 5753052 145701234 680334621 497013634 35429365",
"output": "4565315854"
},
{
"input": "11\n183007351 103343359 164525146 698627979 388556391 926007595 483438978 580927711 659384363 201890880 920750904",
"output": "5310460657"
},
{
"input": "12\n706692128 108170535 339831134 320333838 810063277 20284739 821176722 481520801 467848308 604388203 881959821 874133307",
"output": "6436402813"
},
{
"input": "13\n525349200 54062222 810108418 237010994 821513756 409532178 158915465 87142595 630219037 770849718 843168738 617993222 504443485",
"output": "6470309028"
},
{
"input": "14\n812998169 353860693 690443110 153688149 537992938 798779618 791624505 282706982 733654279 468319337 568341847 597888944 649703235 667623671",
"output": "8107625477"
},
{
"input": "15\n336683946 299752380 865749098 775393009 959499824 893055762 365399057 419335880 896025008 575845364 529550764 341748859 30999793 464432689 19445239",
"output": "7772916672"
},
{
"input": "16\n860368723 540615364 41056086 692070164 970950302 282304201 998108096 24957674 999460249 37279175 490759681 26673285 412295352 671298115 627182888 90740349",
"output": "7766119704"
},
{
"input": "17\n148018692 545442539 980325266 313776023 687429485 376580345 40875544 925549764 161831978 144805202 451968598 475560904 262583806 468107133 60900936 281546097 912565045",
"output": "7237867357"
},
{
"input": "18\n966674765 786305522 860659958 935480883 108937371 60800080 673584584 826142855 560238516 606238013 413177515 455456626 643879364 969943855 963609881 177380550 544192822 864797474",
"output": "11417500634"
},
{
"input": "19\n490360541 496161402 330938242 852158038 120387849 686083328 247359135 431764649 427637949 8736336 843378328 435352349 494167818 766752874 161292122 368186298 470791896 813444279 170758124",
"output": "8615711557"
},
{
"input": "20\n654616375 542649443 729213190 188364665 238384327 726353863 974350390 526804424 601329631 886592063 734805196 275562411 861801362 374466292 119830901 403120565 670982545 63210795 130397643 601611646",
"output": "10304447727"
},
{
"input": "21\n942265343 252505322 904519178 810069524 954862509 115602302 548124942 132426218 999736168 584061682 696014113 960485837 712089816 581331718 317512142 593926314 302610323 716885305 477125514 813997503 535631456",
"output": "12951783229"
},
{
"input": "22\n465951120 788339601 784853870 726746679 376370396 504849742 180834982 33019308 867135601 455551901 657223030 940381560 93386374 378140736 161286599 548696254 934237100 75589518 764917898 731412064 205669368 630662937",
"output": "11305256638"
},
{
"input": "23\n989635897 498195481 255132154 643423835 387820874 894097181 223601429 228583694 265543138 153021520 618431947 684241474 943673829 174949754 358967839 444530707 801900686 965299835 347682577 648826625 406714384 129525158 958578251",
"output": "12022378269"
},
{
"input": "24\n277285866 739058464 135466846 265129694 104300056 519381429 856310469 834204489 132942572 260547547 343605057 664137197 619941683 676786476 497713592 635336455 138557168 618975345 635474960 861212482 76752297 923357675 517046816 274123722",
"output": "11607648357"
},
{
"input": "25\n95942939 979921447 310772834 181806850 525806942 613657573 194049213 734797579 531349109 721980358 304813974 113025815 470230137 473595494 695394833 590106396 770183946 567622150 218239639 778627043 41761505 127248600 134450869 860350034 901937574",
"output": "11937672853"
},
{
"input": "26\n619627716 984748623 486078822 98484005 537257421 2906012 62795060 635390669 103777246 829506385 971050595 92921538 851525695 680460920 893076074 780912144 401811723 221297659 269996214 991012900 242806521 626109821 987889730 682613155 209557740 806895799",
"output": "14070510187"
},
{
"input": "26\n10 1 20 2 23 3 14 6 7 13 26 21 11 8 16 25 12 15 19 9 17 22 24 18 5 4",
"output": "351"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "5\n5 3 3 3 1",
"output": "11"
},
{
"input": "5\n2 2 2 2 2",
"output": "3"
},
{
"input": "10\n10 10 10 10 10 10 10 10 1 1",
"output": "53"
},
{
"input": "10\n100 100 10 10 10 10 10 1 1 1",
"output": "240"
},
{
"input": "6\n5 3 3 3 3 1",
"output": "11"
},
{
"input": "4\n4 3 2 1",
"output": "10"
},
{
"input": "5\n1 1 1 1 1",
"output": "1"
}
] | 1,454,609,643
| 4,142
|
Python 3
|
CHALLENGED
|
CHALLENGES
| 8
| 61
| 0
|
n=int(input())
L=list(map(int,input().split(" ")))
L.sort(reverse=True)
s=L[0]
p=L[0]
for i in range(1,len(L)):
c=L[i]
while c>=p:
c-=1
s+=c
p=c
print(s)
|
Title: Making a String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an alphabet consisting of *n* letters, your task is to make a string of the maximum possible length so that the following conditions are satisfied:
- the *i*-th letter occurs in the string no more than *a**i* times; - the number of occurrences of each letter in the string must be distinct for all the letters that occurred in the string at least once.
Input Specification:
The first line of the input contains a single integer *n* (2<=<=≤<=<=*n*<=<=≤<=<=26) — the number of letters in the alphabet.
The next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — *i*-th of these integers gives the limitation on the number of occurrences of the *i*-th character in the string.
Output Specification:
Print a single integer — the maximum length of the string that meets all the requirements.
Demo Input:
['3\n2 5 5\n', '3\n1 1 2\n']
Demo Output:
['11\n', '3\n']
Note:
For convenience let's consider an alphabet consisting of three letters: "a", "b", "c". In the first sample, some of the optimal strings are: "cccaabbccbb", "aabcbcbcbcb". In the second sample some of the optimal strings are: "acc", "cbc".
|
```python
n=int(input())
L=list(map(int,input().split(" ")))
L.sort(reverse=True)
s=L[0]
p=L[0]
for i in range(1,len(L)):
c=L[i]
while c>=p:
c-=1
s+=c
p=c
print(s)
```
| -1
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,682,430,205
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 61
| 0
|
import math
var = [0,0,0]
x = input()
var = x.split(" ")
n = var[0]
m = var[1]
a = var[2]
temp_1 = math.ceil(float(n)/float(a))
temp_2 = math.ceil(float(m)/float(a))
print(str(temp_1*temp_2))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
import math
var = [0,0,0]
x = input()
var = x.split(" ")
n = var[0]
m = var[1]
a = var[2]
temp_1 = math.ceil(float(n)/float(a))
temp_2 = math.ceil(float(m)/float(a))
print(str(temp_1*temp_2))
```
| 3.9695
|
999
|
E
|
Reachability from the Capital
|
PROGRAMMING
| 2,000
|
[
"dfs and similar",
"graphs",
"greedy"
] | null | null |
There are $n$ cities and $m$ roads in Berland. Each road connects a pair of cities. The roads in Berland are one-way.
What is the minimum number of new roads that need to be built to make all the cities reachable from the capital?
New roads will also be one-way.
|
The first line of input consists of three integers $n$, $m$ and $s$ ($1 \le n \le 5000, 0 \le m \le 5000, 1 \le s \le n$) — the number of cities, the number of roads and the index of the capital. Cities are indexed from $1$ to $n$.
The following $m$ lines contain roads: road $i$ is given as a pair of cities $u_i$, $v_i$ ($1 \le u_i, v_i \le n$, $u_i \ne v_i$). For each pair of cities $(u, v)$, there can be at most one road from $u$ to $v$. Roads in opposite directions between a pair of cities are allowed (i.e. from $u$ to $v$ and from $v$ to $u$).
|
Print one integer — the minimum number of extra roads needed to make all the cities reachable from city $s$. If all the cities are already reachable from $s$, print 0.
|
[
"9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1\n",
"5 4 5\n1 2\n2 3\n3 4\n4 1\n"
] |
[
"3\n",
"1\n"
] |
The first example is illustrated by the following:
For example, you can add roads ($6, 4$), ($7, 9$), ($1, 7$) to make all the cities reachable from $s = 1$.
The second example is illustrated by the following:
In this example, you can add any one of the roads ($5, 1$), ($5, 2$), ($5, 3$), ($5, 4$) to make all the cities reachable from $s = 5$.
| 0
|
[
{
"input": "9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1",
"output": "3"
},
{
"input": "5 4 5\n1 2\n2 3\n3 4\n4 1",
"output": "1"
},
{
"input": "5000 0 2956",
"output": "4999"
},
{
"input": "2 0 2",
"output": "1"
},
{
"input": "2 1 1\n1 2",
"output": "0"
},
{
"input": "2 1 2\n1 2",
"output": "1"
},
{
"input": "2 2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "5000 2 238\n3212 238\n238 3212",
"output": "4998"
},
{
"input": "5000 2 3810\n3225 1137\n1137 3225",
"output": "4998"
},
{
"input": "100 1 30\n69 81",
"output": "98"
},
{
"input": "500 1 209\n183 107",
"output": "498"
},
{
"input": "1000 1 712\n542 916",
"output": "998"
},
{
"input": "39 40 38\n4 8\n24 28\n16 17\n7 25\n4 29\n34 35\n16 24\n21 10\n23 36\n36 14\n28 16\n34 19\n15 21\n22 38\n22 37\n37 27\n28 33\n3 29\n32 22\n12 30\n9 15\n5 19\n23 27\n19 17\n25 17\n24 11\n39 10\n6 20\n16 6\n3 18\n34 21\n15 38\n11 19\n11 3\n32 4\n15 13\n16 11\n11 7\n33 7\n3 33",
"output": "12"
},
{
"input": "8 8 1\n3 2\n3 4\n4 5\n5 3\n6 4\n6 7\n7 8\n8 6",
"output": "1"
},
{
"input": "7 7 1\n2 3\n4 2\n7 4\n5 7\n4 5\n4 6\n6 4",
"output": "1"
},
{
"input": "2333 1 1\n1 2",
"output": "2331"
},
{
"input": "7 4 2\n1 2\n3 4\n5 6\n7 1",
"output": "3"
},
{
"input": "1 0 1",
"output": "0"
},
{
"input": "9 9 1\n2 3\n3 4\n4 5\n6 2\n7 6\n8 7\n6 8\n5 9\n9 2",
"output": "1"
},
{
"input": "30 30 29\n29 9\n1 3\n15 5\n14 24\n7 18\n17 12\n5 9\n22 7\n26 20\n7 29\n8 2\n10 12\n17 18\n17 24\n8 12\n23 28\n10 15\n18 2\n29 13\n25 29\n9 2\n7 13\n11 5\n19 26\n10 5\n25 5\n20 10\n5 26\n24 23\n22 8",
"output": "13"
},
{
"input": "30 30 28\n16 28\n5 30\n7 17\n6 1\n12 28\n15 28\n14 30\n25 11\n25 10\n25 8\n12 30\n27 5\n30 10\n22 14\n30 13\n20 27\n15 25\n24 20\n20 15\n1 30\n3 10\n3 4\n3 18\n15 14\n18 22\n20 26\n10 3\n15 27\n23 29\n10 24",
"output": "9"
}
] | 1,622,311,854
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 171
| 6,041,600
|
from collections import deque
import heapq
import sys
input = sys.stdin.readline
def bfs1(s):
q = deque()
q.append(s)
visit[s] = 1
ok = set()
while q:
i = q.popleft()
ok.add(i)
for j in G[i]:
if not visit[j]:
q.append(j)
visit[j] = 1
return ok
def bfs2(s):
q = deque()
q.append(s)
visit0 = visit
visit0[s] = 1
x = set()
while q:
i = q.popleft()
x.add(i)
for j in G[i]:
if not visit0[j]:
q.append(j)
visit0[j] = 1
return x
n, m, s = map(int, input().split())
G = [[] for _ in range(n + 1)]
for _ in range(m):
u, v = map(int, input().split())
G[u].append(v)
visit = [0] * (n + 1)
ok = bfs1(s)
y = [_ for _ in range(n + 1)]
h = []
for i in range(1, n + 1):
if not visit[i]:
x = bfs2(i)
y[i] = x
heapq.heappush(h, (-len(x), i))
ans = 0
while not len(ok) == n:
ans += 1
l, i = heapq.heappop(h)
for j in y[i]:
ok.add(j)
print(ans)
|
Title: Reachability from the Capital
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are $n$ cities and $m$ roads in Berland. Each road connects a pair of cities. The roads in Berland are one-way.
What is the minimum number of new roads that need to be built to make all the cities reachable from the capital?
New roads will also be one-way.
Input Specification:
The first line of input consists of three integers $n$, $m$ and $s$ ($1 \le n \le 5000, 0 \le m \le 5000, 1 \le s \le n$) — the number of cities, the number of roads and the index of the capital. Cities are indexed from $1$ to $n$.
The following $m$ lines contain roads: road $i$ is given as a pair of cities $u_i$, $v_i$ ($1 \le u_i, v_i \le n$, $u_i \ne v_i$). For each pair of cities $(u, v)$, there can be at most one road from $u$ to $v$. Roads in opposite directions between a pair of cities are allowed (i.e. from $u$ to $v$ and from $v$ to $u$).
Output Specification:
Print one integer — the minimum number of extra roads needed to make all the cities reachable from city $s$. If all the cities are already reachable from $s$, print 0.
Demo Input:
['9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1\n', '5 4 5\n1 2\n2 3\n3 4\n4 1\n']
Demo Output:
['3\n', '1\n']
Note:
The first example is illustrated by the following:
For example, you can add roads ($6, 4$), ($7, 9$), ($1, 7$) to make all the cities reachable from $s = 1$.
The second example is illustrated by the following:
In this example, you can add any one of the roads ($5, 1$), ($5, 2$), ($5, 3$), ($5, 4$) to make all the cities reachable from $s = 5$.
|
```python
from collections import deque
import heapq
import sys
input = sys.stdin.readline
def bfs1(s):
q = deque()
q.append(s)
visit[s] = 1
ok = set()
while q:
i = q.popleft()
ok.add(i)
for j in G[i]:
if not visit[j]:
q.append(j)
visit[j] = 1
return ok
def bfs2(s):
q = deque()
q.append(s)
visit0 = visit
visit0[s] = 1
x = set()
while q:
i = q.popleft()
x.add(i)
for j in G[i]:
if not visit0[j]:
q.append(j)
visit0[j] = 1
return x
n, m, s = map(int, input().split())
G = [[] for _ in range(n + 1)]
for _ in range(m):
u, v = map(int, input().split())
G[u].append(v)
visit = [0] * (n + 1)
ok = bfs1(s)
y = [_ for _ in range(n + 1)]
h = []
for i in range(1, n + 1):
if not visit[i]:
x = bfs2(i)
y[i] = x
heapq.heappush(h, (-len(x), i))
ans = 0
while not len(ok) == n:
ans += 1
l, i = heapq.heappop(h)
for j in y[i]:
ok.add(j)
print(ans)
```
| 0
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,676,698,960
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 124
| 0
|
string_b=input()
low_b=0
up_b=0
for i in string_b:
if i.islower():
low_b+=1
else:
up_b+=1
if low_b>=up_b:
print(string_b.lower())
else:
print(string_b.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
string_b=input()
low_b=0
up_b=0
for i in string_b:
if i.islower():
low_b+=1
else:
up_b+=1
if low_b>=up_b:
print(string_b.lower())
else:
print(string_b.upper())
```
| 3.969
|
660
|
A
|
Co-prime Array
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
|
Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them.
|
[
"3\n2 7 28\n"
] |
[
"1\n2 7 9 28\n"
] |
none
| 0
|
[
{
"input": "3\n2 7 28",
"output": "1\n2 7 1 28"
},
{
"input": "1\n1",
"output": "0\n1"
},
{
"input": "1\n548",
"output": "0\n548"
},
{
"input": "1\n963837006",
"output": "0\n963837006"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0\n1 1 1 1 1 1 1 1 1 1"
},
{
"input": "10\n26 723 970 13 422 968 875 329 234 983",
"output": "2\n26 723 970 13 422 1 968 875 1 329 234 983"
},
{
"input": "10\n319645572 758298525 812547177 459359946 355467212 304450522 807957797 916787906 239781206 242840396",
"output": "7\n319645572 1 758298525 1 812547177 1 459359946 1 355467212 1 304450522 807957797 916787906 1 239781206 1 242840396"
},
{
"input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1",
"output": "19\n1 1 1 1 2 1 1 1 1 1 2 1 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 1 2 1 2 1 1 2 1 1 1 2 1 2 1 2 1 1 1 2 1 2 1 2 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 2 1"
},
{
"input": "100\n591 417 888 251 792 847 685 3 182 461 102 348 555 956 771 901 712 878 580 631 342 333 285 899 525 725 537 718 929 653 84 788 104 355 624 803 253 853 201 995 536 184 65 205 540 652 549 777 248 405 677 950 431 580 600 846 328 429 134 983 526 103 500 963 400 23 276 704 570 757 410 658 507 620 984 244 486 454 802 411 985 303 635 283 96 597 855 775 139 839 839 61 219 986 776 72 729 69 20 917",
"output": "38\n591 1 417 1 888 251 792 1 847 685 3 182 461 102 1 348 1 555 956 771 901 712 1 878 1 580 631 342 1 333 1 285 899 525 1 725 537 718 929 653 84 1 788 1 104 355 624 803 1 253 853 201 995 536 1 184 65 1 205 1 540 1 652 549 1 777 248 405 677 950 431 580 1 600 1 846 1 328 429 134 983 526 103 500 963 400 23 1 276 1 704 1 570 757 410 1 658 507 620 1 984 1 244 1 486 1 454 1 802 411 985 303 635 283 96 1 597 1 855 1 775 139 839 1 839 61 219 986 1 776 1 72 1 729 1 69 20 917"
},
{
"input": "5\n472882027 472882027 472882027 472882027 472882027",
"output": "4\n472882027 1 472882027 1 472882027 1 472882027 1 472882027"
},
{
"input": "2\n1000000000 1000000000",
"output": "1\n1000000000 1 1000000000"
},
{
"input": "2\n8 6",
"output": "1\n8 1 6"
},
{
"input": "3\n100000000 1000000000 1000000000",
"output": "2\n100000000 1 1000000000 1 1000000000"
},
{
"input": "5\n1 2 3 4 5",
"output": "0\n1 2 3 4 5"
},
{
"input": "20\n2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000 2 1000000000",
"output": "19\n2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000 1 2 1 1000000000"
},
{
"input": "2\n223092870 23",
"output": "1\n223092870 1 23"
},
{
"input": "2\n100000003 100000003",
"output": "1\n100000003 1 100000003"
},
{
"input": "2\n999999937 999999937",
"output": "1\n999999937 1 999999937"
},
{
"input": "4\n999 999999937 999999937 999",
"output": "1\n999 999999937 1 999999937 999"
},
{
"input": "2\n999999929 999999929",
"output": "1\n999999929 1 999999929"
},
{
"input": "2\n1049459 2098918",
"output": "1\n1049459 1 2098918"
},
{
"input": "2\n352229 704458",
"output": "1\n352229 1 704458"
},
{
"input": "2\n7293 4011",
"output": "1\n7293 1 4011"
},
{
"input": "2\n5565651 3999930",
"output": "1\n5565651 1 3999930"
},
{
"input": "2\n997 997",
"output": "1\n997 1 997"
},
{
"input": "3\n9994223 9994223 9994223",
"output": "2\n9994223 1 9994223 1 9994223"
},
{
"input": "2\n99999998 1000000000",
"output": "1\n99999998 1 1000000000"
},
{
"input": "3\n1000000000 1000000000 1000000000",
"output": "2\n1000000000 1 1000000000 1 1000000000"
},
{
"input": "2\n130471 130471",
"output": "1\n130471 1 130471"
},
{
"input": "3\n1000000000 2 2",
"output": "2\n1000000000 1 2 1 2"
},
{
"input": "2\n223092870 66526",
"output": "1\n223092870 1 66526"
},
{
"input": "14\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491 436077930 570018449",
"output": "10\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491 436077930 1 570018449"
},
{
"input": "2\n3996017 3996017",
"output": "1\n3996017 1 3996017"
},
{
"input": "2\n999983 999983",
"output": "1\n999983 1 999983"
},
{
"input": "2\n618575685 773990454",
"output": "1\n618575685 1 773990454"
},
{
"input": "3\n9699690 3 7",
"output": "1\n9699690 1 3 7"
},
{
"input": "2\n999999999 999999996",
"output": "1\n999999999 1 999999996"
},
{
"input": "2\n99999910 99999910",
"output": "1\n99999910 1 99999910"
},
{
"input": "12\n1000000000 1000000000 223092870 223092870 6 105 2 2 510510 510510 999999491 999999491",
"output": "9\n1000000000 1 1000000000 1 223092870 1 223092870 1 6 1 105 2 1 2 1 510510 1 510510 999999491 1 999999491"
},
{
"input": "3\n999999937 999999937 999999937",
"output": "2\n999999937 1 999999937 1 999999937"
},
{
"input": "2\n99839 99839",
"output": "1\n99839 1 99839"
},
{
"input": "3\n19999909 19999909 19999909",
"output": "2\n19999909 1 19999909 1 19999909"
},
{
"input": "4\n1 1000000000 1 1000000000",
"output": "0\n1 1000000000 1 1000000000"
},
{
"input": "2\n64006 64006",
"output": "1\n64006 1 64006"
},
{
"input": "2\n1956955 1956955",
"output": "1\n1956955 1 1956955"
},
{
"input": "3\n1 1000000000 1000000000",
"output": "1\n1 1000000000 1 1000000000"
},
{
"input": "2\n982451707 982451707",
"output": "1\n982451707 1 982451707"
},
{
"input": "2\n999999733 999999733",
"output": "1\n999999733 1 999999733"
},
{
"input": "3\n999999733 999999733 999999733",
"output": "2\n999999733 1 999999733 1 999999733"
},
{
"input": "2\n3257 3257",
"output": "1\n3257 1 3257"
},
{
"input": "2\n223092870 181598",
"output": "1\n223092870 1 181598"
},
{
"input": "3\n959919409 105935 105935",
"output": "2\n959919409 1 105935 1 105935"
},
{
"input": "2\n510510 510510",
"output": "1\n510510 1 510510"
},
{
"input": "3\n223092870 1000000000 1000000000",
"output": "2\n223092870 1 1000000000 1 1000000000"
},
{
"input": "14\n1000000000 2 1000000000 3 1000000000 6 1000000000 1000000000 15 1000000000 1000000000 1000000000 100000000 1000",
"output": "11\n1000000000 1 2 1 1000000000 3 1000000000 1 6 1 1000000000 1 1000000000 1 15 1 1000000000 1 1000000000 1 1000000000 1 100000000 1 1000"
},
{
"input": "7\n1 982451653 982451653 1 982451653 982451653 982451653",
"output": "3\n1 982451653 1 982451653 1 982451653 1 982451653 1 982451653"
},
{
"input": "2\n100000007 100000007",
"output": "1\n100000007 1 100000007"
},
{
"input": "3\n999999757 999999757 999999757",
"output": "2\n999999757 1 999999757 1 999999757"
},
{
"input": "3\n99999989 99999989 99999989",
"output": "2\n99999989 1 99999989 1 99999989"
},
{
"input": "5\n2 4 982451707 982451707 3",
"output": "2\n2 1 4 982451707 1 982451707 3"
},
{
"input": "2\n20000014 20000014",
"output": "1\n20000014 1 20000014"
},
{
"input": "2\n99999989 99999989",
"output": "1\n99999989 1 99999989"
},
{
"input": "2\n111546435 111546435",
"output": "1\n111546435 1 111546435"
},
{
"input": "2\n55288874 33538046",
"output": "1\n55288874 1 33538046"
},
{
"input": "5\n179424673 179424673 179424673 179424673 179424673",
"output": "4\n179424673 1 179424673 1 179424673 1 179424673 1 179424673"
},
{
"input": "2\n199999978 199999978",
"output": "1\n199999978 1 199999978"
},
{
"input": "2\n1000000000 2",
"output": "1\n1000000000 1 2"
},
{
"input": "3\n19999897 19999897 19999897",
"output": "2\n19999897 1 19999897 1 19999897"
},
{
"input": "2\n19999982 19999982",
"output": "1\n19999982 1 19999982"
},
{
"input": "2\n10000007 10000007",
"output": "1\n10000007 1 10000007"
},
{
"input": "3\n999999937 999999937 2",
"output": "1\n999999937 1 999999937 2"
},
{
"input": "5\n2017 2017 2017 2017 2017",
"output": "4\n2017 1 2017 1 2017 1 2017 1 2017"
},
{
"input": "2\n19999909 39999818",
"output": "1\n19999909 1 39999818"
},
{
"input": "2\n62615533 7919",
"output": "1\n62615533 1 7919"
},
{
"input": "5\n39989 39989 33 31 29",
"output": "1\n39989 1 39989 33 31 29"
},
{
"input": "2\n1000000000 100000",
"output": "1\n1000000000 1 100000"
},
{
"input": "2\n1938 10010",
"output": "1\n1938 1 10010"
},
{
"input": "2\n199999 199999",
"output": "1\n199999 1 199999"
},
{
"input": "2\n107273 107273",
"output": "1\n107273 1 107273"
},
{
"input": "3\n49999 49999 49999",
"output": "2\n49999 1 49999 1 49999"
},
{
"input": "2\n1999966 1999958",
"output": "1\n1999966 1 1999958"
},
{
"input": "2\n86020 300846",
"output": "1\n86020 1 300846"
},
{
"input": "2\n999999997 213",
"output": "1\n999999997 1 213"
},
{
"input": "2\n200000014 200000434",
"output": "1\n200000014 1 200000434"
}
] | 1,592,534,012
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 93
| 187
| 1,331,200
|
import fractions
def coprimeArray(arr, n):
c = 0
for i in range(1, n):
if fractions.gcd(arr[i], arr[i-1]) != 1:
c = c+1
print(c)
print(arr[0], end=" ")
for i in range(1, n):
if fractions.gcd(arr[i], arr[i-1]) != 1:
print(1, end=" ")
print(arr[i], end=" ")
if __name__ == "__main__":
n = int(input())
arr = list(map(int, input().split()))
coprimeArray(arr, n)
print()
|
Title: Co-prime Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of *n* elements, you must make it a co-prime array in as few moves as possible.
In each move you can insert any positive integral number you want not greater than 109 in any place in the array.
An array is co-prime if any two adjacent numbers of it are co-prime.
In the number theory, two integers *a* and *b* are said to be co-prime if the only positive integer that divides both of them is 1.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the given array.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
Output Specification:
Print integer *k* on the first line — the least number of elements needed to add to the array *a* to make it co-prime.
The second line should contain *n*<=+<=*k* integers *a**j* — the elements of the array *a* after adding *k* elements to it. Note that the new array should be co-prime, so any two adjacent values should be co-prime. Also the new array should be got from the original array *a* by adding *k* elements to it.
If there are multiple answers you can print any one of them.
Demo Input:
['3\n2 7 28\n']
Demo Output:
['1\n2 7 9 28\n']
Note:
none
|
```python
import fractions
def coprimeArray(arr, n):
c = 0
for i in range(1, n):
if fractions.gcd(arr[i], arr[i-1]) != 1:
c = c+1
print(c)
print(arr[0], end=" ")
for i in range(1, n):
if fractions.gcd(arr[i], arr[i-1]) != 1:
print(1, end=" ")
print(arr[i], end=" ")
if __name__ == "__main__":
n = int(input())
arr = list(map(int, input().split()))
coprimeArray(arr, n)
print()
```
| 3
|
|
32
|
B
|
Borze
|
PROGRAMMING
| 800
|
[
"expression parsing",
"implementation"
] |
B. Borze
|
2
|
256
|
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
|
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
|
Output the decoded ternary number. It can have leading zeroes.
|
[
".-.--\n",
"--.\n",
"-..-.--\n"
] |
[
"012",
"20",
"1012"
] |
none
| 1,000
|
[
{
"input": ".-.--",
"output": "012"
},
{
"input": "--.",
"output": "20"
},
{
"input": "-..-.--",
"output": "1012"
},
{
"input": "---..",
"output": "210"
},
{
"input": "..--.---..",
"output": "0020210"
},
{
"input": "-.....----.",
"output": "10000220"
},
{
"input": ".",
"output": "0"
},
{
"input": "-.",
"output": "1"
},
{
"input": "--",
"output": "2"
},
{
"input": "..",
"output": "00"
},
{
"input": "--.",
"output": "20"
},
{
"input": ".--.",
"output": "020"
},
{
"input": ".-.-..",
"output": "0110"
},
{
"input": "----.-.",
"output": "2201"
},
{
"input": "-..--.-.",
"output": "10201"
},
{
"input": "..--..--.",
"output": "0020020"
},
{
"input": "-.-.---.--..-..-.-.-..-..-.--.",
"output": "112120010111010120"
},
{
"input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.",
"output": "21112220010101011012011011221011"
},
{
"input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------",
"output": "11020111110111222212021020002022111100201121222020012022110010222"
},
{
"input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..",
"output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110"
},
{
"input": ".-..-.-.---.-----.--.---...-.--.-.-....-..",
"output": "01011212212021001201100010"
},
{
"input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..",
"output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210"
},
{
"input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.",
"output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220"
},
{
"input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----",
"output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122"
},
{
"input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..",
"output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110"
},
{
"input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.",
"output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020"
},
{
"input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..",
"output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200"
},
{
"input": "-.---...----...--.--...-.--.----",
"output": "121002200020200012022"
},
{
"input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.",
"output": "202020212012111010201021100001021221200011222112012201012220"
}
] | 1,681,092,097
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
a = input()
a = str(a).replace('--','2')
a = str(a).replace('-.','1')
a = str(a).replace('.','0')
print(a)
|
Title: Borze
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
Input Specification:
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output Specification:
Output the decoded ternary number. It can have leading zeroes.
Demo Input:
['.-.--\n', '--.\n', '-..-.--\n']
Demo Output:
['012', '20', '1012']
Note:
none
|
```python
a = input()
a = str(a).replace('--','2')
a = str(a).replace('-.','1')
a = str(a).replace('.','0')
print(a)
```
| 3.977
|
225
|
A
|
Dice Tower
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"greedy"
] | null | null |
A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input.
|
Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes).
|
[
"3\n6\n3 2\n5 4\n2 4\n",
"3\n3\n2 6\n4 1\n5 3\n"
] |
[
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3\n6\n3 2\n5 4\n2 4",
"output": "YES"
},
{
"input": "3\n3\n2 6\n4 1\n5 3",
"output": "NO"
},
{
"input": "1\n3\n2 1",
"output": "YES"
},
{
"input": "2\n2\n3 1\n1 5",
"output": "NO"
},
{
"input": "3\n2\n1 4\n5 3\n6 4",
"output": "NO"
},
{
"input": "4\n3\n5 6\n1 3\n1 5\n4 1",
"output": "NO"
},
{
"input": "2\n2\n3 1\n1 3",
"output": "YES"
},
{
"input": "3\n2\n1 4\n3 1\n4 6",
"output": "YES"
},
{
"input": "4\n3\n5 6\n1 5\n5 1\n1 5",
"output": "YES"
},
{
"input": "5\n1\n2 3\n5 3\n5 4\n5 1\n3 5",
"output": "NO"
},
{
"input": "10\n5\n1 3\n2 3\n6 5\n6 5\n4 5\n1 3\n1 2\n3 2\n4 2\n1 2",
"output": "NO"
},
{
"input": "15\n4\n2 1\n2 4\n6 4\n5 3\n4 1\n4 2\n6 3\n4 5\n3 5\n2 6\n5 6\n1 5\n3 5\n6 4\n3 2",
"output": "NO"
},
{
"input": "20\n6\n3 2\n4 6\n3 6\n6 4\n5 1\n1 5\n2 6\n1 2\n1 4\n5 3\n2 3\n6 2\n5 4\n2 6\n1 3\n4 6\n4 5\n6 3\n3 1\n6 2",
"output": "NO"
},
{
"input": "25\n4\n1 2\n4 1\n3 5\n2 1\n3 5\n6 5\n3 5\n5 6\n1 2\n2 4\n6 2\n2 3\n2 4\n6 5\n2 3\n6 3\n2 3\n1 3\n2 1\n3 1\n5 6\n3 1\n6 4\n3 6\n2 3",
"output": "NO"
},
{
"input": "100\n3\n6 5\n5 1\n3 2\n1 5\n3 6\n5 4\n2 6\n4 1\n6 3\n4 5\n1 5\n1 4\n4 2\n2 6\n5 4\n4 1\n1 3\n6 5\n5 1\n2 1\n2 4\n2 1\n3 6\n4 1\n6 3\n2 3\n5 1\n2 6\n6 4\n3 5\n4 1\n6 5\n1 5\n1 5\n2 3\n4 1\n5 3\n6 4\n1 3\n5 3\n4 1\n1 4\n2 1\n6 2\n1 5\n6 2\n6 2\n4 5\n4 2\n5 6\n6 3\n1 3\n2 3\n5 4\n6 5\n3 1\n1 2\n4 1\n1 3\n1 3\n6 5\n4 6\n3 1\n2 1\n2 3\n3 2\n4 1\n1 5\n4 1\n6 3\n1 5\n4 5\n4 2\n4 5\n2 6\n2 1\n3 5\n4 6\n4 2\n4 5\n2 4\n3 1\n6 4\n5 6\n3 1\n1 4\n4 5\n6 3\n6 3\n2 1\n5 1\n3 6\n3 5\n2 1\n4 6\n4 2\n5 6\n3 1\n3 5\n3 6",
"output": "NO"
},
{
"input": "99\n3\n2 1\n6 2\n3 6\n1 3\n5 1\n2 6\n4 6\n6 4\n6 4\n6 5\n3 6\n2 6\n1 5\n2 3\n4 6\n1 4\n4 1\n2 3\n4 5\n4 1\n5 1\n1 2\n6 5\n4 6\n6 5\n6 2\n3 6\n6 4\n2 1\n3 1\n2 1\n6 2\n3 5\n4 1\n5 3\n3 1\n1 5\n3 6\n6 2\n1 5\n2 1\n5 1\n4 1\n2 6\n5 4\n4 2\n2 1\n1 5\n1 3\n4 6\n4 6\n4 5\n2 3\n6 2\n3 2\n2 1\n4 6\n6 2\n3 5\n3 6\n3 1\n2 3\n2 1\n3 6\n6 5\n6 3\n1 2\n5 1\n1 4\n6 2\n5 3\n1 3\n5 4\n2 3\n6 3\n1 5\n1 2\n2 6\n5 6\n5 6\n3 5\n3 1\n4 6\n3 1\n4 5\n4 2\n3 5\n6 2\n2 4\n4 6\n6 2\n4 2\n2 3\n2 4\n1 5\n1 4\n3 5\n1 2\n4 5",
"output": "NO"
},
{
"input": "98\n6\n4 2\n1 2\n3 2\n2 1\n2 1\n3 2\n2 3\n6 5\n4 6\n1 5\n4 5\n5 1\n6 5\n1 4\n1 2\n2 4\n6 5\n4 5\n4 6\n3 1\n2 3\n4 1\n4 2\n6 5\n3 2\n4 2\n5 1\n2 4\n1 3\n4 5\n3 2\n1 2\n3 1\n3 2\n3 6\n6 4\n3 6\n3 5\n4 6\n6 5\n3 5\n3 2\n4 2\n6 4\n1 3\n2 4\n5 3\n2 3\n1 3\n5 6\n5 3\n5 3\n4 6\n4 6\n3 6\n4 1\n6 5\n6 2\n1 5\n2 1\n6 2\n5 4\n6 3\n1 5\n2 3\n2 6\n5 6\n2 6\n5 1\n3 2\n6 2\n6 2\n1 2\n2 1\n3 5\n2 1\n4 6\n1 4\n4 5\n3 2\n3 2\n5 4\n1 3\n5 1\n2 3\n6 2\n2 6\n1 5\n5 1\n5 4\n5 1\n5 4\n2 1\n6 5\n1 4\n6 5\n1 2\n3 5",
"output": "NO"
},
{
"input": "97\n3\n2 1\n6 5\n4 1\n6 5\n3 2\n1 2\n6 3\n6 4\n6 3\n1 3\n1 3\n3 1\n3 6\n3 2\n5 6\n4 2\n3 6\n1 5\n2 6\n3 2\n6 2\n2 1\n2 4\n1 3\n3 1\n2 6\n3 6\n4 6\n6 2\n5 1\n6 3\n2 6\n3 6\n2 4\n4 5\n6 5\n4 1\n5 6\n6 2\n5 4\n5 1\n6 5\n1 4\n2 1\n4 5\n4 5\n4 1\n5 4\n1 4\n2 6\n2 6\n1 5\n5 6\n3 2\n2 3\n1 4\n4 1\n3 6\n6 2\n5 3\n6 2\n4 5\n6 2\n2 6\n6 5\n1 4\n2 6\n3 5\n2 6\n4 1\n4 5\n1 3\n4 2\n3 2\n1 2\n5 6\n1 5\n3 5\n2 1\n1 2\n1 2\n6 4\n5 1\n1 2\n2 4\n6 3\n4 5\n1 5\n4 2\n5 1\n3 1\n6 4\n4 2\n1 5\n4 6\n2 1\n2 6",
"output": "NO"
},
{
"input": "96\n4\n1 5\n1 5\n4 6\n1 2\n4 2\n3 2\n4 6\n6 4\n6 3\n6 2\n4 1\n6 4\n5 1\n2 4\n5 6\n6 5\n3 2\n6 2\n3 1\n1 4\n3 2\n6 2\n2 4\n1 3\n5 4\n1 3\n6 2\n6 2\n5 6\n1 4\n4 2\n6 2\n3 1\n6 5\n3 1\n4 2\n6 3\n3 2\n3 6\n1 3\n5 6\n6 4\n1 4\n5 4\n2 6\n3 5\n5 4\n5 1\n2 4\n1 5\n1 3\n1 2\n1 3\n6 4\n6 3\n4 5\n4 1\n3 6\n1 2\n6 4\n1 2\n2 3\n2 1\n4 6\n1 3\n5 1\n4 5\n5 4\n6 3\n2 6\n5 1\n6 2\n3 1\n3 1\n5 4\n3 1\n5 6\n2 6\n5 6\n4 2\n6 5\n3 2\n6 5\n2 3\n6 4\n6 2\n1 2\n4 1\n1 2\n6 3\n2 1\n5 1\n6 5\n5 4\n4 5\n1 2",
"output": "NO"
},
{
"input": "5\n1\n2 3\n3 5\n4 5\n5 4\n5 3",
"output": "YES"
},
{
"input": "10\n5\n1 3\n3 1\n6 3\n6 3\n4 6\n3 1\n1 4\n3 1\n4 6\n1 3",
"output": "YES"
},
{
"input": "15\n4\n2 1\n2 6\n6 5\n5 1\n1 5\n2 1\n6 5\n5 1\n5 1\n6 2\n6 5\n5 1\n5 1\n6 5\n2 6",
"output": "YES"
},
{
"input": "20\n6\n3 2\n4 2\n3 5\n4 2\n5 3\n5 4\n2 3\n2 3\n4 5\n3 5\n3 2\n2 4\n4 5\n2 4\n3 2\n4 2\n5 4\n3 2\n3 5\n2 4",
"output": "YES"
},
{
"input": "25\n4\n1 2\n1 5\n5 6\n1 2\n5 1\n5 6\n5 1\n6 5\n2 1\n2 6\n2 6\n2 6\n2 6\n5 6\n2 6\n6 5\n2 1\n1 5\n1 2\n1 2\n6 5\n1 2\n6 5\n6 2\n2 6",
"output": "YES"
},
{
"input": "100\n3\n6 5\n1 5\n2 1\n5 1\n6 5\n5 1\n6 2\n1 2\n6 5\n5 1\n5 1\n1 5\n2 6\n6 2\n5 6\n1 2\n1 5\n5 6\n1 5\n1 2\n2 6\n1 2\n6 2\n1 5\n6 2\n2 6\n1 5\n6 2\n6 5\n5 6\n1 5\n5 6\n5 1\n5 1\n2 1\n1 2\n5 6\n6 5\n1 5\n5 1\n1 2\n1 5\n1 2\n2 6\n5 1\n2 6\n2 6\n5 6\n2 6\n6 5\n6 5\n1 5\n2 1\n5 6\n5 6\n1 2\n2 1\n1 2\n1 2\n1 2\n5 6\n6 2\n1 5\n1 2\n2 1\n2 6\n1 2\n5 1\n1 5\n6 5\n5 1\n5 1\n2 6\n5 6\n6 2\n1 2\n5 1\n6 2\n2 1\n5 6\n2 1\n1 5\n6 5\n6 5\n1 2\n1 2\n5 1\n6 2\n6 2\n1 2\n1 5\n6 5\n5 6\n1 2\n6 5\n2 1\n6 5\n1 5\n5 6\n6 5",
"output": "YES"
},
{
"input": "99\n3\n2 1\n2 6\n6 2\n1 5\n1 5\n6 2\n6 5\n6 5\n6 2\n5 6\n6 5\n6 2\n5 1\n2 6\n6 5\n1 5\n1 5\n2 6\n5 1\n1 5\n1 5\n2 1\n5 6\n6 5\n5 6\n2 6\n6 2\n6 5\n1 2\n1 2\n1 2\n2 6\n5 6\n1 2\n5 6\n1 2\n5 1\n6 5\n2 6\n5 1\n1 2\n1 5\n1 5\n6 2\n5 1\n2 6\n1 2\n5 1\n1 5\n6 5\n6 5\n5 6\n2 1\n2 6\n2 6\n1 2\n6 2\n2 6\n5 6\n6 5\n1 5\n2 1\n1 2\n6 2\n5 6\n6 5\n2 1\n1 5\n1 5\n2 6\n5 1\n1 2\n5 6\n2 1\n6 5\n5 1\n2 1\n6 2\n6 5\n6 5\n5 6\n1 2\n6 5\n1 2\n5 1\n2 1\n5 1\n2 6\n2 1\n6 2\n2 6\n2 6\n2 1\n2 1\n5 1\n1 5\n5 6\n2 1\n5 6",
"output": "YES"
},
{
"input": "98\n6\n4 2\n2 3\n2 3\n2 3\n2 3\n2 3\n3 2\n5 4\n4 2\n5 4\n5 4\n5 4\n5 3\n4 5\n2 3\n4 2\n5 3\n5 4\n4 5\n3 5\n3 2\n4 2\n2 4\n5 4\n2 3\n2 4\n5 4\n4 2\n3 5\n5 4\n2 3\n2 4\n3 5\n2 3\n3 5\n4 2\n3 5\n5 3\n4 2\n5 3\n5 3\n2 3\n2 4\n4 5\n3 2\n4 2\n3 5\n3 2\n3 5\n5 4\n3 5\n3 5\n4 2\n4 2\n3 2\n4 5\n5 4\n2 3\n5 4\n2 4\n2 3\n4 5\n3 5\n5 4\n3 2\n2 3\n5 3\n2 3\n5 3\n2 3\n2 3\n2 4\n2 3\n2 3\n5 3\n2 3\n4 2\n4 2\n5 4\n2 3\n2 3\n4 5\n3 2\n5 3\n3 2\n2 4\n2 4\n5 3\n5 4\n4 5\n5 3\n4 5\n2 4\n5 3\n4 2\n5 4\n2 4\n5 3",
"output": "YES"
},
{
"input": "97\n3\n2 1\n5 6\n1 2\n5 6\n2 6\n2 1\n6 2\n6 5\n6 2\n1 5\n1 2\n1 2\n6 2\n2 6\n6 5\n2 6\n6 5\n5 1\n6 2\n2 6\n2 6\n1 2\n2 6\n1 2\n1 5\n6 2\n6 5\n6 5\n2 6\n1 5\n6 5\n6 2\n6 2\n2 6\n5 6\n5 6\n1 5\n6 5\n2 6\n5 6\n1 5\n5 6\n1 5\n1 2\n5 1\n5 1\n1 5\n5 1\n1 5\n6 2\n6 2\n5 1\n6 5\n2 1\n2 6\n1 5\n1 5\n6 2\n2 6\n5 6\n2 6\n5 6\n2 6\n6 2\n5 6\n1 2\n6 2\n5 6\n6 2\n1 5\n5 6\n1 5\n2 6\n2 6\n2 1\n6 5\n5 1\n5 1\n1 2\n2 1\n2 1\n6 2\n1 5\n2 1\n2 1\n6 2\n5 1\n5 1\n2 6\n1 5\n1 2\n6 2\n2 6\n5 1\n6 5\n1 2\n6 2",
"output": "YES"
},
{
"input": "96\n4\n1 5\n5 1\n6 5\n2 1\n2 1\n2 6\n6 5\n6 5\n6 2\n2 6\n1 5\n6 5\n1 5\n2 6\n6 5\n5 6\n2 1\n2 6\n1 2\n1 5\n2 6\n2 6\n2 1\n1 5\n5 1\n1 2\n2 6\n2 6\n6 5\n1 5\n2 1\n2 6\n1 2\n5 6\n1 5\n2 6\n6 2\n2 6\n6 5\n1 5\n6 5\n6 5\n1 5\n5 1\n6 2\n5 1\n5 1\n1 5\n2 6\n5 1\n1 5\n2 1\n1 2\n6 2\n6 2\n5 6\n1 5\n6 5\n2 1\n6 5\n2 1\n2 1\n1 2\n6 2\n1 2\n1 5\n5 1\n5 6\n6 5\n6 2\n1 5\n2 6\n1 2\n1 2\n5 1\n1 5\n6 5\n6 2\n6 5\n2 6\n5 6\n2 1\n5 6\n2 1\n6 5\n2 6\n2 1\n1 5\n2 1\n6 2\n1 2\n1 5\n5 6\n5 1\n5 6\n2 1",
"output": "YES"
},
{
"input": "3\n6\n3 2\n5 4\n2 6",
"output": "NO"
},
{
"input": "4\n1\n2 3\n2 3\n2 3\n1 3",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 4",
"output": "NO"
},
{
"input": "3\n6\n3 2\n5 6\n2 4",
"output": "NO"
},
{
"input": "2\n5\n6 3\n4 5",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 5",
"output": "NO"
},
{
"input": "2\n1\n3 2\n1 2",
"output": "NO"
},
{
"input": "2\n3\n5 1\n3 5",
"output": "NO"
},
{
"input": "2\n1\n2 3\n1 2",
"output": "NO"
},
{
"input": "2\n1\n2 3\n2 1",
"output": "NO"
},
{
"input": "3\n1\n4 5\n4 1\n4 5",
"output": "NO"
},
{
"input": "2\n4\n2 6\n5 4",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 2",
"output": "NO"
},
{
"input": "2\n3\n2 1\n3 5",
"output": "NO"
},
{
"input": "2\n3\n1 2\n3 1",
"output": "NO"
},
{
"input": "2\n3\n2 6\n5 3",
"output": "NO"
},
{
"input": "3\n3\n1 2\n3 2\n3 1",
"output": "NO"
},
{
"input": "3\n5\n3 1\n1 3\n2 3",
"output": "NO"
},
{
"input": "2\n6\n2 4\n6 5",
"output": "NO"
},
{
"input": "2\n6\n4 5\n6 5",
"output": "NO"
},
{
"input": "2\n6\n3 5\n3 6",
"output": "NO"
},
{
"input": "2\n4\n1 2\n4 5",
"output": "NO"
},
{
"input": "2\n3\n2 6\n3 1",
"output": "NO"
}
] | 1,692,955,235
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 92
| 0
|
n = int(input())
k = int(input())
l = 7 - k
ok = True
for i in range(n):
a, b = map(int, input().split())
if a == k or a == l or b == k or b == l:
ok = False
break
if ok:
print('YES')
else:
print('NO')
|
Title: Dice Tower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input.
Output Specification:
Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes).
Demo Input:
['3\n6\n3 2\n5 4\n2 4\n', '3\n3\n2 6\n4 1\n5 3\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
n = int(input())
k = int(input())
l = 7 - k
ok = True
for i in range(n):
a, b = map(int, input().split())
if a == k or a == l or b == k or b == l:
ok = False
break
if ok:
print('YES')
else:
print('NO')
```
| 3
|
|
978
|
B
|
File Name
|
PROGRAMMING
| 800
|
[
"greedy",
"strings"
] | null | null |
You can not just take the file and send it. When Polycarp trying to send a file in the social network "Codehorses", he encountered an unexpected problem. If the name of the file contains three or more "x" (lowercase Latin letters "x") in a row, the system considers that the file content does not correspond to the social network topic. In this case, the file is not sent and an error message is displayed.
Determine the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. Print 0 if the file name does not initially contain a forbidden substring "xxx".
You can delete characters in arbitrary positions (not necessarily consecutive). If you delete a character, then the length of a string is reduced by $1$. For example, if you delete the character in the position $2$ from the string "exxxii", then the resulting string is "exxii".
|
The first line contains integer $n$ $(3 \le n \le 100)$ — the length of the file name.
The second line contains a string of length $n$ consisting of lowercase Latin letters only — the file name.
|
Print the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. If initially the file name dost not contain a forbidden substring "xxx", print 0.
|
[
"6\nxxxiii\n",
"5\nxxoxx\n",
"10\nxxxxxxxxxx\n"
] |
[
"1\n",
"0\n",
"8\n"
] |
In the first example Polycarp tried to send a file with name contains number $33$, written in Roman numerals. But he can not just send the file, because it name contains three letters "x" in a row. To send the file he needs to remove any one of this letters.
| 0
|
[
{
"input": "6\nxxxiii",
"output": "1"
},
{
"input": "5\nxxoxx",
"output": "0"
},
{
"input": "10\nxxxxxxxxxx",
"output": "8"
},
{
"input": "100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "98"
},
{
"input": "99\nxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxa",
"output": "0"
},
{
"input": "3\nxxx",
"output": "1"
},
{
"input": "77\naaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxyyyzzz",
"output": "0"
},
{
"input": "100\nuxxxxxlmexxxxxxxwnxxexxxxxcxxfydxxxxxxvmdxxxxxxisxxxxxxxxidkxxxpxxxxxxxxmnuxxxxjxxxqcxxwmxxxxxxxxmrx",
"output": "41"
},
{
"input": "100\nxxxxxxxxxxxjtxxxxxxxxcxxxxxxcfxxxxzxxxxxxgxxxxxbxxxxbxxxxxxxxdycxxxxokixxxkizxxgcxxxxxxxxexxxxxfxxxc",
"output": "49"
},
{
"input": "100\nuxxxxxlmexxxxxxxwnxxexxxxxcxxfydxxxxxxvmdxxxxxxisxxxxxxxxidkxxxpxxxxxxxxmnuxxxxjxxxqcxxwmxxxxxwxxxxx",
"output": "41"
},
{
"input": "34\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "5\nfcyju",
"output": "0"
},
{
"input": "100\nihygyvdvyeifomhxhkhdkimquvgallbqharcyriyqkidnwykozuhvkwdldlztpabgyuflikychqpdenwzgtlzotyumjgdsrbxxxx",
"output": "2"
}
] | 1,689,097,403
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 13
| 62
| 0
|
length = int(input())
xcount = counter = 0
text = input()
for letter in text :
if letter == "x" :
xcount += 1
if xcount > 2 :
counter += 1
else :
xcount = 0
print(counter)
|
Title: File Name
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You can not just take the file and send it. When Polycarp trying to send a file in the social network "Codehorses", he encountered an unexpected problem. If the name of the file contains three or more "x" (lowercase Latin letters "x") in a row, the system considers that the file content does not correspond to the social network topic. In this case, the file is not sent and an error message is displayed.
Determine the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. Print 0 if the file name does not initially contain a forbidden substring "xxx".
You can delete characters in arbitrary positions (not necessarily consecutive). If you delete a character, then the length of a string is reduced by $1$. For example, if you delete the character in the position $2$ from the string "exxxii", then the resulting string is "exxii".
Input Specification:
The first line contains integer $n$ $(3 \le n \le 100)$ — the length of the file name.
The second line contains a string of length $n$ consisting of lowercase Latin letters only — the file name.
Output Specification:
Print the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. If initially the file name dost not contain a forbidden substring "xxx", print 0.
Demo Input:
['6\nxxxiii\n', '5\nxxoxx\n', '10\nxxxxxxxxxx\n']
Demo Output:
['1\n', '0\n', '8\n']
Note:
In the first example Polycarp tried to send a file with name contains number $33$, written in Roman numerals. But he can not just send the file, because it name contains three letters "x" in a row. To send the file he needs to remove any one of this letters.
|
```python
length = int(input())
xcount = counter = 0
text = input()
for letter in text :
if letter == "x" :
xcount += 1
if xcount > 2 :
counter += 1
else :
xcount = 0
print(counter)
```
| 3
|
|
873
|
B
|
Balanced Substring
|
PROGRAMMING
| 1,500
|
[
"dp",
"implementation"
] | null | null |
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
|
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
|
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
|
[
"8\n11010111\n",
"3\n111\n"
] |
[
"4\n",
"0\n"
] |
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring.
| 0
|
[
{
"input": "8\n11010111",
"output": "4"
},
{
"input": "3\n111",
"output": "0"
},
{
"input": "11\n00001000100",
"output": "2"
},
{
"input": "10\n0100000000",
"output": "2"
},
{
"input": "13\n0001000011010",
"output": "6"
},
{
"input": "14\n00000100101011",
"output": "10"
},
{
"input": "14\n01111101111111",
"output": "2"
},
{
"input": "18\n110010101101111111",
"output": "10"
},
{
"input": "11\n00010000011",
"output": "4"
},
{
"input": "10\n1000010110",
"output": "6"
},
{
"input": "15\n100000100000011",
"output": "4"
},
{
"input": "18\n011010101110111101",
"output": "8"
},
{
"input": "10\n0011011111",
"output": "6"
},
{
"input": "3\n011",
"output": "2"
},
{
"input": "14\n11111111111111",
"output": "0"
},
{
"input": "65\n11001000110001001011011110111100000000101001001010101111000100010",
"output": "48"
},
{
"input": "10\n0011111000",
"output": "10"
},
{
"input": "13\n1110000001110",
"output": "12"
},
{
"input": "3\n110",
"output": "2"
},
{
"input": "4\n1110",
"output": "2"
},
{
"input": "9\n001011001",
"output": "8"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n01",
"output": "2"
},
{
"input": "12\n110000110000",
"output": "8"
},
{
"input": "3\n001",
"output": "2"
},
{
"input": "14\n11000011000000",
"output": "8"
},
{
"input": "19\n0000011111111100000",
"output": "18"
},
{
"input": "45\n011010001100001111110001011100000001101100111",
"output": "44"
},
{
"input": "18\n000001111111100000",
"output": "16"
},
{
"input": "4\n0101",
"output": "4"
},
{
"input": "12\n000101011001",
"output": "10"
}
] | 1,676,992,832
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 11
| 46
| 0
|
#Task G - Сбалансированная подстрока
def create_prefix_arr(n, s): #в префиксном массиве прибавляем 1, если в массиве s встретили 1 и вычитаем 1 в обратно случае
pr = [0 for _ in range(n+1)]
pr[0] = 0 #для дальнейшего удобства первый элемент делаем нулевым
for i in range(n):
if s[i] == 0:
pr[i+1] = pr[i] - 1
else:
pr[i+1] = pr[i] + 1
return pr
def max_balance_length(n, s):
pr = create_prefix_arr(n, s)
first = [-1 for _ in range(n+1)]
curr_len, max_len = 0, 0
for i in range(1, n+1):
if first[pr[i]] == -1:
first[pr[i]] = i
else:
curr_len = i - first[pr[i]]
if curr_len > max_len:
max_len = curr_len
return max_len
n = int(input())
s = list(map(int, input())) #преобразуем исходную строку в массив целых чисел
print(max_balance_length(n, s))
|
Title: Balanced Substring
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
Input Specification:
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
Output Specification:
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
Demo Input:
['8\n11010111\n', '3\n111\n']
Demo Output:
['4\n', '0\n']
Note:
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring.
|
```python
#Task G - Сбалансированная подстрока
def create_prefix_arr(n, s): #в префиксном массиве прибавляем 1, если в массиве s встретили 1 и вычитаем 1 в обратно случае
pr = [0 for _ in range(n+1)]
pr[0] = 0 #для дальнейшего удобства первый элемент делаем нулевым
for i in range(n):
if s[i] == 0:
pr[i+1] = pr[i] - 1
else:
pr[i+1] = pr[i] + 1
return pr
def max_balance_length(n, s):
pr = create_prefix_arr(n, s)
first = [-1 for _ in range(n+1)]
curr_len, max_len = 0, 0
for i in range(1, n+1):
if first[pr[i]] == -1:
first[pr[i]] = i
else:
curr_len = i - first[pr[i]]
if curr_len > max_len:
max_len = curr_len
return max_len
n = int(input())
s = list(map(int, input())) #преобразуем исходную строку в массив целых чисел
print(max_balance_length(n, s))
```
| 0
|
|
620
|
B
|
Grandfather Dovlet’s calculator
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)).
Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator.
For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12.
|
The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max.
|
Print the only integer *a* — the total number of printed segments.
|
[
"1 3\n",
"10 15\n"
] |
[
"12\n",
"39\n"
] |
none
| 0
|
[
{
"input": "1 3",
"output": "12"
},
{
"input": "10 15",
"output": "39"
},
{
"input": "1 100",
"output": "928"
},
{
"input": "100 10000",
"output": "188446"
},
{
"input": "213 221442",
"output": "5645356"
},
{
"input": "1 1000000",
"output": "28733372"
},
{
"input": "1000000 1000000",
"output": "38"
},
{
"input": "222145 353252",
"output": "3860750"
},
{
"input": "2 1000000",
"output": "28733370"
},
{
"input": "1 999999",
"output": "28733334"
},
{
"input": "192 200",
"output": "122"
}
] | 1,453,390,412
| 2,011
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <bits/stdc++.h>
using namespace std;
int main() {
cin.tie(0);
int a, b;
int r = 0;
cin>>a>>b;
int k[10] = {6, 2, 5, 5, 4, 5, 6, 3, 7, 6};
for (int i=a;i < b+1; i++) {
int t = i;
while(t>9) {
r += k[t % 10];
t /= 10;
}
r += k[t % 10];
}
cout << r;
}
|
Title: Grandfather Dovlet’s calculator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once Max found an electronic calculator from his grandfather Dovlet's chest. He noticed that the numbers were written with seven-segment indicators ([https://en.wikipedia.org/wiki/Seven-segment_display](https://en.wikipedia.org/wiki/Seven-segment_display)).
Max starts to type all the values from *a* to *b*. After typing each number Max resets the calculator. Find the total number of segments printed on the calculator.
For example if *a*<==<=1 and *b*<==<=3 then at first the calculator will print 2 segments, then — 5 segments and at last it will print 5 segments. So the total number of printed segments is 12.
Input Specification:
The only line contains two integers *a*,<=*b* (1<=≤<=*a*<=≤<=*b*<=≤<=106) — the first and the last number typed by Max.
Output Specification:
Print the only integer *a* — the total number of printed segments.
Demo Input:
['1 3\n', '10 15\n']
Demo Output:
['12\n', '39\n']
Note:
none
|
```python
#include <bits/stdc++.h>
using namespace std;
int main() {
cin.tie(0);
int a, b;
int r = 0;
cin>>a>>b;
int k[10] = {6, 2, 5, 5, 4, 5, 6, 3, 7, 6};
for (int i=a;i < b+1; i++) {
int t = i;
while(t>9) {
r += k[t % 10];
t /= 10;
}
r += k[t % 10];
}
cout << r;
}
```
| -1
|
|
496
|
C
|
Removing Columns
|
PROGRAMMING
| 1,500
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
You are given an *n*<=×<=*m* rectangular table consisting of lower case English letters. In one operation you can completely remove one column from the table. The remaining parts are combined forming a new table. For example, after removing the second column from the table
we obtain the table:
A table is called good if its rows are ordered from top to bottom lexicographically, i.e. each row is lexicographically no larger than the following one. Determine the minimum number of operations of removing a column needed to make a given table good.
|
The first line contains two integers — *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Next *n* lines contain *m* small English letters each — the characters of the table.
|
Print a single number — the minimum number of columns that you need to remove in order to make the table good.
|
[
"1 10\ncodeforces\n",
"4 4\ncase\ncare\ntest\ncode\n",
"5 4\ncode\nforc\nesco\ndefo\nrces\n"
] |
[
"0\n",
"2\n",
"4\n"
] |
In the first sample the table is already good.
In the second sample you may remove the first and third column.
In the third sample you have to remove all the columns (note that the table where all rows are empty is considered good by definition).
Let strings *s* and *t* have equal length. Then, *s* is lexicographically larger than *t* if they are not equal and the character following the largest common prefix of *s* and *t* (the prefix may be empty) in *s* is alphabetically larger than the corresponding character of *t*.
| 1,750
|
[
{
"input": "1 10\ncodeforces",
"output": "0"
},
{
"input": "4 4\ncase\ncare\ntest\ncode",
"output": "2"
},
{
"input": "5 4\ncode\nforc\nesco\ndefo\nrces",
"output": "4"
},
{
"input": "2 2\nfb\nye",
"output": "0"
},
{
"input": "5 5\nrzrzh\nrzrzh\nrzrzh\nrzrzh\nrzrzh",
"output": "0"
},
{
"input": "10 10\nddorannorz\nmdrnzqvqgo\ngdtdjmlsuf\neoxbrntqdp\nhribwlslgo\newlqrontvk\nnxibmnawnh\nvxiwdjvdom\nhyhhewmzmp\niysgvzayst",
"output": "1"
},
{
"input": "9 7\nygqartj\nlgwxlqv\nancjjpr\nwnnhkpx\ncnnhvty\nxsfrbqp\nxsolyne\nbsoojiq\nxstetjb",
"output": "1"
},
{
"input": "4 50\nulkteempxafxafcvfwmwhsixwzgbmubcqqceevbbwijeerqbsj\neyqxsievaratndjoekltlqwppfgcukjwxdxexhejbfhzklppkk\npskatxpbjdbmjpwhussetytneohgzxgirluwnbraxtxmaupuid\neappatavdzktqlrjqttmwwroathnulubpjgsjazcycecwmxwvn",
"output": "20"
},
{
"input": "5 50\nvlrkwhvbigkhihwqjpvmohdsszvndheqlmdsspkkxxiedobizr\nmhnzwdefqmttclfxocdmvvtdjtvqhmdllrtrrlnewuqowmtrmp\nrihlhxrqfhpcddslxepesvjqmlqgwyehvxjcsytevujfegeewh\nqrdyiymanvbdjomyruspreihahjhgkcixwowfzczundxqydldq\nkgnrbjlrmkuoiuzeiqwhnyjpuzfnsinqiamlnuzksrdnlvaxjd",
"output": "50"
},
{
"input": "100 1\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\ni\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nv\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx\nx",
"output": "0"
},
{
"input": "1 100\nteloaetuldspjqdlcktjlishwynmjjhlomvemhoyyplbltfwmrlnazbbjvyvwvoxjvvoadkznvxqubgwesoxrznvbdizjdzixecb",
"output": "0"
},
{
"input": "4 100\ngdgmmejiigzsmlarrnfsypvlbutvoxazcigpcospgztqkowfhhbnnbxxrbmwbxwkvxlxzabjjjdtbebedukdelooqlxnadjwjpnp\ndmtsnsbsfdzqvydxcdcnkkfcbseicxhvclsligbhqlkccwujpirymoshkqcosbtlxdypsdqkqaolrqtiibymavcwmbfryttdckhw\njtdmpdljcpciuuoznvqqmafvoqychzfslmwqouuarxctunlzegxsucrwontjplkkxhgixgdbvnewphnatxnwqxqshcexpxlyjuwq\nvhdtvexkyhjmahejbhyfeaompjkdvxmbtdbmvrxrixhnkkjgyvfbxlviatbikfejnqhkrtafftmsgyznpsfxsnzaqdzhxridzilo",
"output": "4"
},
{
"input": "5 2\nab\ndc\ngd\ngc\nhx",
"output": "1"
},
{
"input": "2 1\nb\na",
"output": "1"
},
{
"input": "4 3\nabd\nacc\nbdx\nbcy",
"output": "2"
},
{
"input": "4 2\nad\nac\nbd\nbc",
"output": "1"
},
{
"input": "3 3\naac\nabb\nbba",
"output": "0"
},
{
"input": "3 3\nadc\nbdb\ncda",
"output": "0"
},
{
"input": "4 3\nabz\ndby\ngbx\nhbw",
"output": "0"
},
{
"input": "3 3\naac\nbab\ncaa",
"output": "0"
},
{
"input": "5 6\naaaeaa\nababab\nacacac\nadadad\naeaeae",
"output": "0"
},
{
"input": "3 2\naa\nbc\nba",
"output": "1"
},
{
"input": "3 3\naaz\ndaa\nbaa",
"output": "2"
},
{
"input": "3 3\nabc\nbbb\ncba",
"output": "0"
},
{
"input": "2 3\naxc\nbxa",
"output": "0"
}
] | 1,689,348,566
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
print("_RANDOM_GUESS_1689348566.139502")# 1689348566.1395268
|
Title: Removing Columns
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an *n*<=×<=*m* rectangular table consisting of lower case English letters. In one operation you can completely remove one column from the table. The remaining parts are combined forming a new table. For example, after removing the second column from the table
we obtain the table:
A table is called good if its rows are ordered from top to bottom lexicographically, i.e. each row is lexicographically no larger than the following one. Determine the minimum number of operations of removing a column needed to make a given table good.
Input Specification:
The first line contains two integers — *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Next *n* lines contain *m* small English letters each — the characters of the table.
Output Specification:
Print a single number — the minimum number of columns that you need to remove in order to make the table good.
Demo Input:
['1 10\ncodeforces\n', '4 4\ncase\ncare\ntest\ncode\n', '5 4\ncode\nforc\nesco\ndefo\nrces\n']
Demo Output:
['0\n', '2\n', '4\n']
Note:
In the first sample the table is already good.
In the second sample you may remove the first and third column.
In the third sample you have to remove all the columns (note that the table where all rows are empty is considered good by definition).
Let strings *s* and *t* have equal length. Then, *s* is lexicographically larger than *t* if they are not equal and the character following the largest common prefix of *s* and *t* (the prefix may be empty) in *s* is alphabetically larger than the corresponding character of *t*.
|
```python
print("_RANDOM_GUESS_1689348566.139502")# 1689348566.1395268
```
| 0
|
|
496
|
B
|
Secret Combination
|
PROGRAMMING
| 1,500
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068.
You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display.
The second line contains *n* digits — the initial state of the display.
|
Print a single line containing *n* digits — the desired state of the display containing the smallest possible number.
|
[
"3\n579\n",
"4\n2014\n"
] |
[
"024\n",
"0142\n"
] |
none
| 1,000
|
[
{
"input": "3\n579",
"output": "024"
},
{
"input": "4\n2014",
"output": "0142"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n039",
"output": "014"
},
{
"input": "4\n4444",
"output": "0000"
},
{
"input": "5\n46802",
"output": "02468"
},
{
"input": "10\n4447444444",
"output": "0000000003"
},
{
"input": "10\n5810438174",
"output": "0147609473"
},
{
"input": "30\n027027027027027027027027027027",
"output": "027027027027027027027027027027"
},
{
"input": "50\n41012516454101251645410125164541012516454101251645",
"output": "01076781720107678172010767817201076781720107678172"
},
{
"input": "72\n464553044645330446455304464553064645530445455304464553044645530446455304",
"output": "001011960020119600201196002011960020119600201996002011960020119620201196"
},
{
"input": "100\n2144315253572020279108092911160072328496568665545836825277616363478721946398140227406814602154768031",
"output": "0005996121738545755443472571416650525236761083528703911639570359104365792010332041424619191680979818"
},
{
"input": "200\n79025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544",
"output": "00274325854479025531557298703099245700860027432585447902553155729870309924570086002743258544790255315572987030992457008600274325854479025531557298703099245700860027432585447902553155729870309924570086"
},
{
"input": "100\n6669666666666666666866266666666666666666666666666666666666666666626666666666666966666766665667666656",
"output": "0000000000000000000000000000000000000000006000000000000030000010000900100009000030000000000000002006"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,639,721,170
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 61
| 1,638,400
|
import sys
def read_input(input_path=None):
if input_path is None:
f = sys.stdin
else:
f = open(input_path, 'r')
n = int(f.readline())
key = f.readline().strip()
return n, key
def sol(n, key):
ph = key
t = []
for i in range(10):
dh = ph
ph = ""
l = []
for i in range(0, n):
b = int(dh[i])
if ((b + 1) > 9):
c = b + 1 - 10
else:
c = b + 1
ph += str(c)
l.append(dh[i + 1:] + dh[:i + 1])
t.append(min(min(l), ph))
return [f"{min(t)}"]
def solve(input_path=None):
return sol(*read_input(input_path))
def main():
for line in sol(*read_input()):
print(f"{line}")
if __name__ == '__main__':
main()
|
Title: Secret Combination
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You got a box with a combination lock. The lock has a display showing *n* digits. There are two buttons on the box, each button changes digits on the display. You have quickly discovered that the first button adds 1 to all the digits (all digits 9 become digits 0), and the second button shifts all the digits on the display one position to the right (the last digit becomes the first one). For example, if the display is currently showing number 579, then if we push the first button, the display will show 680, and if after that we push the second button, the display will show 068.
You know that the lock will open if the display is showing the smallest possible number that can be obtained by pushing the buttons in some order. The leading zeros are ignored while comparing numbers. Now your task is to find the desired number.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of digits on the display.
The second line contains *n* digits — the initial state of the display.
Output Specification:
Print a single line containing *n* digits — the desired state of the display containing the smallest possible number.
Demo Input:
['3\n579\n', '4\n2014\n']
Demo Output:
['024\n', '0142\n']
Note:
none
|
```python
import sys
def read_input(input_path=None):
if input_path is None:
f = sys.stdin
else:
f = open(input_path, 'r')
n = int(f.readline())
key = f.readline().strip()
return n, key
def sol(n, key):
ph = key
t = []
for i in range(10):
dh = ph
ph = ""
l = []
for i in range(0, n):
b = int(dh[i])
if ((b + 1) > 9):
c = b + 1 - 10
else:
c = b + 1
ph += str(c)
l.append(dh[i + 1:] + dh[:i + 1])
t.append(min(min(l), ph))
return [f"{min(t)}"]
def solve(input_path=None):
return sol(*read_input(input_path))
def main():
for line in sol(*read_input()):
print(f"{line}")
if __name__ == '__main__':
main()
```
| 3
|
|
14
|
A
|
Letter
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Letter
|
1
|
64
|
A boy Bob likes to draw. Not long ago he bought a rectangular graph (checked) sheet with *n* rows and *m* columns. Bob shaded some of the squares on the sheet. Having seen his masterpiece, he decided to share it with his elder brother, who lives in Flatland. Now Bob has to send his picture by post, but because of the world economic crisis and high oil prices, he wants to send his creation, but to spend as little money as possible. For each sent square of paper (no matter whether it is shaded or not) Bob has to pay 3.14 burles. Please, help Bob cut out of his masterpiece a rectangle of the minimum cost, that will contain all the shaded squares. The rectangle's sides should be parallel to the sheet's sides.
|
The first line of the input data contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50), *n* — amount of lines, and *m* — amount of columns on Bob's sheet. The following *n* lines contain *m* characters each. Character «.» stands for a non-shaded square on the sheet, and «*» — for a shaded square. It is guaranteed that Bob has shaded at least one square.
|
Output the required rectangle of the minimum cost. Study the output data in the sample tests to understand the output format better.
|
[
"6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..\n",
"3 3\n***\n*.*\n***\n"
] |
[
"***\n*..\n***\n*..\n***\n",
"***\n*.*\n***\n"
] |
none
| 0
|
[
{
"input": "6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..",
"output": "***\n*..\n***\n*..\n***"
},
{
"input": "3 3\n***\n*.*\n***",
"output": "***\n*.*\n***"
},
{
"input": "1 1\n*",
"output": "*"
},
{
"input": "2 1\n*\n*",
"output": "*\n*"
},
{
"input": "5 1\n.\n*\n.\n.\n.",
"output": "*"
},
{
"input": "1 6\n*****.",
"output": "*****"
},
{
"input": "2 2\n..\n*.",
"output": "*"
},
{
"input": "8 2\n..\n..\n..\n..\n..\n*.\n..\n..",
"output": "*"
},
{
"input": "50 1\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "*\n.\n*\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n*"
},
{
"input": "2 1\n*\n.",
"output": "*"
},
{
"input": "5 1\n*\n*\n*\n*\n*",
"output": "*\n*\n*\n*\n*"
},
{
"input": "2 2\n*.\n..",
"output": "*"
},
{
"input": "3 4\n...*\n*...\n..*.",
"output": "...*\n*...\n..*."
},
{
"input": "8 2\n**\n**\n**\n**\n**\n**\n**\n**",
"output": "**\n**\n**\n**\n**\n**\n**\n**"
},
{
"input": "50 1\n.\n*\n*\n*\n.\n.\n*\n.\n*\n*\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n.\n.\n*\n*\n.\n*\n*\n.\n.\n.\n.\n*\n*\n.\n.\n.\n.\n.\n.",
"output": "*\n*\n*\n.\n.\n*\n.\n*\n*\n*\n*\n*\n*\n*\n.\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*\n.\n.\n.\n.\n*\n*\n.\n*\n*\n.\n.\n.\n.\n*\n*"
}
] | 1,560,868,298
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 278
| 102,400
|
n,m=map(int,input().split())
d=[]
for i in range(n):
s=input()
s=list(s)
d.append(s)
minc=m
maxc=0
minr=n
maxr=0
for i in range(n):
if "*" in d[i]:
if i<minr:
minr=i
if i>maxr:
maxr=i
for j in range(m):
if d[i][j]=="*":
if j<minc:
minc=j
if j>maxc:
maxc=j
for i in range(minr,maxr+1):
es=""
for j in range(minc,maxc+1):
es+=d[i][j]
print(es)
|
Title: Letter
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
A boy Bob likes to draw. Not long ago he bought a rectangular graph (checked) sheet with *n* rows and *m* columns. Bob shaded some of the squares on the sheet. Having seen his masterpiece, he decided to share it with his elder brother, who lives in Flatland. Now Bob has to send his picture by post, but because of the world economic crisis and high oil prices, he wants to send his creation, but to spend as little money as possible. For each sent square of paper (no matter whether it is shaded or not) Bob has to pay 3.14 burles. Please, help Bob cut out of his masterpiece a rectangle of the minimum cost, that will contain all the shaded squares. The rectangle's sides should be parallel to the sheet's sides.
Input Specification:
The first line of the input data contains numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50), *n* — amount of lines, and *m* — amount of columns on Bob's sheet. The following *n* lines contain *m* characters each. Character «.» stands for a non-shaded square on the sheet, and «*» — for a shaded square. It is guaranteed that Bob has shaded at least one square.
Output Specification:
Output the required rectangle of the minimum cost. Study the output data in the sample tests to understand the output format better.
Demo Input:
['6 7\n.......\n..***..\n..*....\n..***..\n..*....\n..***..\n', '3 3\n***\n*.*\n***\n']
Demo Output:
['***\n*..\n***\n*..\n***\n', '***\n*.*\n***\n']
Note:
none
|
```python
n,m=map(int,input().split())
d=[]
for i in range(n):
s=input()
s=list(s)
d.append(s)
minc=m
maxc=0
minr=n
maxr=0
for i in range(n):
if "*" in d[i]:
if i<minr:
minr=i
if i>maxr:
maxr=i
for j in range(m):
if d[i][j]=="*":
if j<minc:
minc=j
if j>maxc:
maxc=j
for i in range(minr,maxr+1):
es=""
for j in range(minc,maxc+1):
es+=d[i][j]
print(es)
```
| 3.860237
|
705
|
A
|
Hulk
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
|
Print Dr.Banner's feeling in one line.
|
[
"1\n",
"2\n",
"3\n"
] |
[
"I hate it\n",
"I hate that I love it\n",
"I hate that I love that I hate it\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "I hate it"
},
{
"input": "2",
"output": "I hate that I love it"
},
{
"input": "3",
"output": "I hate that I love that I hate it"
},
{
"input": "4",
"output": "I hate that I love that I hate that I love it"
},
{
"input": "5",
"output": "I hate that I love that I hate that I love that I hate it"
},
{
"input": "10",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "18",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "19",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "76",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "77",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "81",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "82",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "85",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "86",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "99",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "98",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "33",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "34",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "57",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
}
] | 1,694,592,705
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 46
| 0
|
sentences = (['I hate', 'I love'] * 50)[:int(input())]
print(*sentences, sep=' that ', end=' it')
|
Title: Hulk
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Output Specification:
Print Dr.Banner's feeling in one line.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n']
Note:
none
|
```python
sentences = (['I hate', 'I love'] * 50)[:int(input())]
print(*sentences, sep=' that ', end=' it')
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Slastyona and her loyal dog Pushok are playing a meaningless game that is indeed very interesting.
The game consists of multiple rounds. Its rules are very simple: in each round, a natural number *k* is chosen. Then, the one who says (or barks) it faster than the other wins the round. After that, the winner's score is multiplied by *k*2, and the loser's score is multiplied by *k*. In the beginning of the game, both Slastyona and Pushok have scores equal to one.
Unfortunately, Slastyona had lost her notepad where the history of all *n* games was recorded. She managed to recall the final results for each games, though, but all of her memories of them are vague. Help Slastyona verify their correctness, or, to put it another way, for each given pair of scores determine whether it was possible for a game to finish with such result or not.
|
In the first string, the number of games *n* (1<=≤<=*n*<=≤<=350000) is given.
Each game is represented by a pair of scores *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) – the results of Slastyona and Pushok, correspondingly.
|
For each pair of scores, answer "Yes" if it's possible for a game to finish with given score, and "No" otherwise.
You can output each letter in arbitrary case (upper or lower).
|
[
"6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000\n"
] |
[
"Yes\nYes\nYes\nNo\nNo\nYes\n"
] |
First game might have been consisted of one round, in which the number 2 would have been chosen and Pushok would have won.
The second game needs exactly two rounds to finish with such result: in the first one, Slastyona would have said the number 5, and in the second one, Pushok would have barked the number 3.
| 0
|
[
{
"input": "6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000",
"output": "Yes\nYes\nYes\nNo\nNo\nYes"
},
{
"input": "3\n1 1\n8 27\n1000 1331",
"output": "Yes\nNo\nNo"
},
{
"input": "1\n12004 18012002",
"output": "Yes"
},
{
"input": "1\n3331 11095561",
"output": "Yes"
},
{
"input": "1\n2 3",
"output": "No"
},
{
"input": "1\n1062961 1031",
"output": "Yes"
},
{
"input": "1\n6 12",
"output": "No"
},
{
"input": "1\n3 1",
"output": "No"
},
{
"input": "1\n3 10",
"output": "No"
},
{
"input": "1\n31159 970883281",
"output": "Yes"
},
{
"input": "1\n9907 98148649",
"output": "Yes"
},
{
"input": "1\n16 8",
"output": "No"
},
{
"input": "1\n90 72",
"output": "No"
}
] | 1,501,909,830
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 1
| 1,000
| 4,608,000
|
def gameLegit(a, b):
prod = a * b
i = 1
cube = i**3
while cube < prod:
i += 1
cube = i**3
if cube == prod:
if a % i == 0 and b % i == 0:
return True
return False
n = int(input())
for i in range(0, n):
a, b = [int(x) for x in input().split(' ')]
if gameLegit(a, b):
print("Yes")
else:
print("No")
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Slastyona and her loyal dog Pushok are playing a meaningless game that is indeed very interesting.
The game consists of multiple rounds. Its rules are very simple: in each round, a natural number *k* is chosen. Then, the one who says (or barks) it faster than the other wins the round. After that, the winner's score is multiplied by *k*2, and the loser's score is multiplied by *k*. In the beginning of the game, both Slastyona and Pushok have scores equal to one.
Unfortunately, Slastyona had lost her notepad where the history of all *n* games was recorded. She managed to recall the final results for each games, though, but all of her memories of them are vague. Help Slastyona verify their correctness, or, to put it another way, for each given pair of scores determine whether it was possible for a game to finish with such result or not.
Input Specification:
In the first string, the number of games *n* (1<=≤<=*n*<=≤<=350000) is given.
Each game is represented by a pair of scores *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) – the results of Slastyona and Pushok, correspondingly.
Output Specification:
For each pair of scores, answer "Yes" if it's possible for a game to finish with given score, and "No" otherwise.
You can output each letter in arbitrary case (upper or lower).
Demo Input:
['6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000\n']
Demo Output:
['Yes\nYes\nYes\nNo\nNo\nYes\n']
Note:
First game might have been consisted of one round, in which the number 2 would have been chosen and Pushok would have won.
The second game needs exactly two rounds to finish with such result: in the first one, Slastyona would have said the number 5, and in the second one, Pushok would have barked the number 3.
|
```python
def gameLegit(a, b):
prod = a * b
i = 1
cube = i**3
while cube < prod:
i += 1
cube = i**3
if cube == prod:
if a % i == 0 and b % i == 0:
return True
return False
n = int(input())
for i in range(0, n):
a, b = [int(x) for x in input().split(' ')]
if gameLegit(a, b):
print("Yes")
else:
print("No")
```
| 0
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,636,789,527
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 61
| 4,300,800
|
a=input()
b=input()
i=0
x=''
while i<len(a):
if a[i]!=b[i]:
x+='1'
else:
x+='0'
i+=1
print(x)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
a=input()
b=input()
i=0
x=''
while i<len(a):
if a[i]!=b[i]:
x+='1'
else:
x+='0'
i+=1
print(x)
```
| 3.976739
|
697
|
A
|
Pineapple Incident
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc.
Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time.
|
The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively.
|
Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output.
|
[
"3 10 4\n",
"3 10 3\n",
"3 8 51\n",
"3 8 52\n"
] |
[
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] |
In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3.
In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
| 500
|
[
{
"input": "3 10 4",
"output": "NO"
},
{
"input": "3 10 3",
"output": "YES"
},
{
"input": "3 8 51",
"output": "YES"
},
{
"input": "3 8 52",
"output": "YES"
},
{
"input": "456947336 740144 45",
"output": "NO"
},
{
"input": "33 232603 599417964",
"output": "YES"
},
{
"input": "4363010 696782227 701145238",
"output": "YES"
},
{
"input": "9295078 2 6",
"output": "NO"
},
{
"input": "76079 281367 119938421",
"output": "YES"
},
{
"input": "93647 7 451664565",
"output": "YES"
},
{
"input": "5 18553 10908",
"output": "NO"
},
{
"input": "6 52 30",
"output": "NO"
},
{
"input": "6431 855039 352662",
"output": "NO"
},
{
"input": "749399100 103031711 761562532",
"output": "NO"
},
{
"input": "21 65767 55245",
"output": "NO"
},
{
"input": "4796601 66897 4860613",
"output": "NO"
},
{
"input": "8 6728951 860676",
"output": "NO"
},
{
"input": "914016 6 914019",
"output": "NO"
},
{
"input": "60686899 78474 60704617",
"output": "NO"
},
{
"input": "3 743604 201724",
"output": "NO"
},
{
"input": "571128 973448796 10",
"output": "NO"
},
{
"input": "688051712 67 51",
"output": "NO"
},
{
"input": "74619 213344 6432326",
"output": "NO"
},
{
"input": "6947541 698167 6",
"output": "NO"
},
{
"input": "83 6 6772861",
"output": "NO"
},
{
"input": "251132 67561 135026988",
"output": "NO"
},
{
"input": "8897216 734348516 743245732",
"output": "YES"
},
{
"input": "50 64536 153660266",
"output": "YES"
},
{
"input": "876884 55420 971613604",
"output": "YES"
},
{
"input": "0 6906451 366041903",
"output": "YES"
},
{
"input": "11750 8 446010134",
"output": "YES"
},
{
"input": "582692707 66997 925047377",
"output": "YES"
},
{
"input": "11 957526890 957526901",
"output": "YES"
},
{
"input": "556888 514614196 515171084",
"output": "YES"
},
{
"input": "6 328006 584834704",
"output": "YES"
},
{
"input": "4567998 4 204966403",
"output": "YES"
},
{
"input": "60 317278 109460971",
"output": "YES"
},
{
"input": "906385 342131991 685170368",
"output": "YES"
},
{
"input": "1 38 902410512",
"output": "YES"
},
{
"input": "29318 787017 587931018",
"output": "YES"
},
{
"input": "351416375 243431 368213115",
"output": "YES"
},
{
"input": "54 197366062 197366117",
"output": "YES"
},
{
"input": "586389 79039 850729874",
"output": "YES"
},
{
"input": "723634470 2814619 940360134",
"output": "YES"
},
{
"input": "0 2 0",
"output": "YES"
},
{
"input": "0 2 1",
"output": "NO"
},
{
"input": "0 2 2",
"output": "YES"
},
{
"input": "0 2 3",
"output": "YES"
},
{
"input": "0 2 1000000000",
"output": "YES"
},
{
"input": "0 10 23",
"output": "NO"
},
{
"input": "0 2 999999999",
"output": "YES"
},
{
"input": "10 5 11",
"output": "NO"
},
{
"input": "1 2 1000000000",
"output": "YES"
},
{
"input": "1 10 20",
"output": "NO"
},
{
"input": "1 2 999999937",
"output": "YES"
},
{
"input": "10 3 5",
"output": "NO"
},
{
"input": "3 2 5",
"output": "YES"
},
{
"input": "0 4 0",
"output": "YES"
},
{
"input": "0 215 403",
"output": "NO"
},
{
"input": "5 2 10",
"output": "YES"
},
{
"input": "0 2 900000000",
"output": "YES"
},
{
"input": "0 79 4000",
"output": "NO"
},
{
"input": "5 1000 1000",
"output": "NO"
},
{
"input": "1 5 103",
"output": "NO"
},
{
"input": "5 2 6",
"output": "NO"
},
{
"input": "120 2 1000000000",
"output": "YES"
},
{
"input": "2 2 1000000000",
"output": "YES"
},
{
"input": "5 5 13",
"output": "NO"
},
{
"input": "10 5 15",
"output": "YES"
},
{
"input": "11 2 0",
"output": "NO"
},
{
"input": "3 8 53",
"output": "NO"
},
{
"input": "2 2 4",
"output": "YES"
},
{
"input": "4 4 0",
"output": "NO"
},
{
"input": "1 2 3",
"output": "YES"
},
{
"input": "5 3 9",
"output": "YES"
},
{
"input": "5 6 19",
"output": "NO"
},
{
"input": "3 10 125",
"output": "NO"
},
{
"input": "5 3 8",
"output": "YES"
},
{
"input": "6 3 9",
"output": "YES"
},
{
"input": "0 3 5",
"output": "NO"
},
{
"input": "5 3 300000035",
"output": "YES"
},
{
"input": "5 2 7",
"output": "YES"
},
{
"input": "1 5 6",
"output": "YES"
},
{
"input": "4 2 6",
"output": "YES"
},
{
"input": "0 3 999999998",
"output": "NO"
},
{
"input": "0 10001 0",
"output": "YES"
},
{
"input": "6 5 3",
"output": "NO"
},
{
"input": "1 5 1000000000",
"output": "NO"
},
{
"input": "1 3 6",
"output": "NO"
},
{
"input": "3 3 1000000000",
"output": "YES"
},
{
"input": "3 3 4",
"output": "NO"
},
{
"input": "3 3 5",
"output": "NO"
},
{
"input": "3 3 0",
"output": "NO"
},
{
"input": "1 2 4",
"output": "YES"
},
{
"input": "5 5 10",
"output": "YES"
}
] | 1,623,441,866
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 95
| 77
| 0
|
t,s,x=map(int,input().split())
a=x-t
b=x-t-1
if(t==x):
print("YES")
else:
if(a>=s)or(b>=s):
if(a>=s)and(a%s==0):
print("YES")
elif((b%s==0)and(b>=s)):
print("YES")
else:
print("NO")
else:
print("NO")
|
Title: Pineapple Incident
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc.
Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time.
Input Specification:
The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively.
Output Specification:
Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output.
Demo Input:
['3 10 4\n', '3 10 3\n', '3 8 51\n', '3 8 52\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3.
In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
|
```python
t,s,x=map(int,input().split())
a=x-t
b=x-t-1
if(t==x):
print("YES")
else:
if(a>=s)or(b>=s):
if(a>=s)and(a%s==0):
print("YES")
elif((b%s==0)and(b>=s)):
print("YES")
else:
print("NO")
else:
print("NO")
```
| 3
|
|
910
|
A
|
The Way to Home
|
PROGRAMMING
| 800
|
[
"dfs and similar",
"dp",
"greedy",
"implementation"
] | null | null |
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
|
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
|
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
|
[
"8 4\n10010101\n",
"4 2\n1001\n",
"8 4\n11100101\n",
"12 3\n101111100101\n"
] |
[
"2\n",
"-1\n",
"3\n",
"4\n"
] |
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
| 500
|
[
{
"input": "8 4\n10010101",
"output": "2"
},
{
"input": "4 2\n1001",
"output": "-1"
},
{
"input": "8 4\n11100101",
"output": "3"
},
{
"input": "12 3\n101111100101",
"output": "4"
},
{
"input": "5 4\n11011",
"output": "1"
},
{
"input": "5 4\n10001",
"output": "1"
},
{
"input": "10 7\n1101111011",
"output": "2"
},
{
"input": "10 9\n1110000101",
"output": "1"
},
{
"input": "10 9\n1100000001",
"output": "1"
},
{
"input": "20 5\n11111111110111101001",
"output": "4"
},
{
"input": "20 11\n11100000111000011011",
"output": "2"
},
{
"input": "20 19\n10100000000000000001",
"output": "1"
},
{
"input": "50 13\n10011010100010100111010000010000000000010100000101",
"output": "5"
},
{
"input": "50 8\n11010100000011001100001100010001110000101100110011",
"output": "8"
},
{
"input": "99 4\n111111111111111111111111111111111111111111111111111111111011111111111111111111111111111111111111111",
"output": "25"
},
{
"input": "99 98\n100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 5\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "20"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111",
"output": "25"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111101111111011111111111111111111111111111",
"output": "25"
},
{
"input": "100 3\n1111110111111111111111111111111111111111101111111111111111111111111101111111111111111111111111111111",
"output": "34"
},
{
"input": "100 8\n1111111111101110111111111111111111111111111111111111111111111111111111110011111111111111011111111111",
"output": "13"
},
{
"input": "100 7\n1011111111111111111011101111111011111101111111111101111011110111111111111111111111110111111011111111",
"output": "15"
},
{
"input": "100 9\n1101111110111110101111111111111111011001110111011101011111111111010101111111100011011111111010111111",
"output": "12"
},
{
"input": "100 6\n1011111011111111111011010110011001010101111110111111000111011011111110101101110110101111110000100111",
"output": "18"
},
{
"input": "100 7\n1110001111101001110011111111111101111101101001010001101000101100000101101101011111111101101000100001",
"output": "16"
},
{
"input": "100 11\n1000010100011100011011100000010011001111011110100100001011010100011011111001101101110110010110001101",
"output": "10"
},
{
"input": "100 9\n1001001110000011100100000001000110111101101010101001000101001010011001101100110011011110110011011111",
"output": "13"
},
{
"input": "100 7\n1010100001110101111011000111000001110100100110110001110110011010100001100100001110111100110000101001",
"output": "18"
},
{
"input": "100 10\n1110110000000110000000101110100000111000001011100000100110010001110111001010101000011000000001011011",
"output": "12"
},
{
"input": "100 13\n1000000100000000100011000010010000101010011110000000001000011000110100001000010001100000011001011001",
"output": "9"
},
{
"input": "100 11\n1000000000100000010000100001000100000000010000100100000000100100001000000001011000110001000000000101",
"output": "12"
},
{
"input": "100 22\n1000100000001010000000000000000001000000100000000000000000010000000000001000000000000000000100000001",
"output": "7"
},
{
"input": "100 48\n1000000000000000011000000000000000000000000000000001100000000000000000000000000000000000000000000001",
"output": "3"
},
{
"input": "100 48\n1000000000000000000000100000000000000000000000000000000000000000000001000000000000000000100000000001",
"output": "3"
},
{
"input": "100 75\n1000000100000000000000000000000000000000000000000000000000000000000000000000000001000000000000000001",
"output": "3"
},
{
"input": "100 73\n1000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 99\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "99"
},
{
"input": "100 2\n1111111111111111111111111111111110111111111111111111111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "100 1\n1111111111111111011111111111111111111111111111111111111111111111111101111111111111111111111111111111",
"output": "-1"
},
{
"input": "100 3\n1111111111111111111111111101111111111111111111111011111111111111111111111111111011111111111111111111",
"output": "33"
},
{
"input": "100 1\n1101111111111111111111101111111111111111111111111111111111111011111111101111101111111111111111111111",
"output": "-1"
},
{
"input": "100 6\n1111111111111111111111101111111101011110001111111111111111110111111111111111111111111110010111111111",
"output": "17"
},
{
"input": "100 2\n1111111101111010110111011011110111101111111011111101010101011111011111111111111011111001101111101111",
"output": "-1"
},
{
"input": "100 8\n1100110101111001101001111000111100110100011110111011001011111110000110101000001110111011100111011011",
"output": "14"
},
{
"input": "100 10\n1000111110100000001001101100000010011100010101001100010011111001001101111110110111101111001010001101",
"output": "11"
},
{
"input": "100 7\n1110000011010001110101011010000011110001000000011101110111010110001000011101111010010001101111110001",
"output": "-1"
},
{
"input": "100 3\n1111010001000001011011000011001111000100101000101101000010111101111000010000011110110011001101010111",
"output": "-1"
},
{
"input": "100 9\n1101010101101100010111011000010100001010000101010011001001100010110110000000010000101000000001101101",
"output": "13"
},
{
"input": "100 14\n1010100000000000010101000010001100000000000011100010000001000001011010001110001010100000100001101101",
"output": "9"
},
{
"input": "100 13\n1000000001101001110000010000011001000000000000001010000000100001001010000000000000000100010000000001",
"output": "-1"
},
{
"input": "100 18\n1000000000000000110000000000000000010000000001000001000001000000000100000000000010000000000000000001",
"output": "-1"
},
{
"input": "100 32\n1000000000000000000000000001000000000000000000000101000000000000000000000000000000000001000000000001",
"output": "-1"
},
{
"input": "100 79\n1000000001000000000101000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 41\n1000000000000000000000000000000000010000000000000000000000000000000000000000100000000000000000000001",
"output": "3"
},
{
"input": "100 82\n1000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 96\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "-1"
},
{
"input": "43 30\n1001000001111111010100100100110101011101101",
"output": "2"
},
{
"input": "7 1\n1111111",
"output": "6"
},
{
"input": "9 3\n101000001",
"output": "-1"
},
{
"input": "10 3\n1100000001",
"output": "-1"
},
{
"input": "8 2\n10000101",
"output": "-1"
},
{
"input": "2 1\n11",
"output": "1"
}
] | 1,606,562,588
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 37
| 108
| 0
|
def dfs(poc, duz):
if poc >= n-1:
return duz
if s[poc] == '0':
return -1
for i in range(d, 1, -1):
temp = dfs(poc+i, duz+1)
if temp >= 0:
return temp
return -1
n, d = map(int, input().split())
s = input()
print(dfs(0, 0))
|
Title: The Way to Home
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
Input Specification:
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
Output Specification:
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
Demo Input:
['8 4\n10010101\n', '4 2\n1001\n', '8 4\n11100101\n', '12 3\n101111100101\n']
Demo Output:
['2\n', '-1\n', '3\n', '4\n']
Note:
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
|
```python
def dfs(poc, duz):
if poc >= n-1:
return duz
if s[poc] == '0':
return -1
for i in range(d, 1, -1):
temp = dfs(poc+i, duz+1)
if temp >= 0:
return temp
return -1
n, d = map(int, input().split())
s = input()
print(dfs(0, 0))
```
| 0
|
|
456
|
A
|
Laptops
|
PROGRAMMING
| 1,100
|
[
"sortings"
] | null | null |
One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct.
|
If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes).
|
[
"2\n1 2\n2 1\n"
] |
[
"Happy Alex\n"
] |
none
| 500
|
[
{
"input": "2\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "2\n1 1\n2 2",
"output": "Poor Alex"
},
{
"input": "3\n2 2\n3 3\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n3 3\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "1\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n2 3\n1 1\n3 2",
"output": "Happy Alex"
},
{
"input": "4\n4 1\n3 2\n2 3\n1 4",
"output": "Happy Alex"
},
{
"input": "2\n2 1\n1 2",
"output": "Happy Alex"
},
{
"input": "3\n3 2\n1 1\n2 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 1\n3 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
}
] | 1,665,670,197
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 1,000
| 7,680,000
|
n = int(input())
laptops = []
for _ in range(n):
laptops.append([int(x) for x in input().split()])
laptops.sort()
for i in range(len(laptops)):
for j in range(i+1, len(laptops)): # higher price
if laptops[j][1] < laptops[i][1]: # lower quality
print('Happy Alex')
exit()
print('Poor Alex')
|
Title: Laptops
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct.
Output Specification:
If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes).
Demo Input:
['2\n1 2\n2 1\n']
Demo Output:
['Happy Alex\n']
Note:
none
|
```python
n = int(input())
laptops = []
for _ in range(n):
laptops.append([int(x) for x in input().split()])
laptops.sort()
for i in range(len(laptops)):
for j in range(i+1, len(laptops)): # higher price
if laptops[j][1] < laptops[i][1]: # lower quality
print('Happy Alex')
exit()
print('Poor Alex')
```
| 0
|
|
490
|
A
|
Team Olympiad
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
The School №0 of the capital of Berland has *n* children studying in it. All the children in this school are gifted: some of them are good at programming, some are good at maths, others are good at PE (Physical Education). Hence, for each child we know value *t**i*:
- *t**i*<==<=1, if the *i*-th child is good at programming, - *t**i*<==<=2, if the *i*-th child is good at maths, - *t**i*<==<=3, if the *i*-th child is good at PE
Each child happens to be good at exactly one of these three subjects.
The Team Scientific Decathlon Olympias requires teams of three students. The school teachers decided that the teams will be composed of three children that are good at different subjects. That is, each team must have one mathematician, one programmer and one sportsman. Of course, each child can be a member of no more than one team.
What is the maximum number of teams that the school will be able to present at the Olympiad? How should the teams be formed for that?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of children in the school. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=3), where *t**i* describes the skill of the *i*-th child.
|
In the first line output integer *w* — the largest possible number of teams.
Then print *w* lines, containing three numbers in each line. Each triple represents the indexes of the children forming the team. You can print both the teams, and the numbers in the triplets in any order. The children are numbered from 1 to *n* in the order of their appearance in the input. Each child must participate in no more than one team. If there are several solutions, print any of them.
If no teams can be compiled, print the only line with value *w* equal to 0.
|
[
"7\n1 3 1 3 2 1 2\n",
"4\n2 1 1 2\n"
] |
[
"2\n3 5 2\n6 7 4\n",
"0\n"
] |
none
| 500
|
[
{
"input": "7\n1 3 1 3 2 1 2",
"output": "2\n3 5 2\n6 7 4"
},
{
"input": "4\n2 1 1 2",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "1\n1 2 3"
},
{
"input": "12\n3 3 3 3 3 3 3 3 1 3 3 2",
"output": "1\n9 12 2"
},
{
"input": "60\n3 3 1 2 2 1 3 1 1 1 3 2 2 2 3 3 1 3 2 3 2 2 1 3 3 2 3 1 2 2 2 1 3 2 1 1 3 3 1 1 1 3 1 2 1 1 3 3 3 2 3 2 3 2 2 2 1 1 1 2",
"output": "20\n6 60 1\n17 44 20\n3 5 33\n36 21 42\n59 14 2\n58 26 49\n9 29 48\n23 19 24\n10 30 37\n41 54 15\n45 31 27\n57 55 38\n39 12 25\n35 34 11\n32 52 7\n8 50 18\n43 4 53\n46 56 51\n40 22 16\n28 13 47"
},
{
"input": "12\n3 1 1 1 1 1 1 2 1 1 1 1",
"output": "1\n3 8 1"
},
{
"input": "22\n2 2 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 1 2 2 2 2",
"output": "1\n18 2 11"
},
{
"input": "138\n2 3 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 1 2 2 1 2 2 2 2 2 2 2 2 2 2 2 1 2 3 2 2 2 1 2 3 2 2 2 3 1 3 2 3 2 3 2 2 2 2 3 2 2 2 2 2 1 2 2 3 2 2 3 2 1 2 2 2 2 2 3 1 2 2 2 2 2 3 2 2 3 2 2 2 2 2 1 1 2 3 2 2 2 2 3 2 2 2 2 2 1 2 1 2 2 2 2 2 1 2 3 2 3 2 2 2 1 2 2 2 1 2 2 2 2 1 2 2 2 2 1 3",
"output": "18\n13 91 84\n34 90 48\n11 39 77\n78 129 50\n137 68 119\n132 122 138\n19 12 96\n40 7 2\n22 88 69\n107 73 46\n115 15 52\n127 106 87\n93 92 66\n71 112 117\n63 124 42\n17 70 101\n109 121 57\n123 25 36"
},
{
"input": "203\n2 2 1 2 1 2 2 2 1 2 2 1 1 3 1 2 1 2 1 1 2 3 1 1 2 3 3 2 2 2 1 2 1 1 1 1 1 3 1 1 2 1 1 2 2 2 1 2 2 2 1 2 3 2 1 1 2 2 1 2 1 2 2 1 1 2 2 2 1 1 2 2 1 2 1 2 2 3 2 1 2 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 2 2 2 1 1 1 1 1 1 1 2 2 2 2 2 1 1 1 2 2 2 1 2 2 1 3 2 1 1 1 2 1 1 2 1 1 2 2 2 1 1 2 2 2 1 2 1 3 2 1 2 2 2 1 1 1 2 2 2 1 2 1 1 2 2 2 2 2 1 1 2 1 2 2 1 1 1 1 1 1 2 2 3 1 1 2 3 1 1 1 1 1 1 2 2 1 1 1 2 2 3 2 1 3 1 1 1",
"output": "13\n188 72 14\n137 4 197\n158 76 122\n152 142 26\n104 119 179\n40 63 38\n12 1 78\n17 30 27\n189 60 53\n166 190 144\n129 7 183\n83 41 22\n121 81 200"
},
{
"input": "220\n1 1 3 1 3 1 1 3 1 3 3 3 3 1 3 3 1 3 3 3 3 3 1 1 1 3 1 1 1 3 2 3 3 3 1 1 3 3 1 1 3 3 3 3 1 3 3 1 1 1 2 3 1 1 1 2 3 3 3 2 3 1 1 3 1 1 1 3 2 1 3 2 3 1 1 3 3 3 1 3 1 1 1 3 3 2 1 3 2 1 1 3 3 1 1 1 2 1 1 3 2 1 2 1 1 1 3 1 3 3 1 2 3 3 3 3 1 3 1 1 1 1 2 3 1 1 1 1 1 1 3 2 3 1 3 1 3 1 1 3 1 3 1 3 1 3 1 3 3 2 3 1 3 3 1 3 3 3 3 1 1 3 3 3 3 1 1 3 3 3 2 1 1 1 3 3 1 3 3 3 1 1 1 3 1 3 3 1 1 1 2 3 1 1 3 1 1 1 1 2 3 1 1 2 3 3 1 3 1 3 3 3 3 1 3 2 3 1 1 3",
"output": "20\n198 89 20\n141 56 131\n166 204 19\n160 132 142\n111 112 195\n45 216 92\n6 31 109\n14 150 170\n199 60 18\n173 123 140\n134 69 156\n82 191 85\n126 200 80\n24 97 46\n62 86 149\n214 101 26\n79 171 78\n125 72 118\n172 103 162\n219 51 64"
},
{
"input": "61\n2 3 1 3 2 2 2 3 1 3 2 3 1 2 1 1 2 2 2 2 3 2 3 1 2 1 3 1 3 2 1 1 3 2 1 3 3 3 1 3 3 1 1 3 1 3 2 2 1 2 2 2 1 3 2 3 1 3 3 1 1",
"output": "20\n9 55 2\n24 34 27\n3 5 37\n35 17 41\n61 11 4\n60 19 54\n15 20 59\n26 14 29\n16 22 38\n43 50 12\n49 25 36\n57 51 40\n39 6 33\n32 30 10\n31 48 8\n13 47 23\n45 1 58\n53 52 56\n42 18 21\n28 7 44"
},
{
"input": "5\n1 2 2 3 3",
"output": "1\n1 3 4"
}
] | 1,659,326,097
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 41
| 77
| 3,379,200
|
import sys
from collections import deque
def rs(): return sys.stdin.readline().rstrip()
def ri(): return int(sys.stdin.readline())
def ria(): return deque(map(int, sys.stdin.readline().split()))
def ws(s): sys.stdout.write(s)
def wi(n): sys.stdout.write(str(n) + '\n')
def wia(a): sys.stdout.write('\n'.join([str(x) for x in a]) + '\n')
#--------------------Solution------------------------
n=ri()
lst=ria()
x=deque()
y=deque()
z=deque()
for i in range(n):
if lst[i]==1:
x.append(i)
elif lst[i]==2:
y.append(i)
elif lst[i]==3:
z.append(i)
o=min([len(x),len(y),len(z)])
wi(o)
for i in range(o):
ws(f"{x[i]+1} {y[i]+1} {z[i]+1}\n")
|
Title: Team Olympiad
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The School №0 of the capital of Berland has *n* children studying in it. All the children in this school are gifted: some of them are good at programming, some are good at maths, others are good at PE (Physical Education). Hence, for each child we know value *t**i*:
- *t**i*<==<=1, if the *i*-th child is good at programming, - *t**i*<==<=2, if the *i*-th child is good at maths, - *t**i*<==<=3, if the *i*-th child is good at PE
Each child happens to be good at exactly one of these three subjects.
The Team Scientific Decathlon Olympias requires teams of three students. The school teachers decided that the teams will be composed of three children that are good at different subjects. That is, each team must have one mathematician, one programmer and one sportsman. Of course, each child can be a member of no more than one team.
What is the maximum number of teams that the school will be able to present at the Olympiad? How should the teams be formed for that?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=5000) — the number of children in the school. The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=3), where *t**i* describes the skill of the *i*-th child.
Output Specification:
In the first line output integer *w* — the largest possible number of teams.
Then print *w* lines, containing three numbers in each line. Each triple represents the indexes of the children forming the team. You can print both the teams, and the numbers in the triplets in any order. The children are numbered from 1 to *n* in the order of their appearance in the input. Each child must participate in no more than one team. If there are several solutions, print any of them.
If no teams can be compiled, print the only line with value *w* equal to 0.
Demo Input:
['7\n1 3 1 3 2 1 2\n', '4\n2 1 1 2\n']
Demo Output:
['2\n3 5 2\n6 7 4\n', '0\n']
Note:
none
|
```python
import sys
from collections import deque
def rs(): return sys.stdin.readline().rstrip()
def ri(): return int(sys.stdin.readline())
def ria(): return deque(map(int, sys.stdin.readline().split()))
def ws(s): sys.stdout.write(s)
def wi(n): sys.stdout.write(str(n) + '\n')
def wia(a): sys.stdout.write('\n'.join([str(x) for x in a]) + '\n')
#--------------------Solution------------------------
n=ri()
lst=ria()
x=deque()
y=deque()
z=deque()
for i in range(n):
if lst[i]==1:
x.append(i)
elif lst[i]==2:
y.append(i)
elif lst[i]==3:
z.append(i)
o=min([len(x),len(y),len(z)])
wi(o)
for i in range(o):
ws(f"{x[i]+1} {y[i]+1} {z[i]+1}\n")
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,540,155,511
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 248
| 0
|
lines = int(input())
forces = [[int(f) for f in input().split(' ')] for n in range(lines)]
x = 0
y = 0
z = 0
for f in forces:
x += f[0]
y += f[1]
z += f[2]
if all([x == 0, y == 0, z == 0]):
print('YES')
else:
print('NO')
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
lines = int(input())
forces = [[int(f) for f in input().split(' ')] for n in range(lines)]
x = 0
y = 0
z = 0
for f in forces:
x += f[0]
y += f[1]
z += f[2]
if all([x == 0, y == 0, z == 0]):
print('YES')
else:
print('NO')
```
| 3.938
|
236
|
A
|
Boy or Girl
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
|
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
|
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
|
[
"wjmzbmr\n",
"xiaodao\n",
"sevenkplus\n"
] |
[
"CHAT WITH HER!\n",
"IGNORE HIM!\n",
"CHAT WITH HER!\n"
] |
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
| 500
|
[
{
"input": "wjmzbmr",
"output": "CHAT WITH HER!"
},
{
"input": "xiaodao",
"output": "IGNORE HIM!"
},
{
"input": "sevenkplus",
"output": "CHAT WITH HER!"
},
{
"input": "pezu",
"output": "CHAT WITH HER!"
},
{
"input": "wnemlgppy",
"output": "CHAT WITH HER!"
},
{
"input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn",
"output": "IGNORE HIM!"
},
{
"input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx",
"output": "CHAT WITH HER!"
},
{
"input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt",
"output": "IGNORE HIM!"
},
{
"input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk",
"output": "IGNORE HIM!"
},
{
"input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz",
"output": "IGNORE HIM!"
},
{
"input": "tgcdptnkc",
"output": "IGNORE HIM!"
},
{
"input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi",
"output": "IGNORE HIM!"
},
{
"input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp",
"output": "IGNORE HIM!"
},
{
"input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia",
"output": "IGNORE HIM!"
},
{
"input": "fpellxwskyekoyvrfnuf",
"output": "CHAT WITH HER!"
},
{
"input": "xninyvkuvakfbs",
"output": "IGNORE HIM!"
},
{
"input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak",
"output": "CHAT WITH HER!"
},
{
"input": "kmsk",
"output": "IGNORE HIM!"
},
{
"input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz",
"output": "CHAT WITH HER!"
},
{
"input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq",
"output": "CHAT WITH HER!"
},
{
"input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm",
"output": "IGNORE HIM!"
},
{
"input": "ppcpbnhwoizajrl",
"output": "IGNORE HIM!"
},
{
"input": "sgubujztzwkzvztitssxxxwzanfmddfqvv",
"output": "CHAT WITH HER!"
},
{
"input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw",
"output": "IGNORE HIM!"
},
{
"input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu",
"output": "CHAT WITH HER!"
},
{
"input": "ojjvpnkrxibyevxk",
"output": "CHAT WITH HER!"
},
{
"input": "wjweqcrqfuollfvfbiyriijovweg",
"output": "IGNORE HIM!"
},
{
"input": "hkdbykboclchfdsuovvpknwqr",
"output": "IGNORE HIM!"
},
{
"input": "stjvyfrfowopwfjdveduedqylerqugykyu",
"output": "IGNORE HIM!"
},
{
"input": "rafcaanqytfclvfdegak",
"output": "CHAT WITH HER!"
},
{
"input": "xczn",
"output": "CHAT WITH HER!"
},
{
"input": "arcoaeozyeawbveoxpmafxxzdjldsielp",
"output": "IGNORE HIM!"
},
{
"input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika",
"output": "CHAT WITH HER!"
},
{
"input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh",
"output": "CHAT WITH HER!"
},
{
"input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg",
"output": "CHAT WITH HER!"
},
{
"input": "udlpagtpq",
"output": "CHAT WITH HER!"
},
{
"input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy",
"output": "CHAT WITH HER!"
},
{
"input": "qagzrqjomdwhagkhrjahhxkieijyten",
"output": "CHAT WITH HER!"
},
{
"input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb",
"output": "CHAT WITH HER!"
},
{
"input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr",
"output": "CHAT WITH HER!"
},
{
"input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc",
"output": "IGNORE HIM!"
},
{
"input": "lnpdosnceumubvk",
"output": "IGNORE HIM!"
},
{
"input": "efrk",
"output": "CHAT WITH HER!"
},
{
"input": "temnownneghnrujforif",
"output": "IGNORE HIM!"
},
{
"input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta",
"output": "IGNORE HIM!"
},
{
"input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh",
"output": "IGNORE HIM!"
},
{
"input": "gwntwbpj",
"output": "IGNORE HIM!"
},
{
"input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim",
"output": "IGNORE HIM!"
},
{
"input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd",
"output": "CHAT WITH HER!"
},
{
"input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx",
"output": "IGNORE HIM!"
},
{
"input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks",
"output": "CHAT WITH HER!"
},
{
"input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx",
"output": "CHAT WITH HER!"
},
{
"input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc",
"output": "CHAT WITH HER!"
},
{
"input": "yzlzmesxdttfcztooypjztlgxwcr",
"output": "IGNORE HIM!"
},
{
"input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc",
"output": "IGNORE HIM!"
},
{
"input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq",
"output": "CHAT WITH HER!"
},
{
"input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj",
"output": "IGNORE HIM!"
},
{
"input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom",
"output": "CHAT WITH HER!"
},
{
"input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo",
"output": "CHAT WITH HER!"
},
{
"input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh",
"output": "IGNORE HIM!"
},
{
"input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa",
"output": "CHAT WITH HER!"
},
{
"input": "oh",
"output": "CHAT WITH HER!"
},
{
"input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri",
"output": "IGNORE HIM!"
},
{
"input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp",
"output": "CHAT WITH HER!"
},
{
"input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp",
"output": "CHAT WITH HER!"
},
{
"input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo",
"output": "CHAT WITH HER!"
},
{
"input": "mnmbupgo",
"output": "IGNORE HIM!"
},
{
"input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl",
"output": "IGNORE HIM!"
},
{
"input": "yocxrzspinchmhtmqo",
"output": "CHAT WITH HER!"
},
{
"input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv",
"output": "CHAT WITH HER!"
},
{
"input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad",
"output": "IGNORE HIM!"
},
{
"input": "ubvhyaebyxoghakajqrpqpctwbrfqzli",
"output": "CHAT WITH HER!"
},
{
"input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy",
"output": "IGNORE HIM!"
},
{
"input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd",
"output": "IGNORE HIM!"
},
{
"input": "acrzbavz",
"output": "CHAT WITH HER!"
},
{
"input": "drvzznznvrzskftnrhvvzxcalwutxmdza",
"output": "IGNORE HIM!"
},
{
"input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws",
"output": "CHAT WITH HER!"
},
{
"input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff",
"output": "CHAT WITH HER!"
},
{
"input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu",
"output": "CHAT WITH HER!"
},
{
"input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw",
"output": "IGNORE HIM!"
},
{
"input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy",
"output": "CHAT WITH HER!"
},
{
"input": "rhh",
"output": "CHAT WITH HER!"
},
{
"input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo",
"output": "IGNORE HIM!"
},
{
"input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn",
"output": "CHAT WITH HER!"
},
{
"input": "urigreuzpxnej",
"output": "CHAT WITH HER!"
}
] | 1,699,573,246
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 0
|
def funzione():
nome=str(input(''))
male='IGNORE HIM!'
female='CHAT WITH HER!'
if len(nome)%2==0:
print(female)
else:
print(male)
|
Title: Boy or Girl
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
Input Specification:
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
Output Specification:
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
Demo Input:
['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n']
Demo Output:
['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n']
Note:
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
|
```python
def funzione():
nome=str(input(''))
male='IGNORE HIM!'
female='CHAT WITH HER!'
if len(nome)%2==0:
print(female)
else:
print(male)
```
| 0
|
|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,589,863,270
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 124
| 0
|
s = str(input())
k = int(input())
l = list(map(int, input().split()))
numbers = []
for i in range(len(s)):
numbers.append(l[ord(s[i])-97])
high = max(numbers)
while k!=0:
numbers.append(high)
k=k-1
temp=1
ans= 0
for i in numbers:
ans = ans + temp*i
temp = temp+1
print(ans)
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
s = str(input())
k = int(input())
l = list(map(int, input().split()))
numbers = []
for i in range(len(s)):
numbers.append(l[ord(s[i])-97])
high = max(numbers)
while k!=0:
numbers.append(high)
k=k-1
temp=1
ans= 0
for i in numbers:
ans = ans + temp*i
temp = temp+1
print(ans)
```
| 0
|
|
602
|
B
|
Approximating a Constant Range
|
PROGRAMMING
| 1,400
|
[
"dp",
"implementation",
"two pointers"
] | null | null |
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
|
Print a single number — the maximum length of an almost constant range of the given sequence.
|
[
"5\n1 2 3 3 2\n",
"11\n5 4 5 5 6 7 8 8 8 7 6\n"
] |
[
"4\n",
"5\n"
] |
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
| 1,000
|
[
{
"input": "5\n1 2 3 3 2",
"output": "4"
},
{
"input": "11\n5 4 5 5 6 7 8 8 8 7 6",
"output": "5"
},
{
"input": "2\n3 2",
"output": "2"
},
{
"input": "4\n1001 1000 1000 1001",
"output": "4"
},
{
"input": "4\n1 1 2 3",
"output": "3"
},
{
"input": "3\n1 2 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "18\n10 9 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "3"
},
{
"input": "4\n10 9 10 9",
"output": "4"
},
{
"input": "4\n4 3 2 3",
"output": "3"
},
{
"input": "4\n8 8 7 7",
"output": "4"
},
{
"input": "3\n99998 99999 100000",
"output": "2"
},
{
"input": "3\n100000 99999 99998",
"output": "2"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "2\n99999 100000",
"output": "2"
},
{
"input": "2\n100000 100000",
"output": "2"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "15\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "15"
}
] | 1,605,261,616
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 139
| 0
|
'''Author- Akshit Monga'''
t=1
for _ in range(t):
n=int(input())
arr=[int(x) for x in input().split()]
a=b=c=0
ans=0
s=-1
temp=[]
for i in arr:
if i==s:
c+=1
else:
if len(temp)==3:
if temp[0] == temp[-1]:
ans = max(ans, a + b + c)
else:
ans = max(ans, a + b, b + c)
a=b
b=c
c=1
temp.append(i)
if len(temp) > 3:
temp.pop(0)
s=i
if len(temp) == 3:
if temp[0] == temp[-1]:
ans = max(ans, a + b + c)
else:
ans = max(ans, a + b, b + c)
print(ans)
|
Title: Approximating a Constant Range
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
Output Specification:
Print a single number — the maximum length of an almost constant range of the given sequence.
Demo Input:
['5\n1 2 3 3 2\n', '11\n5 4 5 5 6 7 8 8 8 7 6\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10].
|
```python
'''Author- Akshit Monga'''
t=1
for _ in range(t):
n=int(input())
arr=[int(x) for x in input().split()]
a=b=c=0
ans=0
s=-1
temp=[]
for i in arr:
if i==s:
c+=1
else:
if len(temp)==3:
if temp[0] == temp[-1]:
ans = max(ans, a + b + c)
else:
ans = max(ans, a + b, b + c)
a=b
b=c
c=1
temp.append(i)
if len(temp) > 3:
temp.pop(0)
s=i
if len(temp) == 3:
if temp[0] == temp[-1]:
ans = max(ans, a + b + c)
else:
ans = max(ans, a + b, b + c)
print(ans)
```
| 0
|
|
525
|
B
|
Pasha and String
|
PROGRAMMING
| 1,400
|
[
"constructive algorithms",
"greedy",
"math",
"strings"
] | null | null |
Pasha got a very beautiful string *s* for his birthday, the string consists of lowercase Latin letters. The letters in the string are numbered from 1 to |*s*| from left to right, where |*s*| is the length of the given string.
Pasha didn't like his present very much so he decided to change it. After his birthday Pasha spent *m* days performing the following transformations on his string — each day he chose integer *a**i* and reversed a piece of string (a segment) from position *a**i* to position |*s*|<=-<=*a**i*<=+<=1. It is guaranteed that 2·*a**i*<=≤<=|*s*|.
You face the following task: determine what Pasha's string will look like after *m* days.
|
The first line of the input contains Pasha's string *s* of length from 2 to 2·105 characters, consisting of lowercase Latin letters.
The second line contains a single integer *m* (1<=≤<=*m*<=≤<=105) — the number of days when Pasha changed his string.
The third line contains *m* space-separated elements *a**i* (1<=≤<=*a**i*; 2·*a**i*<=≤<=|*s*|) — the position from which Pasha started transforming the string on the *i*-th day.
|
In the first line of the output print what Pasha's string *s* will look like after *m* days.
|
[
"abcdef\n1\n2\n",
"vwxyz\n2\n2 2\n",
"abcdef\n3\n1 2 3\n"
] |
[
"aedcbf\n",
"vwxyz\n",
"fbdcea\n"
] |
none
| 750
|
[
{
"input": "abcdef\n1\n2",
"output": "aedcbf"
},
{
"input": "vwxyz\n2\n2 2",
"output": "vwxyz"
},
{
"input": "abcdef\n3\n1 2 3",
"output": "fbdcea"
},
{
"input": "jc\n5\n1 1 1 1 1",
"output": "cj"
},
{
"input": "wljqgdlxyc\n13\n3 4 3 3 5 4 4 2 4 4 5 3 3",
"output": "wyjldgqxlc"
},
{
"input": "keicnqmuqinhsmtudqcilocxkbqgzhbkitmqwttdyoyvcbxincwjryzknubpacsngorexaldfurondbednowemnnlphhboycfavs\n2\n5 12",
"output": "keiccyobhhphsmtudqcilocxkbqgzhbkitmqwttdyoyvcbxincwjryzknubpacsngorexaldfurondbednowemnnlniqumqnfavs"
},
{
"input": "xwcxggxvfqbdklewbxkjzibmufnaywuxsqvwakefxbbkfandvigasbhbatsxyqxicrosatfsfybedklsaztyyiuurfbrzmwumujy\n100\n14 43 30 13 8 19 33 7 8 14 15 35 5 18 44 1 35 1 18 7 50 47 9 49 28 29 39 37 27 17 19 12 5 24 37 42 37 23 35 31 10 26 5 38 40 34 42 47 2 40 43 34 16 25 14 45 35 38 46 48 49 27 49 38 10 49 5 7 3 3 41 25 24 34 37 33 17 50 48 11 40 43 48 10 9 50 18 39 32 13 26 40 37 16 45 50 27 3 7 31",
"output": "xjcxggxvfbbruliyyxkjzikdebnfyftxsorcaxqyxbtkfhbdvigasnababsxfekiwvqsauwsayfumblsaztbweukdfqrzmwumuwy"
}
] | 1,592,330,415
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 43
| 249
| 13,312,000
|
x=list(input())
l=len(x)
c=input()
lst=[0]*(l//2+1)
for i in input().split():
lst[int(i)-1]+=1
for i in range(1,(l//2+1)):
lst[i]+=lst[i-1]
for i in range(l//2):
if lst[i]%2==1:
x[i],x[l-i-1]=x[l-i-1],x[i]
print(''.join(x))
|
Title: Pasha and String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha got a very beautiful string *s* for his birthday, the string consists of lowercase Latin letters. The letters in the string are numbered from 1 to |*s*| from left to right, where |*s*| is the length of the given string.
Pasha didn't like his present very much so he decided to change it. After his birthday Pasha spent *m* days performing the following transformations on his string — each day he chose integer *a**i* and reversed a piece of string (a segment) from position *a**i* to position |*s*|<=-<=*a**i*<=+<=1. It is guaranteed that 2·*a**i*<=≤<=|*s*|.
You face the following task: determine what Pasha's string will look like after *m* days.
Input Specification:
The first line of the input contains Pasha's string *s* of length from 2 to 2·105 characters, consisting of lowercase Latin letters.
The second line contains a single integer *m* (1<=≤<=*m*<=≤<=105) — the number of days when Pasha changed his string.
The third line contains *m* space-separated elements *a**i* (1<=≤<=*a**i*; 2·*a**i*<=≤<=|*s*|) — the position from which Pasha started transforming the string on the *i*-th day.
Output Specification:
In the first line of the output print what Pasha's string *s* will look like after *m* days.
Demo Input:
['abcdef\n1\n2\n', 'vwxyz\n2\n2 2\n', 'abcdef\n3\n1 2 3\n']
Demo Output:
['aedcbf\n', 'vwxyz\n', 'fbdcea\n']
Note:
none
|
```python
x=list(input())
l=len(x)
c=input()
lst=[0]*(l//2+1)
for i in input().split():
lst[int(i)-1]+=1
for i in range(1,(l//2+1)):
lst[i]+=lst[i-1]
for i in range(l//2):
if lst[i]%2==1:
x[i],x[l-i-1]=x[l-i-1],x[i]
print(''.join(x))
```
| 3
|
|
963
|
A
|
Alternating Sum
|
PROGRAMMING
| 1,800
|
[
"math",
"number theory"
] | null | null |
You are given two integers $a$ and $b$. Moreover, you are given a sequence $s_0, s_1, \dots, s_{n}$. All values in $s$ are integers $1$ or $-1$. It's known that sequence is $k$-periodic and $k$ divides $n+1$. In other words, for each $k \leq i \leq n$ it's satisfied that $s_{i} = s_{i - k}$.
Find out the non-negative remainder of division of $\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}$ by $10^{9} + 9$.
Note that the modulo is unusual!
|
The first line contains four integers $n, a, b$ and $k$ $(1 \leq n \leq 10^{9}, 1 \leq a, b \leq 10^{9}, 1 \leq k \leq 10^{5})$.
The second line contains a sequence of length $k$ consisting of characters '+' and '-'.
If the $i$-th character (0-indexed) is '+', then $s_{i} = 1$, otherwise $s_{i} = -1$.
Note that only the first $k$ members of the sequence are given, the rest can be obtained using the periodicity property.
|
Output a single integer — value of given expression modulo $10^{9} + 9$.
|
[
"2 2 3 3\n+-+\n",
"4 1 5 1\n-\n"
] |
[
"7\n",
"999999228\n"
] |
In the first example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i})$ = $2^{2} 3^{0} - 2^{1} 3^{1} + 2^{0} 3^{2}$ = 7
In the second example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}) = -1^{4} 5^{0} - 1^{3} 5^{1} - 1^{2} 5^{2} - 1^{1} 5^{3} - 1^{0} 5^{4} = -781 \equiv 999999228 \pmod{10^{9} + 9}$.
| 500
|
[
{
"input": "2 2 3 3\n+-+",
"output": "7"
},
{
"input": "4 1 5 1\n-",
"output": "999999228"
},
{
"input": "1 1 4 2\n-+",
"output": "3"
},
{
"input": "3 1 4 4\n+--+",
"output": "45"
},
{
"input": "5 1 1 6\n++---+",
"output": "0"
},
{
"input": "5 2 2 6\n+--++-",
"output": "0"
},
{
"input": "686653196 115381398 884618610 3\n+-+",
"output": "542231211"
},
{
"input": "608663287 430477711 172252358 8\n-+--+-+-",
"output": "594681696"
},
{
"input": "904132655 827386249 118827660 334\n+++-+++++--+++----+-+-+-+-+--+-+---++--++--++--+-+-+++-+++--+-+-+----+-+-++++-----+--++++------+++-+-+-++-++++++++-+-++-+++--+--++------+--+-+++--++--+---++-++-+-+-++---++-++--+-+-++-+------+-+----+++-+++--+-+-+--+--+--+------+--+---+--+-++--+++---+-+-++--------+-++--++-+-+-+-+-+-+--+-++++-+++--+--++----+--+-++-++--+--+-+-++-+-++++-",
"output": "188208979"
},
{
"input": "234179195 430477711 115381398 12\n++++-+-+-+++",
"output": "549793323"
},
{
"input": "75952547 967294208 907708706 252\n++--++--+++-+-+--++--++++++---+++-++-+-----++++--++-+-++------+-+-+-++-+-+-++++------++---+-++++---+-+-++++--++++++--+-+++-++--+--+---++++---+-+++-+++--+-+--+++++---+--++-++++--++++-+-++-+++-++-----+-+++++----++--+++-+-+++++-+--++-++-+--+-++++--+-+-+-+",
"output": "605712499"
},
{
"input": "74709071 801809249 753674746 18\n++++++-+-+---+-+--",
"output": "13414893"
},
{
"input": "743329 973758 92942 82\n++----+-++++----+--+++---+--++++-+-+---+++++--+--+++++++--++-+++----+--+++++-+--+-",
"output": "299311566"
},
{
"input": "18111 291387 518587 2\n++",
"output": "724471355"
},
{
"input": "996144 218286 837447 1\n-",
"output": "549104837"
},
{
"input": "179358 828426 548710 67\n++++---+--++----+-+-++++----+--+---+------++-+-++++--+----+---+-+--",
"output": "759716474"
},
{
"input": "397521 174985 279760 1\n+",
"output": "25679493"
},
{
"input": "613632 812232 482342 1\n-",
"output": "891965141"
},
{
"input": "936810 183454 647048 1\n+",
"output": "523548992"
},
{
"input": "231531 250371 921383 28\n++-+------+--+--++++--+-+++-",
"output": "134450934"
},
{
"input": "947301 87242 360762 97\n--+++--+++-++--++-++--++--+++---+++--++++--+++++--+-++-++-----+-++-+--++-----+-++-+--++-++-+-----",
"output": "405016159"
},
{
"input": "425583346 814209084 570987274 1\n+",
"output": "63271171"
},
{
"input": "354062556 688076879 786825319 1\n+",
"output": "545304776"
},
{
"input": "206671954 13571766 192250278 1\n+",
"output": "717117421"
},
{
"input": "23047921 621656196 160244047 1\n-",
"output": "101533009"
},
{
"input": "806038018 740585177 987616107 293\n-+++++--++++---++-+--+-+---+-++++--+--+++--++---++++++++--+++++-+-++-+--+----+--+++-+-++-+++-+-+-+----------++-+-+++++++-+-+-+-++---+++-+-+-------+-+-++--++-++-++-++-+---+--++-++--+++--+++-+-+----++--+-+-++-+---+---+-+-+++------+-+++-+---++-+--+++----+++++---++-++--+----+++-+--+++-+------+-++",
"output": "441468166"
},
{
"input": "262060935 184120408 148332034 148\n+--+-------+-+-+--++-+++--++-+-++++++--++-+++-+++--+-------+-+--+++-+-+-+---++-++-+-++---+--+-+-+--+------+++--+--+-+-+---+---+-+-++++---+++--+++---",
"output": "700325386"
},
{
"input": "919350941 654611542 217223605 186\n++-++-+++++-+++--+---+++++++-++-+----+-++--+-++--++--+++-+++---+--+--++-+-+++-+-+++-++---+--+++-+-+++--+-+-------+-++------++---+-+---++-++-++---+-+--+-+--+++++---+--+--++++-++-++--+--++",
"output": "116291420"
},
{
"input": "289455627 906207104 512692624 154\n-------++--+++---++-++------++----------+--+++-+-+++---+---+++--++++++--+-+-+--+---+-+-++-++--+-++--++++---+-+---+-----+--+-+---------+++-++---++-+-+-----",
"output": "48198216"
},
{
"input": "258833760 515657142 791267045 1\n-",
"output": "935800888"
},
{
"input": "691617927 66917103 843055237 8\n--+++---",
"output": "147768186"
},
{
"input": "379582849 362892355 986900829 50\n++-++---+-+++++--++++--+--++--++-----+------++--+-",
"output": "927469713"
},
{
"input": "176799169 363368399 841293419 1\n+",
"output": "746494802"
},
{
"input": "144808247 203038656 166324035 4\n-+-+",
"output": "909066471"
},
{
"input": "477607531 177367565 20080950 2\n++",
"output": "928662830"
},
{
"input": "682074525 289438443 917164266 1\n+",
"output": "28048785"
},
{
"input": "938449224 59852396 219719125 1\n-",
"output": "648647459"
},
{
"input": "395171426 872478622 193568600 147\n+---++---+-+--+++++--+---+-++++-+-++---++++--+--+-+-++-+-++--------++---+++-+---++---+---+-+--+-++++-+++-+-+-++-+--+++-++-+-+-+-++++++-+---+---++--",
"output": "460881399"
},
{
"input": "403493428 317461491 556701240 1\n-",
"output": "936516261"
},
{
"input": "917751169 330191895 532837377 70\n-+-+++++++--++---++-+++++-+++-----+-+++---+--+-+-++-++-+-+-++-++-+----",
"output": "908035409"
},
{
"input": "252089413 552678586 938424519 1\n-",
"output": "627032736"
},
{
"input": "649316142 320010793 200197645 1\n-",
"output": "323650777"
},
{
"input": "116399299 784781190 299072480 5\n++++-",
"output": "754650814"
}
] | 1,537,848,957
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 93
| 0
|
def solution(n, a, b, ops):
sumNums = 0
cont = 0
for i in range(n + 1):
si = 1 if ops[cont] else -1
sumNums += si * (a ** (n - i)) * (b ** i)
if cont + 1 >= len(ops):
cont = 0
else:
cont += 1
base = (10 ** 9) + 9
print(sumNums % base)
if __name__ == '__main__':
n = int(input())
a = int(input())
b = int(input())
k = int(input())
print(k)
ops = []
for i in range(k):
sign = input()
if sign == '+':
ops.append(True)
else:
ops.append(False)
solution(n,a,b,ops)
|
Title: Alternating Sum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two integers $a$ and $b$. Moreover, you are given a sequence $s_0, s_1, \dots, s_{n}$. All values in $s$ are integers $1$ or $-1$. It's known that sequence is $k$-periodic and $k$ divides $n+1$. In other words, for each $k \leq i \leq n$ it's satisfied that $s_{i} = s_{i - k}$.
Find out the non-negative remainder of division of $\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}$ by $10^{9} + 9$.
Note that the modulo is unusual!
Input Specification:
The first line contains four integers $n, a, b$ and $k$ $(1 \leq n \leq 10^{9}, 1 \leq a, b \leq 10^{9}, 1 \leq k \leq 10^{5})$.
The second line contains a sequence of length $k$ consisting of characters '+' and '-'.
If the $i$-th character (0-indexed) is '+', then $s_{i} = 1$, otherwise $s_{i} = -1$.
Note that only the first $k$ members of the sequence are given, the rest can be obtained using the periodicity property.
Output Specification:
Output a single integer — value of given expression modulo $10^{9} + 9$.
Demo Input:
['2 2 3 3\n+-+\n', '4 1 5 1\n-\n']
Demo Output:
['7\n', '999999228\n']
Note:
In the first example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i})$ = $2^{2} 3^{0} - 2^{1} 3^{1} + 2^{0} 3^{2}$ = 7
In the second example:
$(\sum \limits_{i=0}^{n} s_{i} a^{n - i} b^{i}) = -1^{4} 5^{0} - 1^{3} 5^{1} - 1^{2} 5^{2} - 1^{1} 5^{3} - 1^{0} 5^{4} = -781 \equiv 999999228 \pmod{10^{9} + 9}$.
|
```python
def solution(n, a, b, ops):
sumNums = 0
cont = 0
for i in range(n + 1):
si = 1 if ops[cont] else -1
sumNums += si * (a ** (n - i)) * (b ** i)
if cont + 1 >= len(ops):
cont = 0
else:
cont += 1
base = (10 ** 9) + 9
print(sumNums % base)
if __name__ == '__main__':
n = int(input())
a = int(input())
b = int(input())
k = int(input())
print(k)
ops = []
for i in range(k):
sign = input()
if sign == '+':
ops.append(True)
else:
ops.append(False)
solution(n,a,b,ops)
```
| -1
|
|
631
|
C
|
Report
|
PROGRAMMING
| 1,700
|
[
"data structures",
"sortings"
] | null | null |
Each month Blake gets the report containing main economic indicators of the company "Blake Technologies". There are *n* commodities produced by the company. For each of them there is exactly one integer in the final report, that denotes corresponding revenue. Before the report gets to Blake, it passes through the hands of *m* managers. Each of them may reorder the elements in some order. Namely, the *i*-th manager either sorts first *r**i* numbers in non-descending or non-ascending order and then passes the report to the manager *i*<=+<=1, or directly to Blake (if this manager has number *i*<==<=*m*).
Employees of the "Blake Technologies" are preparing the report right now. You know the initial sequence *a**i* of length *n* and the description of each manager, that is value *r**i* and his favourite order. You are asked to speed up the process and determine how the final report will look like.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the number of commodities in the report and the number of managers, respectively.
The second line contains *n* integers *a**i* (|*a**i*|<=≤<=109) — the initial report before it gets to the first manager.
Then follow *m* lines with the descriptions of the operations managers are going to perform. The *i*-th of these lines contains two integers *t**i* and *r**i* (, 1<=≤<=*r**i*<=≤<=*n*), meaning that the *i*-th manager sorts the first *r**i* numbers either in the non-descending (if *t**i*<==<=1) or non-ascending (if *t**i*<==<=2) order.
|
Print *n* integers — the final report, which will be passed to Blake by manager number *m*.
|
[
"3 1\n1 2 3\n2 2\n",
"4 2\n1 2 4 3\n2 3\n1 2\n"
] |
[
"2 1 3 ",
"2 4 1 3 "
] |
In the first sample, the initial report looked like: 1 2 3. After the first manager the first two numbers were transposed: 2 1 3. The report got to Blake in this form.
In the second sample the original report was like this: 1 2 4 3. After the first manager the report changed to: 4 2 1 3. After the second manager the report changed to: 2 4 1 3. This report was handed over to Blake.
| 1,500
|
[
{
"input": "3 1\n1 2 3\n2 2",
"output": "2 1 3 "
},
{
"input": "4 2\n1 2 4 3\n2 3\n1 2",
"output": "2 4 1 3 "
},
{
"input": "4 1\n4 3 2 1\n1 4",
"output": "1 2 3 4 "
},
{
"input": "5 1\n1 2 3 4 5\n2 5",
"output": "5 4 3 2 1 "
},
{
"input": "6 2\n3 1 2 6 4 5\n1 6\n2 3",
"output": "3 2 1 4 5 6 "
},
{
"input": "10 3\n6 4 0 2 -3 7 8 -9 1 5\n1 8\n1 4\n2 2",
"output": "-3 -9 0 2 4 6 7 8 1 5 "
},
{
"input": "100 30\n65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 74 57 115 16 55 88 79 97 21 80 41 56 49 103 61 66 1 36 44 43 82 37 38 106 27 114 51 112 55 87 41 69 31 86 58 27 46 99 18 105 91 38 5 9 2 109 39 2 27 47\n2 38\n2 32\n1 46\n1 37\n1 20\n1 5\n2 42\n2 18\n1 35\n1 36\n2 44\n1 36\n1 20\n2 21\n2 14\n1 13\n2 2\n1 15\n2 50\n2 35\n1 42\n1 21\n1 50\n2 50\n1 1\n2 48\n2 24\n1 34\n1 23\n2 9",
"output": "65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 65 74 57 115 16 55 88 79 97 21 80 41 56 49 103 61 66 1 36 44 43 82 37 38 106 27 114 51 112 55 87 41 69 31 86 58 27 46 99 18 105 91 38 5 9 2 109 39 2 27 47 "
},
{
"input": "1 1\n1234\n1 1",
"output": "1234 "
},
{
"input": "1 1\n1000000000\n2 1",
"output": "1000000000 "
},
{
"input": "1 2\n-1000000000\n1 1\n2 1",
"output": "-1000000000 "
},
{
"input": "30 13\n15 44 5 56 84 15 24 72 97 3 61 97 36 33 98 49 1 40 76 94 7 46 85 53 79 68 78 54 80 33\n2 18\n1 9\n1 6\n2 30\n2 15\n2 4\n2 17\n2 16\n2 20\n2 16\n2 7\n2 12\n1 20",
"output": "40 44 46 49 53 54 56 61 68 72 76 78 79 80 84 85 94 97 97 98 36 33 33 24 15 15 7 5 3 1 "
}
] | 1,458,758,869
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 4,608,000
|
n, m = map(int, input('').split())
lst = list(map(int, input().split()))
managers = []
for i in range(m):
managers.append(list((map(int,input().split()))))
def sort(lst1, to, oneortwo):
k = lst1[:to]
if oneortwo == 1:
k.sort()
if oneortwo == 2:
k.sort(reverse = True)
lst1[:to] = k
for manager in managers:
sort(lst, manager[1], manager[0])
|
Title: Report
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Each month Blake gets the report containing main economic indicators of the company "Blake Technologies". There are *n* commodities produced by the company. For each of them there is exactly one integer in the final report, that denotes corresponding revenue. Before the report gets to Blake, it passes through the hands of *m* managers. Each of them may reorder the elements in some order. Namely, the *i*-th manager either sorts first *r**i* numbers in non-descending or non-ascending order and then passes the report to the manager *i*<=+<=1, or directly to Blake (if this manager has number *i*<==<=*m*).
Employees of the "Blake Technologies" are preparing the report right now. You know the initial sequence *a**i* of length *n* and the description of each manager, that is value *r**i* and his favourite order. You are asked to speed up the process and determine how the final report will look like.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the number of commodities in the report and the number of managers, respectively.
The second line contains *n* integers *a**i* (|*a**i*|<=≤<=109) — the initial report before it gets to the first manager.
Then follow *m* lines with the descriptions of the operations managers are going to perform. The *i*-th of these lines contains two integers *t**i* and *r**i* (, 1<=≤<=*r**i*<=≤<=*n*), meaning that the *i*-th manager sorts the first *r**i* numbers either in the non-descending (if *t**i*<==<=1) or non-ascending (if *t**i*<==<=2) order.
Output Specification:
Print *n* integers — the final report, which will be passed to Blake by manager number *m*.
Demo Input:
['3 1\n1 2 3\n2 2\n', '4 2\n1 2 4 3\n2 3\n1 2\n']
Demo Output:
['2 1 3 ', '2 4 1 3 ']
Note:
In the first sample, the initial report looked like: 1 2 3. After the first manager the first two numbers were transposed: 2 1 3. The report got to Blake in this form.
In the second sample the original report was like this: 1 2 4 3. After the first manager the report changed to: 4 2 1 3. After the second manager the report changed to: 2 4 1 3. This report was handed over to Blake.
|
```python
n, m = map(int, input('').split())
lst = list(map(int, input().split()))
managers = []
for i in range(m):
managers.append(list((map(int,input().split()))))
def sort(lst1, to, oneortwo):
k = lst1[:to]
if oneortwo == 1:
k.sort()
if oneortwo == 2:
k.sort(reverse = True)
lst1[:to] = k
for manager in managers:
sort(lst, manager[1], manager[0])
```
| 0
|
|
931
|
B
|
World Cup
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"implementation"
] | null | null |
The last stage of Football World Cup is played using the play-off system.
There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over.
Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet.
|
The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in.
It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal.
|
In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final.
Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1.
|
[
"4 1 2\n",
"8 2 6\n",
"8 7 5\n"
] |
[
"1\n",
"Final!\n",
"2\n"
] |
In the first example teams 1 and 2 meet in the first round.
In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds.
In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round.
| 1,000
|
[
{
"input": "4 1 2",
"output": "1"
},
{
"input": "8 2 6",
"output": "Final!"
},
{
"input": "8 7 5",
"output": "2"
},
{
"input": "128 30 98",
"output": "Final!"
},
{
"input": "256 128 256",
"output": "Final!"
},
{
"input": "256 2 127",
"output": "7"
},
{
"input": "2 1 2",
"output": "Final!"
},
{
"input": "2 2 1",
"output": "Final!"
},
{
"input": "4 1 3",
"output": "Final!"
},
{
"input": "4 1 4",
"output": "Final!"
},
{
"input": "4 2 1",
"output": "1"
},
{
"input": "4 2 3",
"output": "Final!"
},
{
"input": "4 2 4",
"output": "Final!"
},
{
"input": "4 3 1",
"output": "Final!"
},
{
"input": "4 3 2",
"output": "Final!"
},
{
"input": "4 3 4",
"output": "1"
},
{
"input": "4 4 1",
"output": "Final!"
},
{
"input": "4 4 2",
"output": "Final!"
},
{
"input": "4 4 3",
"output": "1"
},
{
"input": "8 8 7",
"output": "1"
},
{
"input": "8 8 5",
"output": "2"
},
{
"input": "8 8 1",
"output": "Final!"
},
{
"input": "16 4 3",
"output": "1"
},
{
"input": "16 2 4",
"output": "2"
},
{
"input": "16 14 11",
"output": "3"
},
{
"input": "16 3 11",
"output": "Final!"
},
{
"input": "32 10 9",
"output": "1"
},
{
"input": "32 25 28",
"output": "2"
},
{
"input": "32 22 18",
"output": "3"
},
{
"input": "32 17 25",
"output": "4"
},
{
"input": "32 18 3",
"output": "Final!"
},
{
"input": "64 40 39",
"output": "1"
},
{
"input": "64 60 58",
"output": "2"
},
{
"input": "64 34 37",
"output": "3"
},
{
"input": "64 26 24",
"output": "4"
},
{
"input": "64 50 43",
"output": "5"
},
{
"input": "64 17 42",
"output": "Final!"
},
{
"input": "128 116 115",
"output": "1"
},
{
"input": "128 35 33",
"output": "2"
},
{
"input": "128 61 59",
"output": "3"
},
{
"input": "128 116 123",
"output": "4"
},
{
"input": "128 17 15",
"output": "5"
},
{
"input": "128 124 77",
"output": "6"
},
{
"input": "128 4 80",
"output": "Final!"
},
{
"input": "256 224 223",
"output": "1"
},
{
"input": "256 24 22",
"output": "2"
},
{
"input": "256 199 196",
"output": "3"
},
{
"input": "256 148 159",
"output": "4"
},
{
"input": "256 178 166",
"output": "5"
},
{
"input": "256 75 97",
"output": "6"
},
{
"input": "256 185 200",
"output": "7"
},
{
"input": "256 3 238",
"output": "Final!"
},
{
"input": "256 128 129",
"output": "Final!"
},
{
"input": "256 255 129",
"output": "7"
},
{
"input": "256 255 128",
"output": "Final!"
},
{
"input": "256 129 256",
"output": "7"
},
{
"input": "128 98 69",
"output": "6"
},
{
"input": "128 47 83",
"output": "Final!"
},
{
"input": "16 2 3",
"output": "2"
},
{
"input": "64 32 30",
"output": "2"
},
{
"input": "8 4 5",
"output": "Final!"
},
{
"input": "8 7 8",
"output": "1"
},
{
"input": "8 2 3",
"output": "2"
},
{
"input": "8 2 5",
"output": "Final!"
}
] | 1,520,178,966
| 1,266
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 19
| 62
| 5,632,000
|
n, a, b = map(int, input().split());
cntb = 0;
cnt = 0;
f = 1;
while n > 1:
if not (((n // 2 >= a and n // 2 < b) or (n // 2 >= b and n // 2 < a))) and f:
cnt = cnt + 1;
n = n // 2;
a = a % n;
b = b % n;
cntb = cntb + 1;
else:
n = n // 2;
f = 0;
cntb =cntb + 1;
if (cnt == 0):
print("Final!");
elif (cntb == cnt):
print(1);
else:
print(cntb - cnt);
|
Title: World Cup
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The last stage of Football World Cup is played using the play-off system.
There are *n* teams left in this stage, they are enumerated from 1 to *n*. Several rounds are held, in each round the remaining teams are sorted in the order of their ids, then the first in this order plays with the second, the third — with the fourth, the fifth — with the sixth, and so on. It is guaranteed that in each round there is even number of teams. The winner of each game advances to the next round, the loser is eliminated from the tournament, there are no draws. In the last round there is the only game with two remaining teams: the round is called the Final, the winner is called the champion, and the tournament is over.
Arkady wants his two favorite teams to play in the Final. Unfortunately, the team ids are already determined, and it may happen that it is impossible for teams to meet in the Final, because they are to meet in some earlier stage, if they are strong enough. Determine, in which round the teams with ids *a* and *b* can meet.
Input Specification:
The only line contains three integers *n*, *a* and *b* (2<=≤<=*n*<=≤<=256, 1<=≤<=*a*,<=*b*<=≤<=*n*) — the total number of teams, and the ids of the teams that Arkady is interested in.
It is guaranteed that *n* is such that in each round an even number of team advance, and that *a* and *b* are not equal.
Output Specification:
In the only line print "Final!" (without quotes), if teams *a* and *b* can meet in the Final.
Otherwise, print a single integer — the number of the round in which teams *a* and *b* can meet. The round are enumerated from 1.
Demo Input:
['4 1 2\n', '8 2 6\n', '8 7 5\n']
Demo Output:
['1\n', 'Final!\n', '2\n']
Note:
In the first example teams 1 and 2 meet in the first round.
In the second example teams 2 and 6 can only meet in the third round, which is the Final, if they win all their opponents in earlier rounds.
In the third example the teams with ids 7 and 5 can meet in the second round, if they win their opponents in the first round.
|
```python
n, a, b = map(int, input().split());
cntb = 0;
cnt = 0;
f = 1;
while n > 1:
if not (((n // 2 >= a and n // 2 < b) or (n // 2 >= b and n // 2 < a))) and f:
cnt = cnt + 1;
n = n // 2;
a = a % n;
b = b % n;
cntb = cntb + 1;
else:
n = n // 2;
f = 0;
cntb =cntb + 1;
if (cnt == 0):
print("Final!");
elif (cntb == cnt):
print(1);
else:
print(cntb - cnt);
```
| 0
|
|
681
|
A
|
A Good Contest
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
|
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
|
[
"3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n",
"3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n"
] |
[
"YES",
"NO"
] |
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
| 500
|
[
{
"input": "3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "NO"
},
{
"input": "1\nDb -3373 3591",
"output": "NO"
},
{
"input": "5\nQ2bz 960 2342\nhmX 2710 -1348\ngbAe -1969 -963\nE -160 196\npsi 2665 -3155",
"output": "NO"
},
{
"input": "9\nmwAz9lQ 1786 -1631\nnYgYFXZQfY -1849 -1775\nKU4jF -1773 -3376\nopR 3752 2931\nGl -1481 -1002\nR -1111 3778\n0i9B21DC 3650 289\nQ8L2dS0 358 -3305\ng -2662 3968",
"output": "NO"
},
{
"input": "5\nzMSBcOUf -2883 -2238\nYN -3314 -1480\nfHpuccQn06 -1433 -589\naM1NVEPQi 399 3462\n_L 2516 -3290",
"output": "NO"
},
{
"input": "1\na 2400 2401",
"output": "YES"
},
{
"input": "1\nfucker 4000 4000",
"output": "NO"
},
{
"input": "1\nJora 2400 2401",
"output": "YES"
},
{
"input": "1\nACA 2400 2420",
"output": "YES"
},
{
"input": "1\nAca 2400 2420",
"output": "YES"
},
{
"input": "1\nSub_d 2401 2402",
"output": "YES"
},
{
"input": "2\nHack 2400 2401\nDum 1243 555",
"output": "YES"
},
{
"input": "1\nXXX 2400 2500",
"output": "YES"
},
{
"input": "1\nfucker 2400 2401",
"output": "YES"
},
{
"input": "1\nX 2400 2500",
"output": "YES"
},
{
"input": "1\nvineet 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2500",
"output": "YES"
},
{
"input": "1\naaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nhoge 2400 2401",
"output": "YES"
},
{
"input": "1\nInfinity 2400 2468",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2401",
"output": "YES"
},
{
"input": "1\nFuck 2400 2401",
"output": "YES"
},
{
"input": "1\nfuck 2400 2401",
"output": "YES"
},
{
"input": "3\nApplejack 2400 2401\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450",
"output": "YES"
},
{
"input": "1\nalex 2400 2401",
"output": "YES"
},
{
"input": "1\nA 2400 2401",
"output": "YES"
},
{
"input": "1\na 2400 2455",
"output": "YES"
},
{
"input": "1\nlol 2400 2401",
"output": "YES"
},
{
"input": "2\nBurunduk1 2400 2537\nBudAlNik 2084 2214",
"output": "YES"
},
{
"input": "1\naaaaaa 2400 2401",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2500",
"output": "YES"
},
{
"input": "1\nds 2400 2410",
"output": "YES"
},
{
"input": "1\nas 2400 2401",
"output": "YES"
},
{
"input": "1\nabc 2400 2401",
"output": "YES"
},
{
"input": "3\nBudAlNik 2084 2214\nsubscriber 2833 2749\nBurunduk1 2526 2537",
"output": "YES"
},
{
"input": "1\ncaonima 2400 2401",
"output": "YES"
},
{
"input": "1\narr 2400 2500",
"output": "YES"
},
{
"input": "1\nx 2400 2401",
"output": "YES"
},
{
"input": "1\narrr 2400 2500",
"output": "YES"
},
{
"input": "1\nabc 2400 2405",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2420\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nBurunduk1 2400 2537",
"output": "YES"
},
{
"input": "1\nHELLO 2400 2401",
"output": "YES"
},
{
"input": "1\neatmore 2400 2500",
"output": "YES"
},
{
"input": "1\nb 2400 2401",
"output": "YES"
},
{
"input": "3\nBurunduk1 2400 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749",
"output": "YES"
},
{
"input": "1\nApplejack 2400 2410",
"output": "YES"
},
{
"input": "1\nabacaba 2400 2451",
"output": "YES"
},
{
"input": "1\nrekt_n00b 2500 2600",
"output": "YES"
}
] | 1,586,875,204
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 109
| 0
|
t = int(input())
d = []
c=0
for i in range(t):
s = [i for i in input().split()]
d.append((int(s[1]),int(s[2])))
for i in d:
if i[0]>=2400:
if i[0]-i[1]>0:
c+=1
if c > 0:
print("YES")
else:
print("NO")
|
Title: A Good Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Codeforces user' handle color depends on his rating — it is red if his rating is greater or equal to 2400; it is orange if his rating is less than 2400 but greater or equal to 2200, etc. Each time participant takes part in a rated contest, his rating is changed depending on his performance.
Anton wants the color of his handle to become red. He considers his performance in the rated contest to be good if he outscored some participant, whose handle was colored red before the contest and his rating has increased after it.
Anton has written a program that analyses contest results and determines whether he performed good or not. Are you able to do the same?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of participants Anton has outscored in this contest .
The next *n* lines describe participants results: the *i*-th of them consists of a participant handle *name**i* and two integers *before**i* and *after**i* (<=-<=4000<=≤<=*before**i*,<=*after**i*<=≤<=4000) — participant's rating before and after the contest, respectively. Each handle is a non-empty string, consisting of no more than 10 characters, which might be lowercase and uppercase English letters, digits, characters «_» and «-» characters.
It is guaranteed that all handles are distinct.
Output Specification:
Print «YES» (quotes for clarity), if Anton has performed good in the contest and «NO» (quotes for clarity) otherwise.
Demo Input:
['3\nBurunduk1 2526 2537\nBudAlNik 2084 2214\nsubscriber 2833 2749\n', '3\nApplejack 2400 2400\nFluttershy 2390 2431\nPinkie_Pie -2500 -2450\n']
Demo Output:
['YES', 'NO']
Note:
In the first sample, Anton has outscored user with handle Burunduk1, whose handle was colored red before the contest and his rating has increased after the contest.
In the second sample, Applejack's rating has not increased after the contest, while both Fluttershy's and Pinkie_Pie's handles were not colored red before the contest.
|
```python
t = int(input())
d = []
c=0
for i in range(t):
s = [i for i in input().split()]
d.append((int(s[1]),int(s[2])))
for i in d:
if i[0]>=2400:
if i[0]-i[1]>0:
c+=1
if c > 0:
print("YES")
else:
print("NO")
```
| 0
|
|
934
|
A
|
A Compatible Pair
|
PROGRAMMING
| 1,400
|
[
"brute force",
"games"
] | null | null |
Nian is a monster which lives deep in the oceans. Once a year, it shows up on the land, devouring livestock and even people. In order to keep the monster away, people fill their villages with red colour, light, and cracking noise, all of which frighten the monster out of coming.
Little Tommy has *n* lanterns and Big Banban has *m* lanterns. Tommy's lanterns have brightness *a*1,<=*a*2,<=...,<=*a**n*, and Banban's have brightness *b*1,<=*b*2,<=...,<=*b**m* respectively.
Tommy intends to hide one of his lanterns, then Banban picks one of Tommy's non-hidden lanterns and one of his own lanterns to form a pair. The pair's brightness will be the product of the brightness of two lanterns.
Tommy wants to make the product as small as possible, while Banban tries to make it as large as possible.
You are asked to find the brightness of the chosen pair if both of them choose optimally.
|
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=50).
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n*.
The third line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m*.
All the integers range from <=-<=109 to 109.
|
Print a single integer — the brightness of the chosen pair.
|
[
"2 2\n20 18\n2 14\n",
"5 3\n-1 0 1 2 3\n-1 0 1\n"
] |
[
"252\n",
"2\n"
] |
In the first example, Tommy will hide 20 and Banban will choose 18 from Tommy and 14 from himself.
In the second example, Tommy will hide 3 and Banban will choose 2 from Tommy and 1 from himself.
| 500
|
[
{
"input": "2 2\n20 18\n2 14",
"output": "252"
},
{
"input": "5 3\n-1 0 1 2 3\n-1 0 1",
"output": "2"
},
{
"input": "10 2\n1 6 2 10 2 3 2 10 6 4\n5 7",
"output": "70"
},
{
"input": "50 50\n1 6 2 10 2 3 2 10 6 4 5 0 3 1 7 3 2 4 4 2 1 5 0 6 10 1 8 0 10 9 0 4 10 5 5 7 4 9 9 5 5 2 6 7 9 4 3 7 2 0\n0 5 9 4 4 6 1 8 2 1 6 6 8 6 4 4 7 2 1 8 6 7 4 9 8 3 0 2 0 10 7 1 4 9 4 4 2 5 3 5 1 3 2 4 1 6 5 3 8 6",
"output": "100"
},
{
"input": "5 7\n-130464232 -73113866 -542094710 -53118823 -63528720\n-775179088 631683023 -974858199 -157471745 -629658630 71825477 -6235611",
"output": "127184126241438168"
},
{
"input": "16 15\n-94580188 -713689767 -559972014 -632609438 -930348091 -567718487 -611395744 -819913097 -924009672 -427913920 -812510647 -546415480 -982072775 -693369647 -693004777 -714181162\n-772924706 -202246100 -165871667 -991426281 -490838183 209351416 134956137 -36128588 -754413937 -616596290 696201705 -201191199 967464971 -244181984 -729907974",
"output": "922371547895579571"
},
{
"input": "12 22\n-102896616 -311161241 -67541276 -402842686 -830595520 -813834033 -44046671 -584806552 -598620444 -968935604 -303048547 -545969410\n545786451 262898403 442511997 -441241260 -479587986 -752123290 720443264 500646237 737842681 -571966572 -798463881 -477248830 89875164 410339460 -359022689 -251280099 -441455542 -538431186 -406793869 374561004 -108755237 -440143410",
"output": "663200522440413120"
},
{
"input": "33 14\n-576562007 -218618150 -471719380 -583840778 -256368365 -68451917 -405045344 -775538133 -896830082 -439261765 -947070124 -716577019 -456110999 -689862512 -132480131 -10805271 -518903339 -196240188 -222292638 -828546042 -43887962 -161359263 -281422097 -484060534 963147664 -492377073 -154570101 -52145116 187803553 858844161 66540410 418777176 434025748\n-78301978 -319393213 -12393024 542953412 786804661 845642067 754996432 -985617475 -487171947 56142664 203173079 -268261708 -817080591 -511720682",
"output": "883931400924882950"
},
{
"input": "15 8\n-966400308 -992207261 -302395973 -837980754 -516443826 -492405613 -378127629 -762650324 -519519776 -36132939 -286460372 -351445284 -407653342 -604960925 -523442015\n610042288 27129580 -103108347 -942517864 842060508 -588904868 614786155 37455106",
"output": "910849554065102112"
},
{
"input": "6 30\n-524297819 -947277203 -444186475 -182837689 -385379656 -453917269\n834529938 35245081 663687669 585422565 164412867 850052113 796429008 -307345676 -127653313 426960600 211854713 -733687358 251466836 -33491050 -882811238 455544614 774581544 768447941 -241033484 441104324 -493975870 308277556 275268265 935941507 -152292053 -961509996 -740482111 -954176110 -924254634 -518710544",
"output": "504117593849498724"
},
{
"input": "5 32\n-540510995 -841481393 -94342377 -74818927 -93445356\n686714668 -82581175 736472406 502016312 575563638 -899308712 503504178 -644271272 -437408397 385778869 -746757839 306275973 -663503743 -431116516 -418708278 -515261493 -988182324 900230931 218258353 -714420102 -241118202 294802602 -937785552 -857537498 -723195312 -690515139 -214508504 -44086454 -231621215 -418360090 -810003786 -675944617",
"output": "534123411186652380"
},
{
"input": "32 13\n-999451897 -96946179 -524159869 -906101658 -63367320 -629803888 -968586834 -658416130 -874232857 -926556428 -749908220 -517073321 -659752288 -910152878 -786916085 -607633039 -191428642 -867952926 -873793977 -584331784 -733245792 -779809700 -554228536 -464503499 561577340 258991071 -569805979 -372655165 -106685554 -619607960 188856473 -268960803\n886429660 -587284372 911396803 -462990289 -228681210 -876239914 -822830527 -750131315 -401234943 116991909 -582713480 979631847 813552478",
"output": "848714444125692276"
},
{
"input": "12 25\n-464030345 -914672073 -483242132 -856226270 -925135169 -353124606 -294027092 -619650850 -490724485 -240424784 -483066792 -921640365\n279850608 726838739 -431610610 242749870 -244020223 -396865433 129534799 182767854 -939698671 342579400 330027106 893561388 -263513962 643369418 276245179 -99206565 -473767261 -168908664 -853755837 -270920164 -661186118 199341055 765543053 908211534 -93363867",
"output": "866064226130454915"
},
{
"input": "10 13\n-749120991 -186261632 -335412349 -231354880 -195919225 -808736065 -481883825 -263383991 -664780611 -605377134\n718174936 -140362196 -669193674 -598621021 -464130929 450701419 -331183926 107203430 946959233 -565825915 -558199897 246556991 -666216081",
"output": "501307028237810934"
},
{
"input": "17 13\n-483786205 -947257449 -125949195 -294711143 -420288876 -812462057 -250049555 -911026413 -188146919 -129501682 -869006661 -649643966 -26976411 -275761039 -869067490 -272248209 -342067346\n445539900 529728842 -808170728 673157826 -70778491 642872105 299298867 -76674218 -902394063 377664752 723887448 -121522827 906464625",
"output": "822104826327386019"
},
{
"input": "15 29\n-716525085 -464205793 -577203110 -979997115 -491032521 -70793687 -770595947 -817983495 -767886763 -223333719 -971913221 -944656683 -200397825 -295615495 -945544540\n-877638425 -146878165 523758517 -158778747 -49535534 597311016 77325385 494128313 12111658 -4196724 295706874 477139483 375083042 726254399 -439255703 662913604 -481588088 673747948 -345999555 -723334478 -656721905 276267528 628773156 851420802 -585029291 -643535709 -968999740 -384418713 -510285542",
"output": "941783658451562540"
},
{
"input": "5 7\n-130464232 -73113866 -542094710 -53118823 -63528720\n449942926 482853427 861095072 316710734 194604468 20277633 668816604",
"output": "-1288212069119760"
},
{
"input": "24 24\n-700068683 -418791905 -24650102 -167277317 -182309202 -517748507 -663050677 -854097070 -426998982 -197009558 -101944229 -746589957 -849018439 -774208211 -946709040 -594578249 -276703474 -434567489 -743600446 -625029074 -977300284 -895608684 -878936220 -850670748\n704881272 169877679 705460701 94083210 403943695 987978311 786162506 658067668 697640875 186287 295558596 286470276 251313879 353071193 755450449 173370603 805550377 192465301 168935494 110161743 285139426 985238736 723221868 520679017",
"output": "-18990884587723"
},
{
"input": "39 9\n44558618 981372779 318891054 283079237 285093436 907256321 414759796 652683534 79042330 249010687 7020063 309415438 788425492 138577429 714835649 954204512 795507844 389962019 507308352 408180613 194676444 44962879 922688019 101163040 327953325 560462120 183657590 273616448 226876035 233697890 720185285 689340674 372938362 15088928 283418109 796807778 149989495 694808087 276385512\n-681609072 -210918688 -757170622 -205635977 -597872997 -496188744 -97031207 -311654366 -389141528",
"output": "-1464096896176096"
},
{
"input": "5 7\n869535768 926886134 457905290 946881177 936471280\n-550057074 -517146573 -138904928 -683289266 -805395532 -979722367 -331183396",
"output": "-120782803247464704"
},
{
"input": "24 24\n299931317 581208095 975349898 832722683 817690798 482251493 336949323 145902930 573001018 802990442 898055771 253410043 150981561 225791789 53290960 405421751 723296526 565432511 256399554 374970926 22699716 104391316 121063780 149329252\n-295118728 -830122321 -294539299 -905916790 -596056305 -12021689 -213837494 -341932332 -302359125 -999813713 -704441404 -713529724 -748686121 -646928807 -244549551 -826629397 -194449623 -807534699 -831064506 -889838257 -714860574 -14761264 -276778132 -479320983",
"output": "-640647347631440"
},
{
"input": "14 8\n-1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "-1000000000000000000"
}
] | 1,667,774,205
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 87
| 77
| 2,252,800
|
n,m=map(int,input().split())
t=list(map(int,input().split()))
b=list(map(int,input().split()))
t.sort()
b.sort()
ans=10000000000000000000
an=-10000000000000000000
for i in range(len(t)):
an=-10000000000000000000
for k in range(len(t)):
if i==k:
continue;
else:
for j in range(len(b)):
an=max(an,t[k]*b[j])
ans=min(ans,an)
print(ans)
|
Title: A Compatible Pair
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nian is a monster which lives deep in the oceans. Once a year, it shows up on the land, devouring livestock and even people. In order to keep the monster away, people fill their villages with red colour, light, and cracking noise, all of which frighten the monster out of coming.
Little Tommy has *n* lanterns and Big Banban has *m* lanterns. Tommy's lanterns have brightness *a*1,<=*a*2,<=...,<=*a**n*, and Banban's have brightness *b*1,<=*b*2,<=...,<=*b**m* respectively.
Tommy intends to hide one of his lanterns, then Banban picks one of Tommy's non-hidden lanterns and one of his own lanterns to form a pair. The pair's brightness will be the product of the brightness of two lanterns.
Tommy wants to make the product as small as possible, while Banban tries to make it as large as possible.
You are asked to find the brightness of the chosen pair if both of them choose optimally.
Input Specification:
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=50).
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n*.
The third line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m*.
All the integers range from <=-<=109 to 109.
Output Specification:
Print a single integer — the brightness of the chosen pair.
Demo Input:
['2 2\n20 18\n2 14\n', '5 3\n-1 0 1 2 3\n-1 0 1\n']
Demo Output:
['252\n', '2\n']
Note:
In the first example, Tommy will hide 20 and Banban will choose 18 from Tommy and 14 from himself.
In the second example, Tommy will hide 3 and Banban will choose 2 from Tommy and 1 from himself.
|
```python
n,m=map(int,input().split())
t=list(map(int,input().split()))
b=list(map(int,input().split()))
t.sort()
b.sort()
ans=10000000000000000000
an=-10000000000000000000
for i in range(len(t)):
an=-10000000000000000000
for k in range(len(t)):
if i==k:
continue;
else:
for j in range(len(b)):
an=max(an,t[k]*b[j])
ans=min(ans,an)
print(ans)
```
| 3
|
|
919
|
B
|
Perfect Number
|
PROGRAMMING
| 1,100
|
[
"binary search",
"brute force",
"dp",
"implementation",
"number theory"
] | null | null |
We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer.
|
A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$).
|
A single number, denoting the $k$-th smallest perfect integer.
|
[
"1\n",
"2\n"
] |
[
"19\n",
"28\n"
] |
The first perfect integer is $19$ and the second one is $28$.
| 750
|
[
{
"input": "1",
"output": "19"
},
{
"input": "2",
"output": "28"
},
{
"input": "13",
"output": "136"
},
{
"input": "101",
"output": "1432"
},
{
"input": "1023",
"output": "100270"
},
{
"input": "9999",
"output": "10800010"
},
{
"input": "10000",
"output": "10800100"
},
{
"input": "2333",
"output": "310060"
},
{
"input": "9139",
"output": "10134010"
},
{
"input": "9859",
"output": "10422001"
},
{
"input": "5987",
"output": "2221201"
},
{
"input": "3",
"output": "37"
},
{
"input": "4",
"output": "46"
},
{
"input": "5",
"output": "55"
},
{
"input": "7",
"output": "73"
},
{
"input": "9",
"output": "91"
},
{
"input": "10",
"output": "109"
},
{
"input": "15",
"output": "154"
},
{
"input": "51",
"output": "613"
},
{
"input": "99",
"output": "1414"
},
{
"input": "138",
"output": "2224"
},
{
"input": "233",
"output": "5050"
},
{
"input": "666",
"output": "27100"
},
{
"input": "1234",
"output": "110206"
},
{
"input": "3567",
"output": "1033003"
},
{
"input": "4445",
"output": "1221301"
},
{
"input": "5689",
"output": "2114002"
},
{
"input": "6666",
"output": "3102004"
},
{
"input": "7777",
"output": "5300200"
},
{
"input": "8888",
"output": "10110061"
},
{
"input": "9411",
"output": "10214200"
},
{
"input": "5539",
"output": "2101114"
},
{
"input": "6259",
"output": "2511100"
},
{
"input": "2387",
"output": "312220"
},
{
"input": "8515",
"output": "10030114"
}
] | 1,668,083,756
| 2,147,483,647
|
PyPy 3-64
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 2
| 2,000
| 1,536,000
|
k = int(input())
pr_ch = [19, 28, 37, 46, 55, 64, 73, 82, 91]
i = 109
sum = 0
while len(pr_ch) < k:
j = i
while j//10>0:
sum += j%10
j //= 10
if sum > 10: j = 0
sum += j
if sum == 10: pr_ch.append(i)
print(pr_ch[k-1])
|
Title: Perfect Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We consider a positive integer perfect, if and only if the sum of its digits is exactly $10$. Given a positive integer $k$, your task is to find the $k$-th smallest perfect positive integer.
Input Specification:
A single line with a positive integer $k$ ($1 \leq k \leq 10\,000$).
Output Specification:
A single number, denoting the $k$-th smallest perfect integer.
Demo Input:
['1\n', '2\n']
Demo Output:
['19\n', '28\n']
Note:
The first perfect integer is $19$ and the second one is $28$.
|
```python
k = int(input())
pr_ch = [19, 28, 37, 46, 55, 64, 73, 82, 91]
i = 109
sum = 0
while len(pr_ch) < k:
j = i
while j//10>0:
sum += j%10
j //= 10
if sum > 10: j = 0
sum += j
if sum == 10: pr_ch.append(i)
print(pr_ch[k-1])
```
| 0
|
|
70
|
B
|
Text Messaging
|
PROGRAMMING
| 1,600
|
[
"expression parsing",
"greedy",
"strings"
] |
B. Text Messaging
|
1
|
256
|
Fangy the little walrus, as all the modern walruses, loves to communicate via text messaging. One day he faced the following problem: When he sends large texts, they are split into parts each containing *n* characters (which is the size of one text message). Thus, whole sentences and words get split!
Fangy did not like it, so he faced the task of breaking the text into minimal messages on his own so that no sentence were broken into pieces when it is sent and the number of text messages to be sent would be minimal. If two consecutive sentences are in different messages, the space between them can be ignored (Fangy does not write this space).
The little walrus's text looks in the following manner:
SPACE stands for the symbol of a space.
So, how many messages did Fangy send?
|
The first line contains an integer *n*, which is the size of one message (2<=≤<=*n*<=≤<=255). The second line contains the text. The length of the text does not exceed 104 characters. It is guaranteed that the text satisfies the above described format. Specifically, this implies that the text is not empty.
|
On the first and only line print the number of text messages Fangy will need. If it is impossible to split the text, print "Impossible" without the quotes.
|
[
"25\nHello. I am a little walrus.\n",
"2\nHow are you?\n",
"19\nHello! Do you like fish? Why?\n"
] |
[
"2\n",
"Impossible\n",
"3\n"
] |
Let's take a look at the third sample. The text will be split into three messages: "Hello!", "Do you like fish?" and "Why?".
| 1,000
|
[
{
"input": "25\nHello. I am a little walrus.",
"output": "2"
},
{
"input": "2\nHow are you?",
"output": "Impossible"
},
{
"input": "19\nHello! Do you like fish? Why?",
"output": "3"
},
{
"input": "4\na. A.",
"output": "2"
},
{
"input": "191\nEvx vnxZtUSgtzH yDNXCsTaxCKQus gVZLHppOplkGGekIK xbme. krbusMqUs YEnBBTJpjNicZPlx TqEtBPcbejZMzvn fFTub CHYWLmiOFkDdzR! LoQmXPfHJ KVnfrbrFooVSkj xwAZwrRr DdILZ kpco cLoRmJbVKhnbOEhnHKpci. PgYhxFPXdlvlrp mDLZBnVRf AgRMUjxepFuLyKlIAhLS wtmEiLDNUAHpZEsKnkOu!",
"output": "2"
},
{
"input": "146\niIQVkDsPqzAJyBrtHk EhBSN gzDoigItCMzETerb cIbXhTPbKYMdMoYqyFTEN. qcrrseVwmaZEiQUQoGT SUyErST lJDejKkjqTdoUrHR tsZYDyI? pmuNNHYqQUISxdZfWOB XdEECvNz hnNmVfODaIC qjhRIEPAlEsQBxo apZ! gCpqoiUFIwWLBOmYubywj qJojFVhLd dCpovICpXHfgihydEOoij?",
"output": "2"
},
{
"input": "151\nayDIuxJXWNqu OImqJLodviANkQNxZ OpDpwyoPQdZyosXJpqRx! ZFQNQJPnoEVUEEbjqs iyfUYK HuGCOtlsEllsCiHIdEuW ZmlRSWVOmLAD MSYsC? CGKxobjmddejDDdF qbQsAWi qxViwV iLmPHfhLjP ZfNCItjZikwaQyhQGC? bvSaaZhwHdbNKSiiI bEJXRjANEasfrElNHPA UuQCajtuODHgxwgL qbssJss TqT.",
"output": "2"
},
{
"input": "123\nOjg CVJm qfE RnHislFds nNKKt TCPLWukqNGAsVBplYbTfq? VeYKjfFGTzXWA ydpVZLIImNub yApKnAHv iXQmqv GjQvxrnAgtfTApiQyCKtg. GdmapGwvI udRqxTbnzgnOUNZx slAuEuLGCJycZJvtCczQ vommS xuuT eIK! DOJeFEaubbz HYLGlIIlNKfyaJQKVN eFNnUvKKCQLXvGhwX gjmRscMkedELUlHq? aTbyMGB EofzX wcAEjyRQpxghWvXhdJb cwIz FEUsEFicYZ.",
"output": "3"
},
{
"input": "126\ntjQvloOnRednqfvIRudX wAPhGdwEZ BiuuuAW EfSzDuRTdC rptjpHnxyM? FkLaTBruN IwuIQMdpdUpn etTVVJUsKztaR YNY EAENiDgJwYXDDrayjyuKp! yKqRNHznLRpnTqjisR LuapWDnWmwYDE NcClOZBNzMYrpa? SEZdSZIgBekpCPvyEiO AMjztArkFRJuS ilycvolFExqxrXJK. sLvBUxjIOomxUqYd jZsOXWN iBtqSykbeUbAsQgRVs DinPLrpzt.",
"output": "3"
},
{
"input": "118\ngweVo bjbEKaZQw PpSi AWOYt sQSvAHNRswh vUaGuLbtExNECz! USsQxMCjaGOmUESwHvyY SshkERibaWkmNLSZOtWZy FFTUWQgekPRjLRetAdSFt! sIhcimZTisFvndrYioLF HetLn wjoaDUKfbkagupl QdYb fFiV GNqBygStKQw. XLiYZEOGnTLSHmCwktEr pVBePMoRGopNt LdEujxuxzmlbycQdR?",
"output": "4"
},
{
"input": "16\nAbacaba. Abacaba. abacaba. abacab.",
"output": "3"
},
{
"input": "21\nHello. I am a little walrus.",
"output": "2"
},
{
"input": "16\nAbacaba. Abacab. abacaba. abacaba.",
"output": "3"
},
{
"input": "10\nhello! how are you?",
"output": "Impossible"
},
{
"input": "5\nabc. abcd.",
"output": "2"
},
{
"input": "16\nabacaba. abacab. Abacaba. Abacaba.",
"output": "3"
},
{
"input": "5\na. b. c. d.",
"output": "2"
},
{
"input": "8\nabc! ab.",
"output": "1"
},
{
"input": "2\na. b.",
"output": "2"
}
] | 1,690,496,541
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
print("_RANDOM_GUESS_1690496541.0089602")# 1690496541.0089831
|
Title: Text Messaging
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Fangy the little walrus, as all the modern walruses, loves to communicate via text messaging. One day he faced the following problem: When he sends large texts, they are split into parts each containing *n* characters (which is the size of one text message). Thus, whole sentences and words get split!
Fangy did not like it, so he faced the task of breaking the text into minimal messages on his own so that no sentence were broken into pieces when it is sent and the number of text messages to be sent would be minimal. If two consecutive sentences are in different messages, the space between them can be ignored (Fangy does not write this space).
The little walrus's text looks in the following manner:
SPACE stands for the symbol of a space.
So, how many messages did Fangy send?
Input Specification:
The first line contains an integer *n*, which is the size of one message (2<=≤<=*n*<=≤<=255). The second line contains the text. The length of the text does not exceed 104 characters. It is guaranteed that the text satisfies the above described format. Specifically, this implies that the text is not empty.
Output Specification:
On the first and only line print the number of text messages Fangy will need. If it is impossible to split the text, print "Impossible" without the quotes.
Demo Input:
['25\nHello. I am a little walrus.\n', '2\nHow are you?\n', '19\nHello! Do you like fish? Why?\n']
Demo Output:
['2\n', 'Impossible\n', '3\n']
Note:
Let's take a look at the third sample. The text will be split into three messages: "Hello!", "Do you like fish?" and "Why?".
|
```python
print("_RANDOM_GUESS_1690496541.0089602")# 1690496541.0089831
```
| 0
|
842
|
B
|
Gleb And Pizza
|
PROGRAMMING
| 1,100
|
[
"geometry"
] | null | null |
Gleb ordered pizza home. When the courier delivered the pizza, he was very upset, because several pieces of sausage lay on the crust, and he does not really like the crust.
The pizza is a circle of radius *r* and center at the origin. Pizza consists of the main part — circle of radius *r*<=-<=*d* with center at the origin, and crust around the main part of the width *d*. Pieces of sausage are also circles. The radius of the *i* -th piece of the sausage is *r**i*, and the center is given as a pair (*x**i*, *y**i*).
Gleb asks you to help determine the number of pieces of sausage caught on the crust. A piece of sausage got on the crust, if it completely lies on the crust.
|
First string contains two integer numbers *r* and *d* (0<=≤<=*d*<=<<=*r*<=≤<=500) — the radius of pizza and the width of crust.
Next line contains one integer number *n* — the number of pieces of sausage (1<=≤<=*n*<=≤<=105).
Each of next *n* lines contains three integer numbers *x**i*, *y**i* and *r**i* (<=-<=500<=≤<=*x**i*,<=*y**i*<=≤<=500, 0<=≤<=*r**i*<=≤<=500), where *x**i* and *y**i* are coordinates of the center of *i*-th peace of sausage, *r**i* — radius of *i*-th peace of sausage.
|
Output the number of pieces of sausage that lay on the crust.
|
[
"8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1\n",
"10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2\n"
] |
[
"2\n",
"0\n"
] |
Below is a picture explaining the first example. Circles of green color denote pieces of sausage lying on the crust.
| 1,000
|
[
{
"input": "8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1",
"output": "2"
},
{
"input": "10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2",
"output": "0"
},
{
"input": "1 0\n1\n1 1 0",
"output": "0"
},
{
"input": "3 0\n5\n3 0 0\n0 3 0\n-3 0 0\n0 -3 0\n3 0 1",
"output": "4"
},
{
"input": "9 0\n5\n8 1 0\n8 2 0\n8 3 0\n-8 3 0\n-8 2 0",
"output": "0"
},
{
"input": "10 2\n11\n1 1 0\n2 2 3\n3 3 0\n4 4 0\n5 5 0\n6 6 0\n7 7 4\n8 8 7\n9 9 3\n10 10 100\n9 0 1",
"output": "2"
},
{
"input": "5 3\n1\n500 500 10",
"output": "0"
}
] | 1,620,833,407
| 307
|
Python 3
|
OK
|
TESTS
| 34
| 405
| 6,758,400
|
r , d = map(int, input().split())
n = int(input())
k = 0
for i in range(n):
x, y, w = map(int, input().split())
l = (x**2 + y**2)**(1/2)
if l-w >= r-d and l+w <= r:
k += 1
print(k)
|
Title: Gleb And Pizza
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gleb ordered pizza home. When the courier delivered the pizza, he was very upset, because several pieces of sausage lay on the crust, and he does not really like the crust.
The pizza is a circle of radius *r* and center at the origin. Pizza consists of the main part — circle of radius *r*<=-<=*d* with center at the origin, and crust around the main part of the width *d*. Pieces of sausage are also circles. The radius of the *i* -th piece of the sausage is *r**i*, and the center is given as a pair (*x**i*, *y**i*).
Gleb asks you to help determine the number of pieces of sausage caught on the crust. A piece of sausage got on the crust, if it completely lies on the crust.
Input Specification:
First string contains two integer numbers *r* and *d* (0<=≤<=*d*<=<<=*r*<=≤<=500) — the radius of pizza and the width of crust.
Next line contains one integer number *n* — the number of pieces of sausage (1<=≤<=*n*<=≤<=105).
Each of next *n* lines contains three integer numbers *x**i*, *y**i* and *r**i* (<=-<=500<=≤<=*x**i*,<=*y**i*<=≤<=500, 0<=≤<=*r**i*<=≤<=500), where *x**i* and *y**i* are coordinates of the center of *i*-th peace of sausage, *r**i* — radius of *i*-th peace of sausage.
Output Specification:
Output the number of pieces of sausage that lay on the crust.
Demo Input:
['8 4\n7\n7 8 1\n-7 3 2\n0 2 1\n0 -2 2\n-3 -3 1\n0 6 2\n5 3 1\n', '10 8\n4\n0 0 9\n0 0 10\n1 0 1\n1 0 2\n']
Demo Output:
['2\n', '0\n']
Note:
Below is a picture explaining the first example. Circles of green color denote pieces of sausage lying on the crust.
|
```python
r , d = map(int, input().split())
n = int(input())
k = 0
for i in range(n):
x, y, w = map(int, input().split())
l = (x**2 + y**2)**(1/2)
if l-w >= r-d and l+w <= r:
k += 1
print(k)
```
| 3
|
|
385
|
A
|
Bear and Raspberry
|
PROGRAMMING
| 1,000
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
|
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
|
Print a single integer — the answer to the problem.
|
[
"5 1\n5 10 7 3 20\n",
"6 2\n100 1 10 40 10 40\n",
"3 0\n1 2 3\n"
] |
[
"3\n",
"97\n",
"0\n"
] |
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
| 500
|
[
{
"input": "5 1\n5 10 7 3 20",
"output": "3"
},
{
"input": "6 2\n100 1 10 40 10 40",
"output": "97"
},
{
"input": "3 0\n1 2 3",
"output": "0"
},
{
"input": "2 0\n2 1",
"output": "1"
},
{
"input": "10 5\n10 1 11 2 12 3 13 4 14 5",
"output": "4"
},
{
"input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77",
"output": "87"
},
{
"input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93",
"output": "84"
},
{
"input": "6 100\n10 9 8 7 6 5",
"output": "0"
},
{
"input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46",
"output": "78"
},
{
"input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44",
"output": "0"
},
{
"input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62",
"output": "4"
},
{
"input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71",
"output": "0"
},
{
"input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1",
"output": "0"
},
{
"input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27",
"output": "63"
},
{
"input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22",
"output": "38"
},
{
"input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83",
"output": "91"
},
{
"input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14",
"output": "79"
},
{
"input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24",
"output": "91"
},
{
"input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49",
"output": "83"
},
{
"input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70",
"output": "94"
},
{
"input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42",
"output": "43"
},
{
"input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0",
"output": "100"
},
{
"input": "3 1\n1 2 3",
"output": "0"
},
{
"input": "3 2\n3 3 3",
"output": "0"
},
{
"input": "3 3\n3 2 1",
"output": "0"
},
{
"input": "3 100\n1 2 3",
"output": "0"
},
{
"input": "2 100\n0 0",
"output": "0"
},
{
"input": "2 90\n10 5",
"output": "0"
},
{
"input": "2 5\n5 4",
"output": "0"
},
{
"input": "3 1\n19 20 1",
"output": "18"
},
{
"input": "5 1\n5 10 7 4 20",
"output": "2"
},
{
"input": "5 1\n1 2 3 4 5",
"output": "0"
}
] | 1,585,205,453
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 32
| 155
| 0
|
n,k =map(int,input().split())
a = list(map(int,input().split()))
t=0
for i in range(n-1):
t = max(t,a[i]-a[i+1]-k)
print(t)
|
Title: Bear and Raspberry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
Input Specification:
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n']
Demo Output:
['3\n', '97\n', '0\n']
Note:
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
|
```python
n,k =map(int,input().split())
a = list(map(int,input().split()))
t=0
for i in range(n-1):
t = max(t,a[i]-a[i+1]-k)
print(t)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,669,030,198
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 30
| 124
| 0
|
word = input()
upper = 0
for x in word:
if ord(x) < ord("a"):
upper += 1
if upper > (len(word) / 2):
print(word.upper())
else:
print(word.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
word = input()
upper = 0
for x in word:
if ord(x) < ord("a"):
upper += 1
if upper > (len(word) / 2):
print(word.upper())
else:
print(word.lower())
```
| 3.969
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Есть *n*-подъездный дом, в каждом подъезде по *m* этажей, и на каждом этаже каждого подъезда ровно *k* квартир. Таким образом, в доме всего *n*·*m*·*k* квартир. Они пронумерованы естественным образом от 1 до *n*·*m*·*k*, то есть первая квартира на первом этаже в первом подъезде имеет номер 1, первая квартира на втором этаже первого подъезда имеет номер *k*<=+<=1 и так далее. Особенность этого дома состоит в том, что он круглый. То есть если обходить его по часовой стрелке, то после подъезда номер 1 следует подъезд номер 2, затем подъезд номер 3 и так далее до подъезда номер *n*. После подъезда номер *n* снова идёт подъезд номер 1.
Эдвард живёт в квартире номер *a*, а Наташа — в квартире номер *b*. Переход на 1 этаж вверх или вниз по лестнице занимает 5 секунд, переход от двери подъезда к двери соседнего подъезда — 15 секунд, а переход в пределах одного этажа одного подъезда происходит мгновенно. Также в каждом подъезде дома есть лифт. Он устроен следующим образом: он всегда приезжает ровно через 10 секунд после вызова, а чтобы переместить пассажира на один этаж вверх или вниз, лифт тратит ровно 1 секунду. Посадка и высадка происходят мгновенно.
Помогите Эдварду найти минимальное время, за которое он сможет добраться до квартиры Наташи. Считайте, что Эдвард может выйти из подъезда только с первого этажа соответствующего подъезда (это происходит мгновенно). Если Эдвард стоит перед дверью какого-то подъезда, он может зайти в него и сразу окажется на первом этаже этого подъезда (это также происходит мгновенно). Эдвард может выбирать, в каком направлении идти вокруг дома.
|
В первой строке входных данных следуют три числа *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — количество подъездов в доме, количество этажей в каждом подъезде и количество квартир на каждом этаже каждого подъезда соответственно.
Во второй строке входных данных записаны два числа *a* и *b* (1<=≤<=*a*,<=*b*<=≤<=*n*·*m*·*k*) — номера квартир, в которых живут Эдвард и Наташа, соответственно. Гарантируется, что эти номера различны.
|
Выведите единственное целое число — минимальное время (в секундах), за которое Эдвард сможет добраться от своей квартиры до квартиры Наташи.
|
[
"4 10 5\n200 6\n",
"3 1 5\n7 2\n"
] |
[
"39\n",
"15\n"
] |
В первом тестовом примере Эдвард находится в 4 подъезде на 10 этаже, а Наташа находится в 1 подъезде на 2 этаже. Поэтому Эдварду выгодно сначала спуститься на лифте на первый этаж (на это он потратит 19 секунд, из которых 10 — на ожидание и 9 — на поездку на лифте), затем обойти дом против часовой стрелки до подъезда номер 1 (на это он потратит 15 секунд), и наконец подняться по лестнице на этаж номер 2 (на это он потратит 5 секунд). Таким образом, ответ равен 19 + 15 + 5 = 39.
Во втором тестовом примере Эдвард живёт в подъезде 2 на этаже 1, а Наташа находится в подъезде 1 на этаже 1. Поэтому Эдварду выгодно просто обойти дом по часовой стрелке до подъезда 1, на это он потратит 15 секунд.
| 0
|
[
{
"input": "4 10 5\n200 6",
"output": "39"
},
{
"input": "3 1 5\n7 2",
"output": "15"
},
{
"input": "100 100 100\n1 1000000",
"output": "124"
},
{
"input": "1000 1000 1000\n1 1000000000",
"output": "1024"
},
{
"input": "125 577 124\n7716799 6501425",
"output": "1268"
},
{
"input": "624 919 789\n436620192 451753897",
"output": "509"
},
{
"input": "314 156 453\n9938757 14172410",
"output": "1104"
},
{
"input": "301 497 118\n11874825 13582548",
"output": "994"
},
{
"input": "491 980 907\n253658701 421137262",
"output": "3985"
},
{
"input": "35 296 7\n70033 65728",
"output": "499"
},
{
"input": "186 312 492\n19512588 5916903",
"output": "1560"
},
{
"input": "149 186 417\n11126072 11157575",
"output": "85"
},
{
"input": "147 917 539\n55641190 66272443",
"output": "952"
},
{
"input": "200 970 827\n113595903 145423943",
"output": "1484"
},
{
"input": "32 15 441\n163561 23326",
"output": "202"
},
{
"input": "748 428 661\n136899492 11286206",
"output": "5347"
},
{
"input": "169 329 585\n30712888 19040968",
"output": "1430"
},
{
"input": "885 743 317\n191981621 16917729",
"output": "2825"
},
{
"input": "245 168 720\n24072381 125846",
"output": "726"
},
{
"input": "593 174 843\n72930566 9954376",
"output": "2650"
},
{
"input": "41 189 839\n6489169 411125",
"output": "351"
},
{
"input": "437 727 320\n93935485 28179924",
"output": "3007"
},
{
"input": "722 42 684\n18861511 1741045",
"output": "1958"
},
{
"input": "324 584 915\n61572963 155302434",
"output": "2756"
},
{
"input": "356 444 397\n1066682 58120717",
"output": "860"
},
{
"input": "266 675 472\n11637902 74714734",
"output": "1739"
},
{
"input": "841 727 726\n101540521 305197765",
"output": "6264"
},
{
"input": "828 68 391\n3563177 21665321",
"output": "2288"
},
{
"input": "666 140 721\n30509638 63426599",
"output": "4995"
},
{
"input": "151 489 61\n2561086 4227874",
"output": "1640"
},
{
"input": "713 882 468\n5456682 122694685",
"output": "4687"
},
{
"input": "676 53 690\n1197227 20721162",
"output": "2221"
},
{
"input": "618 373 56\n531564 11056643",
"output": "2020"
},
{
"input": "727 645 804\n101269988 374485315",
"output": "3289"
},
{
"input": "504 982 254\n101193488 5004310",
"output": "2556"
},
{
"input": "872 437 360\n5030750 15975571",
"output": "1736"
},
{
"input": "448 297 806\n60062303 9056580",
"output": "3730"
},
{
"input": "165 198 834\n16752490 5105535",
"output": "1354"
},
{
"input": "816 145 656\n32092038 5951215",
"output": "4281"
},
{
"input": "28 883 178\n2217424 1296514",
"output": "424"
},
{
"input": "24 644 653\n1326557 3894568",
"output": "377"
},
{
"input": "717 887 838\n46183300 63974260",
"output": "556"
},
{
"input": "101 315 916\n1624396 1651649",
"output": "40"
},
{
"input": "604 743 433\n78480401 16837572",
"output": "3833"
},
{
"input": "100 100 100\n1 10000",
"output": "109"
},
{
"input": "100 100 100\n1000000 990001",
"output": "109"
},
{
"input": "1 1 2\n1 2",
"output": "0"
},
{
"input": "34 34 34\n20000 20001",
"output": "0"
},
{
"input": "139 252 888\n24732218 24830663",
"output": "121"
},
{
"input": "859 96 634\n26337024 26313792",
"output": "47"
},
{
"input": "987 237 891\n41648697 41743430",
"output": "117"
},
{
"input": "411 81 149\n4799008 4796779",
"output": "25"
},
{
"input": "539 221 895\n18072378 18071555",
"output": "5"
},
{
"input": "259 770 448\n19378646 19320867",
"output": "139"
},
{
"input": "387 422 898\n89303312 89285292",
"output": "30"
},
{
"input": "515 563 451\n12182093 12047399",
"output": "309"
},
{
"input": "939 407 197\n42361632 42370846",
"output": "57"
},
{
"input": "518 518 71\n3540577 3556866",
"output": "239"
},
{
"input": "100 1 1\n55 1",
"output": "690"
},
{
"input": "1000 1000 1000\n1 10000000",
"output": "1144"
},
{
"input": "1000 1000 1000\n1000000000 990000001",
"output": "1144"
},
{
"input": "340 340 340\n200000 200001",
"output": "0"
},
{
"input": "1000 1 1\n556 1",
"output": "6675"
},
{
"input": "2 3 4\n1 2",
"output": "0"
},
{
"input": "2 3 4\n1 3",
"output": "0"
},
{
"input": "2 3 4\n1 4",
"output": "0"
},
{
"input": "2 3 4\n1 5",
"output": "5"
},
{
"input": "2 3 4\n1 6",
"output": "5"
},
{
"input": "2 3 4\n1 7",
"output": "5"
},
{
"input": "2 3 4\n1 8",
"output": "5"
},
{
"input": "2 3 4\n7 8",
"output": "0"
},
{
"input": "2 3 4\n7 9",
"output": "5"
},
{
"input": "2 3 4\n7 10",
"output": "5"
},
{
"input": "2 3 4\n7 11",
"output": "5"
},
{
"input": "2 3 4\n7 12",
"output": "5"
},
{
"input": "2 3 4\n11 12",
"output": "0"
},
{
"input": "2 3 4\n12 13",
"output": "25"
},
{
"input": "2 3 4\n12 14",
"output": "25"
},
{
"input": "2 3 4\n12 24",
"output": "35"
},
{
"input": "1000 1000 1000\n600400021 600400051",
"output": "0"
},
{
"input": "1 2 4\n7 8",
"output": "0"
},
{
"input": "1 1000 1\n42 43",
"output": "5"
},
{
"input": "10 10 1\n2 3",
"output": "5"
},
{
"input": "1 3 1\n2 3",
"output": "5"
},
{
"input": "1 9 1\n6 9",
"output": "13"
},
{
"input": "4 10 5\n6 7",
"output": "0"
},
{
"input": "1 10 10\n40 80",
"output": "14"
},
{
"input": "1 5 1\n5 4",
"output": "5"
},
{
"input": "1 1000 1\n42 228",
"output": "196"
},
{
"input": "4 10 5\n200 199",
"output": "0"
},
{
"input": "1 9 1\n6 7",
"output": "5"
},
{
"input": "2 5 1\n10 9",
"output": "5"
},
{
"input": "1 5 1\n1 5",
"output": "14"
},
{
"input": "1 5 1\n2 5",
"output": "13"
},
{
"input": "3 3 2\n3 5",
"output": "5"
},
{
"input": "1 5 1\n4 5",
"output": "5"
},
{
"input": "1 4 1\n2 4",
"output": "10"
},
{
"input": "1 9 1\n3 6",
"output": "13"
}
] | 1,458,977,597
| 1,997
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 0
| 30
| 4,608,000
|
n, m, k = map(int, input().split())
a, b = map(int, input().split())
podE = a // (m * k)
if a % (m * k) != 0:
podE += 1
podN = b // (m * k)
if b % (m * k) != 0:
podN += 1
etE = (a % (m * k)) // k
if (a % (m * k)) % k != 0:
etE += 1
etN = (b % (m * k)) // k
if (b % (m * k)) % k != 0:
etN += 1
if podE == podN and etE == etN:
print(0)
elif podE == podN:
print(min(abs(etE - etN) * 5, 10 + abs(etE - etN)))
else:
down = min((etE - 1) * 5, 10 + (etE - 1))
move = min(abs(podE - podN), (n - podE) + podN) * 15
up = min((etN - 1) * 5, 10 + (etN - 1))
print(down + move + up)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Есть *n*-подъездный дом, в каждом подъезде по *m* этажей, и на каждом этаже каждого подъезда ровно *k* квартир. Таким образом, в доме всего *n*·*m*·*k* квартир. Они пронумерованы естественным образом от 1 до *n*·*m*·*k*, то есть первая квартира на первом этаже в первом подъезде имеет номер 1, первая квартира на втором этаже первого подъезда имеет номер *k*<=+<=1 и так далее. Особенность этого дома состоит в том, что он круглый. То есть если обходить его по часовой стрелке, то после подъезда номер 1 следует подъезд номер 2, затем подъезд номер 3 и так далее до подъезда номер *n*. После подъезда номер *n* снова идёт подъезд номер 1.
Эдвард живёт в квартире номер *a*, а Наташа — в квартире номер *b*. Переход на 1 этаж вверх или вниз по лестнице занимает 5 секунд, переход от двери подъезда к двери соседнего подъезда — 15 секунд, а переход в пределах одного этажа одного подъезда происходит мгновенно. Также в каждом подъезде дома есть лифт. Он устроен следующим образом: он всегда приезжает ровно через 10 секунд после вызова, а чтобы переместить пассажира на один этаж вверх или вниз, лифт тратит ровно 1 секунду. Посадка и высадка происходят мгновенно.
Помогите Эдварду найти минимальное время, за которое он сможет добраться до квартиры Наташи. Считайте, что Эдвард может выйти из подъезда только с первого этажа соответствующего подъезда (это происходит мгновенно). Если Эдвард стоит перед дверью какого-то подъезда, он может зайти в него и сразу окажется на первом этаже этого подъезда (это также происходит мгновенно). Эдвард может выбирать, в каком направлении идти вокруг дома.
Input Specification:
В первой строке входных данных следуют три числа *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=1000) — количество подъездов в доме, количество этажей в каждом подъезде и количество квартир на каждом этаже каждого подъезда соответственно.
Во второй строке входных данных записаны два числа *a* и *b* (1<=≤<=*a*,<=*b*<=≤<=*n*·*m*·*k*) — номера квартир, в которых живут Эдвард и Наташа, соответственно. Гарантируется, что эти номера различны.
Output Specification:
Выведите единственное целое число — минимальное время (в секундах), за которое Эдвард сможет добраться от своей квартиры до квартиры Наташи.
Demo Input:
['4 10 5\n200 6\n', '3 1 5\n7 2\n']
Demo Output:
['39\n', '15\n']
Note:
В первом тестовом примере Эдвард находится в 4 подъезде на 10 этаже, а Наташа находится в 1 подъезде на 2 этаже. Поэтому Эдварду выгодно сначала спуститься на лифте на первый этаж (на это он потратит 19 секунд, из которых 10 — на ожидание и 9 — на поездку на лифте), затем обойти дом против часовой стрелки до подъезда номер 1 (на это он потратит 15 секунд), и наконец подняться по лестнице на этаж номер 2 (на это он потратит 5 секунд). Таким образом, ответ равен 19 + 15 + 5 = 39.
Во втором тестовом примере Эдвард живёт в подъезде 2 на этаже 1, а Наташа находится в подъезде 1 на этаже 1. Поэтому Эдварду выгодно просто обойти дом по часовой стрелке до подъезда 1, на это он потратит 15 секунд.
|
```python
n, m, k = map(int, input().split())
a, b = map(int, input().split())
podE = a // (m * k)
if a % (m * k) != 0:
podE += 1
podN = b // (m * k)
if b % (m * k) != 0:
podN += 1
etE = (a % (m * k)) // k
if (a % (m * k)) % k != 0:
etE += 1
etN = (b % (m * k)) // k
if (b % (m * k)) % k != 0:
etN += 1
if podE == podN and etE == etN:
print(0)
elif podE == podN:
print(min(abs(etE - etN) * 5, 10 + abs(etE - etN)))
else:
down = min((etE - 1) * 5, 10 + (etE - 1))
move = min(abs(podE - podN), (n - podE) + podN) * 15
up = min((etN - 1) * 5, 10 + (etN - 1))
print(down + move + up)
```
| 0
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,690,021,383
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 62
| 0
|
import math
num = input().split(' ')
n = int(num[0])
k = int(num[1])
print(math.floor(n*k/2))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
import math
num = input().split(' ')
n = int(num[0])
k = int(num[1])
print(math.floor(n*k/2))
```
| 3.9845
|
844
|
B
|
Rectangles
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"math"
] | null | null |
You are given *n*<=×<=*m* table. Each cell of the table is colored white or black. Find the number of non-empty sets of cells such that:
1. All cells in a set have the same color. 1. Every two cells in a set share row or column.
|
The first line of input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the number of rows and the number of columns correspondingly.
The next *n* lines of input contain descriptions of rows. There are *m* integers, separated by spaces, in each line. The number equals 0 if the corresponding cell is colored white and equals 1 if the corresponding cell is colored black.
|
Output single integer — the number of non-empty sets from the problem description.
|
[
"1 1\n0\n",
"2 3\n1 0 1\n0 1 0\n"
] |
[
"1\n",
"8\n"
] |
In the second example, there are six one-element sets. Additionally, there are two two-element sets, the first one consists of the first and the third cells of the first row, the second one consists of the first and the third cells of the second row. To sum up, there are 8 sets.
| 1,000
|
[
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "2 3\n1 0 1\n0 1 0",
"output": "8"
},
{
"input": "2 2\n1 1\n1 1",
"output": "8"
},
{
"input": "1 10\n0 0 0 0 0 0 0 0 0 0",
"output": "1023"
},
{
"input": "11 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "2047"
},
{
"input": "10 11\n1 1 0 1 1 0 0 0 1 0 0\n1 0 0 1 1 1 0 0 1 1 0\n0 0 1 0 1 1 0 1 0 1 1\n0 1 1 1 0 1 0 1 0 0 0\n1 1 1 1 1 1 1 0 1 0 0\n1 1 0 1 1 1 1 0 0 1 1\n1 0 1 0 1 0 0 1 1 1 0\n1 1 0 0 0 0 0 1 0 1 1\n1 1 0 1 1 1 0 0 1 1 0\n1 0 1 1 0 0 1 0 0 1 1",
"output": "2444"
},
{
"input": "50 1\n0\n1\n0\n1\n0\n1\n0\n1\n1\n1\n0\n0\n1\n0\n0\n1\n1\n1\n1\n0\n1\n1\n0\n1\n1\n1\n0\n1\n0\n0\n0\n1\n1\n0\n1\n1\n0\n1\n0\n1\n0\n0\n1\n0\n0\n0\n1\n1\n0\n1",
"output": "142606334"
},
{
"input": "1 50\n0 1 0 1 0 1 0 1 1 1 0 0 1 0 0 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 0 1 1 0 1 1 0 1 0 1 0 0 1 0 0 0 1 1 0 1",
"output": "142606334"
},
{
"input": "2 20\n0 1 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 0 1 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0",
"output": "589853"
},
{
"input": "5 5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "285"
},
{
"input": "6 6\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1",
"output": "720"
},
{
"input": "21 2\n0 1\n1 1\n0 1\n0 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "1310745"
},
{
"input": "3 15\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 1 0 1 0 0 0 0 0 1 0\n1 0 0 1 0 0 0 0 0 0 0 0 1 0 1",
"output": "22587"
},
{
"input": "10 11\n0 1 0 0 0 0 0 0 0 0 0\n0 1 0 1 0 0 1 0 0 0 0\n0 0 0 0 0 0 1 1 1 0 0\n0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 1 0 0 0 0 1 0\n0 0 0 0 0 0 1 0 0 0 0\n0 0 0 0 0 0 0 0 0 1 0\n0 0 1 0 0 0 1 1 0 0 0\n0 0 0 0 0 0 0 0 1 0 0\n0 0 1 0 1 0 0 0 0 1 1",
"output": "12047"
},
{
"input": "14 15\n0 1 0 0 0 0 0 0 1 0 0 0 1 0 1\n0 0 0 1 1 1 1 0 1 0 0 1 1 0 0\n1 0 0 0 0 1 1 0 0 0 0 0 0 0 0\n0 1 0 0 0 1 0 1 1 0 0 1 0 0 0\n0 0 1 1 0 1 0 1 0 1 1 0 1 0 0\n0 0 0 1 1 0 0 0 0 0 1 1 0 1 0\n0 0 1 0 0 0 0 0 0 1 0 0 1 1 0\n1 1 0 0 0 1 0 0 0 0 0 0 1 1 0\n0 0 0 0 1 0 1 1 1 0 0 0 1 0 1\n1 0 1 1 0 1 0 0 1 0 0 1 1 1 0\n1 0 0 0 0 1 0 0 0 0 0 1 0 0 0\n0 0 0 1 0 1 0 0 0 0 1 0 0 0 1\n0 0 1 0 1 0 0 0 1 1 1 1 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 1 0 0 0",
"output": "53166"
},
{
"input": "1 50\n0 0 0 0 0 0 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 1 1 0 0 1 0 0 0 0 1 0 0 0 1 0 0",
"output": "1099511628798"
},
{
"input": "50 1\n0\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1",
"output": "35184372088862"
},
{
"input": "1 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1125899906842623"
},
{
"input": "5 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5629499534214415"
},
{
"input": "32 2\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "8589934622"
},
{
"input": "1 50\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "562949953421312"
},
{
"input": "50 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1125899906842623"
},
{
"input": "1 49\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "562949953421311"
},
{
"input": "2 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2251799813685296"
},
{
"input": "3 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "3377699720528069"
},
{
"input": "1 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1125899906842623"
},
{
"input": "1 40\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1099511627775"
},
{
"input": "1 33\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "8589934591"
},
{
"input": "2 40\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2199023255590"
},
{
"input": "1 35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "34359738367"
},
{
"input": "50 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "1125899906842623"
}
] | 1,504,015,643
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
n,k=map(int,input().split())
a=[]
suma=0
for i in range(n):
a.append(list(input()))
for i in a:
suma+=2**i.count("1")+2**i.count("0")-2
for i in range(k):
b=[]
for j in a:
b.append(j[i])
suma+=2**b.count("1")+2**b.count("0")-2
print(suma-n*k+2)
|
Title: Rectangles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n*<=×<=*m* table. Each cell of the table is colored white or black. Find the number of non-empty sets of cells such that:
1. All cells in a set have the same color. 1. Every two cells in a set share row or column.
Input Specification:
The first line of input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the number of rows and the number of columns correspondingly.
The next *n* lines of input contain descriptions of rows. There are *m* integers, separated by spaces, in each line. The number equals 0 if the corresponding cell is colored white and equals 1 if the corresponding cell is colored black.
Output Specification:
Output single integer — the number of non-empty sets from the problem description.
Demo Input:
['1 1\n0\n', '2 3\n1 0 1\n0 1 0\n']
Demo Output:
['1\n', '8\n']
Note:
In the second example, there are six one-element sets. Additionally, there are two two-element sets, the first one consists of the first and the third cells of the first row, the second one consists of the first and the third cells of the second row. To sum up, there are 8 sets.
|
```python
n,k=map(int,input().split())
a=[]
suma=0
for i in range(n):
a.append(list(input()))
for i in a:
suma+=2**i.count("1")+2**i.count("0")-2
for i in range(k):
b=[]
for j in a:
b.append(j[i])
suma+=2**b.count("1")+2**b.count("0")-2
print(suma-n*k+2)
```
| 0
|
|
431
|
A
|
Black Square
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
|
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104).
The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
|
Print a single integer — the total number of calories that Jury wastes.
|
[
"1 2 3 4\n123214\n",
"1 5 3 2\n11221\n"
] |
[
"13\n",
"13\n"
] |
none
| 500
|
[
{
"input": "1 2 3 4\n123214",
"output": "13"
},
{
"input": "1 5 3 2\n11221",
"output": "13"
},
{
"input": "5 5 5 1\n3422",
"output": "16"
},
{
"input": "4 3 2 1\n2",
"output": "3"
},
{
"input": "5651 6882 6954 4733\n2442313421",
"output": "60055"
},
{
"input": "0 0 0 0\n4132",
"output": "0"
},
{
"input": "3163 5778 83 7640\n11141442444",
"output": "64270"
},
{
"input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442",
"output": "420780"
},
{
"input": "0 0 0 0\n1",
"output": "0"
},
{
"input": "1 2 3 4\n4",
"output": "4"
},
{
"input": "2343 7653 1242 5432\n1",
"output": "2343"
},
{
"input": "2343 7653 1242 5432\n2",
"output": "7653"
},
{
"input": "2343 7653 1242 5432\n3",
"output": "1242"
},
{
"input": "2343 7653 1242 5432\n4",
"output": "5432"
},
{
"input": "1 2 3 4\n123412",
"output": "13"
},
{
"input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111",
"output": "2650"
},
{
"input": "1 2 3 4\n11111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "1 2 3 4\n23123231321231231231231231221232123121312321",
"output": "87"
},
{
"input": "1 2 3 4\n1111111111111222222222233333333333444444444444444",
"output": "126"
},
{
"input": "2 3 1 4\n121321232412342112312313213123123412131231231232",
"output": "105"
}
] | 1,660,264,604
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 49
| 77
| 1,740,800
|
a1, a2, a3, a4 = map(int, input().split())
calories = {}
calories["1"] = a1
calories["2"] = a2
calories["3"] = a3
calories["4"] = a4
total_calories = 0
s = input()
for c in s:
total_calories += calories[c]
print(total_calories)
|
Title: Black Square
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
Input Specification:
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104).
The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Output Specification:
Print a single integer — the total number of calories that Jury wastes.
Demo Input:
['1 2 3 4\n123214\n', '1 5 3 2\n11221\n']
Demo Output:
['13\n', '13\n']
Note:
none
|
```python
a1, a2, a3, a4 = map(int, input().split())
calories = {}
calories["1"] = a1
calories["2"] = a2
calories["3"] = a3
calories["4"] = a4
total_calories = 0
s = input()
for c in s:
total_calories += calories[c]
print(total_calories)
```
| 3
|
|
797
|
B
|
Odd sum
|
PROGRAMMING
| 1,400
|
[
"dp",
"greedy",
"implementation"
] | null | null |
You are given sequence *a*1,<=*a*2,<=...,<=*a**n* of integer numbers of length *n*. Your task is to find such subsequence that its sum is odd and maximum among all such subsequences. It's guaranteed that given sequence contains subsequence with odd sum.
Subsequence is a sequence that can be derived from another sequence by deleting some elements without changing the order of the remaining elements.
You should write a program which finds sum of the best subsequence.
|
The first line contains integer number *n* (1<=≤<=*n*<=≤<=105).
The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=104<=≤<=*a**i*<=≤<=104). The sequence contains at least one subsequence with odd sum.
|
Print sum of resulting subseqeuence.
|
[
"4\n-2 2 -3 1\n",
"3\n2 -5 -3\n"
] |
[
"3\n",
"-1\n"
] |
In the first example sum of the second and the fourth elements is 3.
| 0
|
[
{
"input": "4\n-2 2 -3 1",
"output": "3"
},
{
"input": "3\n2 -5 -3",
"output": "-1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n-1",
"output": "-1"
},
{
"input": "15\n-6004 4882 9052 413 6056 4306 9946 -4616 -6135 906 -1718 5252 -2866 9061 4046",
"output": "53507"
},
{
"input": "2\n-5439 -6705",
"output": "-5439"
},
{
"input": "2\n2850 6843",
"output": "9693"
},
{
"input": "2\n144 9001",
"output": "9145"
},
{
"input": "10\n7535 -819 2389 4933 5495 4887 -5181 -9355 7955 5757",
"output": "38951"
},
{
"input": "10\n-9169 -1574 3580 -8579 -7177 -3216 7490 3470 3465 -1197",
"output": "18005"
},
{
"input": "10\n941 7724 2220 -4704 -8374 -8249 7606 9502 612 -9097",
"output": "28605"
},
{
"input": "10\n4836 -2331 -3456 2312 -1574 3134 -670 -204 512 -5504",
"output": "8463"
},
{
"input": "10\n1184 5136 1654 3254 6576 6900 6468 327 179 7114",
"output": "38613"
},
{
"input": "10\n-2152 -1776 -1810 -9046 -6090 -2324 -8716 -6103 -787 -812",
"output": "-787"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "5\n5 5 5 3 -1",
"output": "17"
},
{
"input": "5\n-1 -2 5 3 0",
"output": "7"
},
{
"input": "5\n-3 -2 5 -1 3",
"output": "7"
},
{
"input": "3\n-2 2 -1",
"output": "1"
},
{
"input": "5\n5 0 7 -2 3",
"output": "15"
},
{
"input": "2\n-2 -5",
"output": "-5"
},
{
"input": "3\n-1 -3 0",
"output": "-1"
},
{
"input": "5\n2 -1 0 -3 -2",
"output": "1"
},
{
"input": "4\n2 3 0 5",
"output": "7"
},
{
"input": "5\n-5 3 -2 2 5",
"output": "7"
},
{
"input": "59\n8593 5929 3016 -859 4366 -6842 8435 -3910 -2458 -8503 -3612 -9793 -5360 -9791 -362 -7180 727 -6245 -8869 -7316 8214 -7944 7098 3788 -5436 -6626 -1131 -2410 -5647 -7981 263 -5879 8786 709 6489 5316 -4039 4909 -4340 7979 -89 9844 -906 172 -7674 -3371 -6828 9505 3284 5895 3646 6680 -1255 3635 -9547 -5104 -1435 -7222 2244",
"output": "129433"
},
{
"input": "17\n-6170 2363 6202 -9142 7889 779 2843 -5089 2313 -3952 1843 5171 462 -3673 5098 -2519 9565",
"output": "43749"
},
{
"input": "26\n-8668 9705 1798 -1766 9644 3688 8654 -3077 -5462 2274 6739 2732 3635 -4745 -9144 -9175 -7488 -2010 1637 1118 8987 1597 -2873 -5153 -8062 146",
"output": "60757"
},
{
"input": "51\n8237 -7239 -3545 -6059 -5110 4066 -4148 -7641 -5797 -994 963 1144 -2785 -8765 -1216 5410 1508 -6312 -6313 -680 -7657 4579 -6898 7379 2015 -5087 -5417 -6092 3819 -9101 989 -8380 9161 -7519 -9314 -3838 7160 5180 567 -1606 -3842 -9665 -2266 1296 -8417 -3976 7436 -2075 -441 -4565 3313",
"output": "73781"
},
{
"input": "1\n-1",
"output": "-1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n-1",
"output": "-1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n-1",
"output": "-1"
},
{
"input": "1\n-1",
"output": "-1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n-2 1",
"output": "1"
},
{
"input": "2\n3 2",
"output": "5"
},
{
"input": "2\n1 2",
"output": "3"
},
{
"input": "2\n-1 1",
"output": "1"
},
{
"input": "2\n0 -1",
"output": "-1"
},
{
"input": "2\n2 1",
"output": "3"
},
{
"input": "2\n3 0",
"output": "3"
},
{
"input": "2\n0 -1",
"output": "-1"
},
{
"input": "3\n-3 1 -1",
"output": "1"
},
{
"input": "3\n3 -1 1",
"output": "3"
},
{
"input": "3\n1 3 1",
"output": "5"
},
{
"input": "3\n-1 0 1",
"output": "1"
},
{
"input": "3\n-3 -3 -2",
"output": "-3"
},
{
"input": "3\n3 -1 1",
"output": "3"
},
{
"input": "3\n3 -1 1",
"output": "3"
},
{
"input": "3\n-2 -2 1",
"output": "1"
},
{
"input": "4\n0 -1 -3 -4",
"output": "-1"
},
{
"input": "4\n5 3 2 1",
"output": "11"
},
{
"input": "4\n-1 -2 4 -2",
"output": "3"
},
{
"input": "4\n-1 -3 0 -3",
"output": "-1"
},
{
"input": "4\n1 -4 -3 -4",
"output": "1"
},
{
"input": "4\n5 3 3 4",
"output": "15"
},
{
"input": "4\n-1 -3 -1 2",
"output": "1"
},
{
"input": "4\n3 2 -1 -4",
"output": "5"
},
{
"input": "5\n-5 -4 -3 -5 2",
"output": "-1"
},
{
"input": "5\n5 5 1 2 -2",
"output": "13"
},
{
"input": "5\n-2 -1 -5 -1 4",
"output": "3"
},
{
"input": "5\n-5 -5 -4 4 0",
"output": "-1"
},
{
"input": "5\n2 -3 -1 -4 -5",
"output": "1"
},
{
"input": "5\n4 3 4 2 3",
"output": "13"
},
{
"input": "5\n0 -2 -5 3 3",
"output": "3"
},
{
"input": "5\n4 -2 -2 -3 0",
"output": "1"
},
{
"input": "6\n6 7 -1 1 5 -1",
"output": "19"
},
{
"input": "6\n-1 7 2 -3 -4 -5",
"output": "9"
},
{
"input": "6\n0 -1 -3 -5 2 -6",
"output": "1"
},
{
"input": "6\n4 -1 0 3 6 1",
"output": "13"
},
{
"input": "6\n5 3 3 4 4 -3",
"output": "19"
},
{
"input": "6\n0 -3 5 -4 5 -4",
"output": "7"
},
{
"input": "6\n-5 -3 1 -1 -5 -3",
"output": "1"
},
{
"input": "6\n-2 1 3 -2 7 4",
"output": "15"
},
{
"input": "7\n0 7 6 2 7 0 6",
"output": "21"
},
{
"input": "7\n6 -6 -1 -5 7 1 7",
"output": "21"
},
{
"input": "7\n2 3 -5 0 -4 0 -4",
"output": "5"
},
{
"input": "7\n-6 3 -3 -1 -6 -6 -5",
"output": "3"
},
{
"input": "7\n7 6 3 2 4 2 0",
"output": "21"
},
{
"input": "7\n-2 3 -3 4 4 0 -1",
"output": "11"
},
{
"input": "7\n-5 -7 4 0 5 -3 -5",
"output": "9"
},
{
"input": "7\n-3 -5 -4 1 3 -4 -7",
"output": "3"
},
{
"input": "8\n5 2 4 5 7 -2 7 3",
"output": "33"
},
{
"input": "8\n-8 -3 -1 3 -8 -4 -4 4",
"output": "7"
},
{
"input": "8\n-6 -7 -7 -5 -4 -9 -2 -7",
"output": "-5"
},
{
"input": "8\n8 7 6 8 3 4 8 -2",
"output": "41"
},
{
"input": "8\n6 7 0 -6 6 5 4 7",
"output": "35"
},
{
"input": "8\n0 -7 -5 -5 5 -1 -8 -7",
"output": "5"
},
{
"input": "8\n1 -6 -5 7 -3 -4 2 -2",
"output": "9"
},
{
"input": "8\n1 -8 -6 -6 -6 -7 -5 -1",
"output": "1"
},
{
"input": "9\n-3 -1 4 4 8 -8 -5 9 -2",
"output": "25"
},
{
"input": "9\n-9 -1 3 -2 -7 2 -9 -1 -4",
"output": "5"
},
{
"input": "9\n-6 -9 -3 -8 -5 2 -6 0 -5",
"output": "-1"
},
{
"input": "9\n5 4 3 3 6 7 8 5 9",
"output": "47"
},
{
"input": "9\n5 3 9 1 5 2 -3 7 0",
"output": "31"
},
{
"input": "9\n-3 -9 -1 -7 5 6 -4 -6 -6",
"output": "11"
},
{
"input": "9\n-6 -5 6 -5 -2 0 1 2 -9",
"output": "9"
},
{
"input": "9\n8 3 6 1 -3 5 2 9 1",
"output": "35"
},
{
"input": "10\n-6 -4 -7 -1 -9 -10 -10 1 0 -3",
"output": "1"
},
{
"input": "10\n-2 -10 -5 -6 -10 -3 -6 -3 -8 -8",
"output": "-3"
},
{
"input": "10\n8 5 9 2 3 3 -6 1 -1 8",
"output": "39"
},
{
"input": "10\n2 10 -7 6 -1 -1 7 -9 -4 -6",
"output": "25"
},
{
"input": "10\n-10 -2 -2 -1 -10 -7 1 0 -4 -5",
"output": "1"
},
{
"input": "10\n4 3 10 -2 -1 0 10 6 7 0",
"output": "39"
},
{
"input": "10\n-2 6 6 5 0 10 6 7 -1 1",
"output": "41"
},
{
"input": "10\n-10 2 8 -6 -1 -5 1 -10 -10 -1",
"output": "11"
}
] | 1,590,042,201
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 1
| 77
| 307,200
|
n=int(input())
a=[int(x) for x in input().split()]
a.sort()
msum=0
i=n-1
while a[i]>0:
msum=msum+a[i]
i=i-1
if (msum%2)==0:
mnsum=msum
j=i+1
while (mnsum%2)==0:
mnsum=mnsum+a[i]
i=i-1
while (msum%2)==0:
msum=msum-a[j]
j=j+1
if msum>mnsum:
print(msum)
else:
print(mnsum)
else:
print(msum)
|
Title: Odd sum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given sequence *a*1,<=*a*2,<=...,<=*a**n* of integer numbers of length *n*. Your task is to find such subsequence that its sum is odd and maximum among all such subsequences. It's guaranteed that given sequence contains subsequence with odd sum.
Subsequence is a sequence that can be derived from another sequence by deleting some elements without changing the order of the remaining elements.
You should write a program which finds sum of the best subsequence.
Input Specification:
The first line contains integer number *n* (1<=≤<=*n*<=≤<=105).
The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=104<=≤<=*a**i*<=≤<=104). The sequence contains at least one subsequence with odd sum.
Output Specification:
Print sum of resulting subseqeuence.
Demo Input:
['4\n-2 2 -3 1\n', '3\n2 -5 -3\n']
Demo Output:
['3\n', '-1\n']
Note:
In the first example sum of the second and the fourth elements is 3.
|
```python
n=int(input())
a=[int(x) for x in input().split()]
a.sort()
msum=0
i=n-1
while a[i]>0:
msum=msum+a[i]
i=i-1
if (msum%2)==0:
mnsum=msum
j=i+1
while (mnsum%2)==0:
mnsum=mnsum+a[i]
i=i-1
while (msum%2)==0:
msum=msum-a[j]
j=j+1
if msum>mnsum:
print(msum)
else:
print(mnsum)
else:
print(msum)
```
| -1
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,650,368,243
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 92
| 0
|
n = int(input())
a = list(map(int, input().split()))
answer= 1
if a[0]%2 == 0 and a[1]%2 == 0:
s = "odd"
else:
s = "even"
if s == "odd":
for i in range(n):
if a[i]%2:
answer = i+1
else:
for i in range(n):
if a[i]%2 == 0:
answer = i+1
print(answer)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n = int(input())
a = list(map(int, input().split()))
answer= 1
if a[0]%2 == 0 and a[1]%2 == 0:
s = "odd"
else:
s = "even"
if s == "odd":
for i in range(n):
if a[i]%2:
answer = i+1
else:
for i in range(n):
if a[i]%2 == 0:
answer = i+1
print(answer)
```
| 0
|
5
|
A
|
Chat Servers Outgoing Traffic
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Chat Server's Outgoing Traffic
|
1
|
64
|
Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem.
|
Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive.
|
Print a single number — answer to the problem.
|
[
"+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n",
"+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n"
] |
[
"9\n",
"14\n"
] |
none
| 0
|
[
{
"input": "+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate",
"output": "9"
},
{
"input": "+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate",
"output": "14"
},
{
"input": "+Dmitry\n+Mike\nDmitry:All letters will be used\nDmitry:qwertyuiopasdfghjklzxcvbnm QWERTYUIOPASDFGHJKLZXCVBNM\nDmitry:And digits too\nDmitry:1234567890 0987654321\n-Dmitry",
"output": "224"
},
{
"input": "+Dmitry\n+Mike\n+Kate\nDmitry:",
"output": "0"
},
{
"input": "+Dmitry\nDmitry:No phrases with spaces at the beginning and at the end\n+Mike\nDmitry:spaces spaces\n-Dmitry",
"output": "86"
},
{
"input": "+XqD\n+aT537\nXqD:x6ZPjMR1DDKG2\nXqD:lLCriywPnB\n-XqD",
"output": "46"
},
{
"input": "+8UjgAJ\n8UjgAJ:02hR7UBc1tqqfL\n-8UjgAJ\n+zdi\n-zdi",
"output": "14"
},
{
"input": "+6JPKkgXDrA\n+j6JHjv70An\n+QGtsceK0zJ\n6JPKkgXDrA:o4\n+CSmwi9zDra\nQGtsceK0zJ:Zl\nQGtsceK0zJ:0\nj6JHjv70An:7\nj6JHjv70An:B\nQGtsceK0zJ:OO",
"output": "34"
},
{
"input": "+1aLNq9S7uLV\n-1aLNq9S7uLV\n+O9ykq3xDJv\n-O9ykq3xDJv\n+54Yq1xJq14F\n+0zJ5Vo0RDZ\n-54Yq1xJq14F\n-0zJ5Vo0RDZ\n+lxlH7sdolyL\n-lxlH7sdolyL",
"output": "0"
},
{
"input": "+qlHEc2AuYy\nqlHEc2AuYy:YYRwD0 edNZgpE nGfOguRWnMYpTpGUVM aXDKGXo1Gv1tHL9\nqlHEc2AuYy:yvh3GsPcImqrvoUcBNQcP6ezwpU0 xAVltaKZp94VKiNao\nqlHEc2AuYy:zuCO6Opey L eu7lTwysaSk00zjpv zrDfbt8l hpHfu\n+pErDMxgVgh\nqlHEc2AuYy:I1FLis mmQbZtd8Ui7y 1vcax6yZBMhVRdD6Ahlq7MNCw\nqlHEc2AuYy:lz MFUNJZhlqBYckHUDlNhLiEkmecRh1o0t7alXBvCRVEFVx\npErDMxgVgh:jCyMbu1dkuEj5TzbBOjyUhpfC50cL8R900Je3R KxRgAI dT\nqlHEc2AuYy:62b47eabo2hf vSUD7KioN ZHki6WB6gh3u GKv5rgwyfF\npErDMxgVgh:zD5 9 ympl4wR gy7a7eAGAn5xVdGP9FbL6hRCZAR6O4pT6zb",
"output": "615"
},
{
"input": "+adabacaba0",
"output": "0"
},
{
"input": "+acabadab\n+caba0aba",
"output": "0"
},
{
"input": "+dabaca\n-dabaca\n+aba0ab",
"output": "0"
},
{
"input": "+cab\n+abac\n-abac\n+baca",
"output": "0"
},
{
"input": "+cabadabac\n-cabadabac\n+abacaba1ab\n-abacaba1ab\n+ba0abaca",
"output": "0"
},
{
"input": "+adabacaba\n-adabacaba\n+aca\naca:caba\n-aca\n+bacaba\n-bacaba\n+aba\n-aba\n+bad",
"output": "4"
},
{
"input": "+acabadab\n-acabadab\n+aba0abacab\n+baca\n+abacaba0ab\n-baca\n-abacaba0ab\n-aba0abacab\n+cab\n-cab\n+abacabada\n-abacabada\n+badabaca\n-badabaca\n+badaba",
"output": "0"
},
{
"input": "+badabac\nbadabac:abacabad\n-badabac\n+0ab\n-0ab\n+dabacab\n-dabacab\n+a0ab\n-a0ab\n+0abaca\n-0abaca\n+dabac\n-dabac\n+abaca\n-abaca\n+bacabada\n-bacabada\n+aca\n-aca\n+abadabaca\n-abadabaca\n+acaba\n-acaba\n+abacabadab\n-abacabadab",
"output": "8"
}
] | 1,583,388,696
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 436
| 2,252,800
|
# -*- coding: utf-8 -*-
"""
Created on Thu Mar 5 11:26:03 2020
@author: akprasad
5A. Chat Server's Outgoing Traffic
time limit per test: 1 second
memory limit per test: 64 megabytes
input: standard input
output: standard output
Polycarp is working on a new project called "Polychat".
Following modern tendencies in IT, he decided,
that this project should contain chat as well.
To achieve this goal, Polycarp has spent several hours
in front of his laptop and implemented a chat server that
can process three types of commands:
Include a person to the chat ('Add' command).
Remove a person from the chat ('Remove' command).
Send a message from a person to all people,
who are currently in the chat, including the one,
who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing
traffic that the server will produce while processing
a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add'
and 'Remove' commands. When 'Send' command is processed,
server sends l bytes to each participant of the chat,
where l is the length of the message.
As Polycarp has no time,
he is asking for your help in solving this problem.
Input
Input file will contain not more than 100 commands,
each in its own line. No line will exceed 100 characters.
Formats of the commands will be the following:
+<name> for 'Add' command.
-<name> for 'Remove' command.
<sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits.
<message_text> can contain letters, digits and spaces, but can't start or
end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e.
there will be no 'Add' command if person with such a name
is already in the chat, there will be no 'Remove' command
if there is no person with such a name in the chat etc.
All names are case-sensitive.
Output
Print a single number — answer to the problem.
Examples
input
+Mike
Mike:hello
+Kate
+Dmitry
-Dmitry
Kate:hi
-Kate
output
9
input
+Mike
-Mike
+Mike
Mike:Hi I am here
-Mike
+Kate
-Kate
output
14
"""
if __name__ == '__main__':
sentinel = '' # end when this string is seen
messages = "\n".join(iter(input, sentinel))
participants = 0
traffic = 0
for message in messages.splitlines():
if message.startswith("+"):
participants += 1
elif message.startswith("-"):
participants -= 1
else:
text = message.split(":", 1)[1]
traffic += len(text) * participants
print(traffic)
|
Title: Chat Servers Outgoing Traffic
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Polycarp is working on a new project called "Polychat". Following modern tendencies in IT, he decided, that this project should contain chat as well. To achieve this goal, Polycarp has spent several hours in front of his laptop and implemented a chat server that can process three types of commands:
- Include a person to the chat ('Add' command). - Remove a person from the chat ('Remove' command). - Send a message from a person to all people, who are currently in the chat, including the one, who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing traffic that the server will produce while processing a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add' and 'Remove' commands. When 'Send' command is processed, server sends *l* bytes to each participant of the chat, where *l* is the length of the message.
As Polycarp has no time, he is asking for your help in solving this problem.
Input Specification:
Input file will contain not more than 100 commands, each in its own line. No line will exceed 100 characters. Formats of the commands will be the following:
- +<name> for 'Add' command. - -<name> for 'Remove' command. - <sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits. <message_text> can contain letters, digits and spaces, but can't start or end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e. there will be no 'Add' command if person with such a name is already in the chat, there will be no 'Remove' command if there is no person with such a name in the chat etc.
All names are case-sensitive.
Output Specification:
Print a single number — answer to the problem.
Demo Input:
['+Mike\nMike:hello\n+Kate\n+Dmitry\n-Dmitry\nKate:hi\n-Kate\n', '+Mike\n-Mike\n+Mike\nMike:Hi I am here\n-Mike\n+Kate\n-Kate\n']
Demo Output:
['9\n', '14\n']
Note:
none
|
```python
# -*- coding: utf-8 -*-
"""
Created on Thu Mar 5 11:26:03 2020
@author: akprasad
5A. Chat Server's Outgoing Traffic
time limit per test: 1 second
memory limit per test: 64 megabytes
input: standard input
output: standard output
Polycarp is working on a new project called "Polychat".
Following modern tendencies in IT, he decided,
that this project should contain chat as well.
To achieve this goal, Polycarp has spent several hours
in front of his laptop and implemented a chat server that
can process three types of commands:
Include a person to the chat ('Add' command).
Remove a person from the chat ('Remove' command).
Send a message from a person to all people,
who are currently in the chat, including the one,
who sends the message ('Send' command).
Now Polycarp wants to find out the amount of outgoing
traffic that the server will produce while processing
a particular set of commands.
Polycarp knows that chat server sends no traffic for 'Add'
and 'Remove' commands. When 'Send' command is processed,
server sends l bytes to each participant of the chat,
where l is the length of the message.
As Polycarp has no time,
he is asking for your help in solving this problem.
Input
Input file will contain not more than 100 commands,
each in its own line. No line will exceed 100 characters.
Formats of the commands will be the following:
+<name> for 'Add' command.
-<name> for 'Remove' command.
<sender_name>:<message_text> for 'Send' command.
<name> and <sender_name> is a non-empty sequence of Latin letters and digits.
<message_text> can contain letters, digits and spaces, but can't start or
end with a space. <message_text> can be an empty line.
It is guaranteed, that input data are correct, i.e.
there will be no 'Add' command if person with such a name
is already in the chat, there will be no 'Remove' command
if there is no person with such a name in the chat etc.
All names are case-sensitive.
Output
Print a single number — answer to the problem.
Examples
input
+Mike
Mike:hello
+Kate
+Dmitry
-Dmitry
Kate:hi
-Kate
output
9
input
+Mike
-Mike
+Mike
Mike:Hi I am here
-Mike
+Kate
-Kate
output
14
"""
if __name__ == '__main__':
sentinel = '' # end when this string is seen
messages = "\n".join(iter(input, sentinel))
participants = 0
traffic = 0
for message in messages.splitlines():
if message.startswith("+"):
participants += 1
elif message.startswith("-"):
participants -= 1
else:
text = message.split(":", 1)[1]
traffic += len(text) * participants
print(traffic)
```
| -1
|
80
|
A
|
Panoramix's Prediction
|
PROGRAMMING
| 800
|
[
"brute force"
] |
A. Panoramix's Prediction
|
2
|
256
|
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
|
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
|
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
|
[
"3 5\n",
"7 11\n",
"7 9\n"
] |
[
"YES",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,644,427,247
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 218
| 2,048,000
|
n, z = map(int, input().split())
sp=[]
for s in (n+1, z+1):
k=0
for i in range(2, int(s**0.5)+1):
if s%i==0:
k+=1
if k==0:
sp.append(s)
if len(sp)==1 and sp[0]==z:
print('YES')
if len(sp)!=1 and sp[-1]==z:
print('NO')
if len(sp)==0:
print('NO')
|
Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none
|
```python
n, z = map(int, input().split())
sp=[]
for s in (n+1, z+1):
k=0
for i in range(2, int(s**0.5)+1):
if s%i==0:
k+=1
if k==0:
sp.append(s)
if len(sp)==1 and sp[0]==z:
print('YES')
if len(sp)!=1 and sp[-1]==z:
print('NO')
if len(sp)==0:
print('NO')
```
| -1
|
19
|
D
|
Points
|
PROGRAMMING
| 2,800
|
[
"data structures"
] |
D. Points
|
2
|
256
|
Pete and Bob invented a new interesting game. Bob takes a sheet of paper and locates a Cartesian coordinate system on it as follows: point (0,<=0) is located in the bottom-left corner, *Ox* axis is directed right, *Oy* axis is directed up. Pete gives Bob requests of three types:
- add x y — on the sheet of paper Bob marks a point with coordinates (*x*,<=*y*). For each request of this type it's guaranteed that point (*x*,<=*y*) is not yet marked on Bob's sheet at the time of the request. - remove x y — on the sheet of paper Bob erases the previously marked point with coordinates (*x*,<=*y*). For each request of this type it's guaranteed that point (*x*,<=*y*) is already marked on Bob's sheet at the time of the request. - find x y — on the sheet of paper Bob finds all the marked points, lying strictly above and strictly to the right of point (*x*,<=*y*). Among these points Bob chooses the leftmost one, if it is not unique, he chooses the bottommost one, and gives its coordinates to Pete.
Bob managed to answer the requests, when they were 10, 100 or 1000, but when their amount grew up to 2·105, Bob failed to cope. Now he needs a program that will answer all Pete's requests. Help Bob, please!
|
The first input line contains number *n* (1<=≤<=*n*<=≤<=2·105) — amount of requests. Then there follow *n* lines — descriptions of the requests. add x y describes the request to add a point, remove x y — the request to erase a point, find x y — the request to find the bottom-left point. All the coordinates in the input file are non-negative and don't exceed 109.
|
For each request of type find x y output in a separate line the answer to it — coordinates of the bottommost among the leftmost marked points, lying strictly above and to the right of point (*x*,<=*y*). If there are no points strictly above and to the right of point (*x*,<=*y*), output -1.
|
[
"7\nadd 1 1\nadd 3 4\nfind 0 0\nremove 1 1\nfind 0 0\nadd 1 1\nfind 0 0\n",
"13\nadd 5 5\nadd 5 6\nadd 5 7\nadd 6 5\nadd 6 6\nadd 6 7\nadd 7 5\nadd 7 6\nadd 7 7\nfind 6 6\nremove 7 7\nfind 6 6\nfind 4 4\n"
] |
[
"1 1\n3 4\n1 1\n",
"7 7\n-1\n5 5\n"
] |
none
| 0
|
[] | 1,669,653,503
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 11
| 2,000
| 4,505,600
|
from bisect import insort_left as il, bisect_left as bl
M,d=10**9+2,[1,100,3000]
N=len(d)
k=M//d[-1]+1
for i in range(N):
d[i]=[d[i],k*d[-1]//d[i],[[[(0,0),(M,M)],[0,M],(0,0)] for _ in range(d[i])],set()]
def v():
for i in range(N-1,0,-1):
for k in d[i][3]:
l=d[i][2][k]
x,y=l[0][-2][0],l[1][-2]
p(x,y,l[2][0],l[2][1],i-1)
l[2]=(x,y)
d[i][3]=set()
def p(x,y,x1=0,y1=0,n=N-1):
k=max(x,x1)//d[n][1]
l=d[n][2][k]
if x1 and y1:
del l[0][bl(l[0],(x1,y1))]
del l[1][bl(l[1],y1)]
if x and y:
il(l[0],(x,y))
il(l[1],y)
if n !=0:
if l[2] != (l[0][-2][0],l[1][-2]):
d[n][3].add(k)
elif k in d[n][3]:
d[n][3].remove(k)
def f(x,y,x1=0,n=0):
t,k=x1//d[n][1],(M,M)
l=d[n][2][t]
if l[0][-2][0]>=x and l[1][-2]>=y:
for k in l[0][bl(l[0],(x,y)):]:
if k[1]>=y:
break
if k==(M,M):
if n !=0: k=f((t+1)*d[n][1],y)
else:
if n !=N-1: k=f(x,y,k[0],n+1)
return k
for i in range(int(input())):
s=input().split()
s=(s[0][0],int(s[1]),int(s[2]))
if s[0]=='f':
v()
k=f(s[1]+1,s[2]+1,s[1]+1,N-1)
if k==(M,M):
print(-1)
else:
print(*k)
elif s[0]=='a':
p(s[1],s[2])
else:
p(0,0,s[1],s[2])
|
Title: Points
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Pete and Bob invented a new interesting game. Bob takes a sheet of paper and locates a Cartesian coordinate system on it as follows: point (0,<=0) is located in the bottom-left corner, *Ox* axis is directed right, *Oy* axis is directed up. Pete gives Bob requests of three types:
- add x y — on the sheet of paper Bob marks a point with coordinates (*x*,<=*y*). For each request of this type it's guaranteed that point (*x*,<=*y*) is not yet marked on Bob's sheet at the time of the request. - remove x y — on the sheet of paper Bob erases the previously marked point with coordinates (*x*,<=*y*). For each request of this type it's guaranteed that point (*x*,<=*y*) is already marked on Bob's sheet at the time of the request. - find x y — on the sheet of paper Bob finds all the marked points, lying strictly above and strictly to the right of point (*x*,<=*y*). Among these points Bob chooses the leftmost one, if it is not unique, he chooses the bottommost one, and gives its coordinates to Pete.
Bob managed to answer the requests, when they were 10, 100 or 1000, but when their amount grew up to 2·105, Bob failed to cope. Now he needs a program that will answer all Pete's requests. Help Bob, please!
Input Specification:
The first input line contains number *n* (1<=≤<=*n*<=≤<=2·105) — amount of requests. Then there follow *n* lines — descriptions of the requests. add x y describes the request to add a point, remove x y — the request to erase a point, find x y — the request to find the bottom-left point. All the coordinates in the input file are non-negative and don't exceed 109.
Output Specification:
For each request of type find x y output in a separate line the answer to it — coordinates of the bottommost among the leftmost marked points, lying strictly above and to the right of point (*x*,<=*y*). If there are no points strictly above and to the right of point (*x*,<=*y*), output -1.
Demo Input:
['7\nadd 1 1\nadd 3 4\nfind 0 0\nremove 1 1\nfind 0 0\nadd 1 1\nfind 0 0\n', '13\nadd 5 5\nadd 5 6\nadd 5 7\nadd 6 5\nadd 6 6\nadd 6 7\nadd 7 5\nadd 7 6\nadd 7 7\nfind 6 6\nremove 7 7\nfind 6 6\nfind 4 4\n']
Demo Output:
['1 1\n3 4\n1 1\n', '7 7\n-1\n5 5\n']
Note:
none
|
```python
from bisect import insort_left as il, bisect_left as bl
M,d=10**9+2,[1,100,3000]
N=len(d)
k=M//d[-1]+1
for i in range(N):
d[i]=[d[i],k*d[-1]//d[i],[[[(0,0),(M,M)],[0,M],(0,0)] for _ in range(d[i])],set()]
def v():
for i in range(N-1,0,-1):
for k in d[i][3]:
l=d[i][2][k]
x,y=l[0][-2][0],l[1][-2]
p(x,y,l[2][0],l[2][1],i-1)
l[2]=(x,y)
d[i][3]=set()
def p(x,y,x1=0,y1=0,n=N-1):
k=max(x,x1)//d[n][1]
l=d[n][2][k]
if x1 and y1:
del l[0][bl(l[0],(x1,y1))]
del l[1][bl(l[1],y1)]
if x and y:
il(l[0],(x,y))
il(l[1],y)
if n !=0:
if l[2] != (l[0][-2][0],l[1][-2]):
d[n][3].add(k)
elif k in d[n][3]:
d[n][3].remove(k)
def f(x,y,x1=0,n=0):
t,k=x1//d[n][1],(M,M)
l=d[n][2][t]
if l[0][-2][0]>=x and l[1][-2]>=y:
for k in l[0][bl(l[0],(x,y)):]:
if k[1]>=y:
break
if k==(M,M):
if n !=0: k=f((t+1)*d[n][1],y)
else:
if n !=N-1: k=f(x,y,k[0],n+1)
return k
for i in range(int(input())):
s=input().split()
s=(s[0][0],int(s[1]),int(s[2]))
if s[0]=='f':
v()
k=f(s[1]+1,s[2]+1,s[1]+1,N-1)
if k==(M,M):
print(-1)
else:
print(*k)
elif s[0]=='a':
p(s[1],s[2])
else:
p(0,0,s[1],s[2])
```
| 0
|
224
|
A
|
Parallelepiped
|
PROGRAMMING
| 1,100
|
[
"brute force",
"geometry",
"math"
] | null | null |
You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped.
|
The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=><=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement.
|
Print a single number — the sum of all edges of the parallelepiped.
|
[
"1 1 1\n",
"4 6 6\n"
] |
[
"12\n",
"28\n"
] |
In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
| 500
|
[
{
"input": "1 1 1",
"output": "12"
},
{
"input": "4 6 6",
"output": "28"
},
{
"input": "20 10 50",
"output": "68"
},
{
"input": "9 4 36",
"output": "56"
},
{
"input": "324 9 36",
"output": "184"
},
{
"input": "1333 93 129",
"output": "308"
},
{
"input": "1022 584 112",
"output": "380"
},
{
"input": "66 174 319",
"output": "184"
},
{
"input": "912 276 1748",
"output": "444"
},
{
"input": "65 156 60",
"output": "120"
},
{
"input": "1 10000 10000",
"output": "40008"
},
{
"input": "1485 55 27",
"output": "332"
},
{
"input": "152 108 4104",
"output": "528"
},
{
"input": "1656 6900 1350",
"output": "740"
},
{
"input": "12 14 42",
"output": "60"
},
{
"input": "615 18 1230",
"output": "856"
},
{
"input": "680 60 408",
"output": "336"
},
{
"input": "644 966 6",
"output": "1308"
},
{
"input": "1 432 432",
"output": "1736"
},
{
"input": "2239 2239 1",
"output": "8964"
},
{
"input": "4106 8212 2",
"output": "16436"
},
{
"input": "10000 10000 10000",
"output": "1200"
},
{
"input": "3623 3623 1",
"output": "14500"
},
{
"input": "9801 9801 9801",
"output": "1188"
},
{
"input": "10000 1 10000",
"output": "40008"
},
{
"input": "9 9 9",
"output": "36"
},
{
"input": "9801 9702 9702",
"output": "1184"
}
] | 1,696,337,739
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 27
| 122
| 0
|
from math import sqrt as s
a,b,c = map(int,input().split())
s1 = s((a*c)/b)
s2 = s((a*b)/c)
s3 = s((b*c)/a)
print(int(4*(s1+s2+s3)))
|
Title: Parallelepiped
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped.
Input Specification:
The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=><=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement.
Output Specification:
Print a single number — the sum of all edges of the parallelepiped.
Demo Input:
['1 1 1\n', '4 6 6\n']
Demo Output:
['12\n', '28\n']
Note:
In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
|
```python
from math import sqrt as s
a,b,c = map(int,input().split())
s1 = s((a*c)/b)
s2 = s((a*b)/c)
s3 = s((b*c)/a)
print(int(4*(s1+s2+s3)))
```
| 3
|
|
812
|
B
|
Sagheer, the Hausmeister
|
PROGRAMMING
| 1,600
|
[
"bitmasks",
"brute force",
"dp"
] | null | null |
Some people leave the lights at their workplaces on when they leave that is a waste of resources. As a hausmeister of DHBW, Sagheer waits till all students and professors leave the university building, then goes and turns all the lights off.
The building consists of *n* floors with stairs at the left and the right sides. Each floor has *m* rooms on the same line with a corridor that connects the left and right stairs passing by all the rooms. In other words, the building can be represented as a rectangle with *n* rows and *m*<=+<=2 columns, where the first and the last columns represent the stairs, and the *m* columns in the middle represent rooms.
Sagheer is standing at the ground floor at the left stairs. He wants to turn all the lights off in such a way that he will not go upstairs until all lights in the floor he is standing at are off. Of course, Sagheer must visit a room to turn the light there off. It takes one minute for Sagheer to go to the next floor using stairs or to move from the current room/stairs to a neighboring room/stairs on the same floor. It takes no time for him to switch the light off in the room he is currently standing in. Help Sagheer find the minimum total time to turn off all the lights.
Note that Sagheer does not have to go back to his starting position, and he does not have to visit rooms where the light is already switched off.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=15 and 1<=≤<=*m*<=≤<=100) — the number of floors and the number of rooms in each floor, respectively.
The next *n* lines contains the building description. Each line contains a binary string of length *m*<=+<=2 representing a floor (the left stairs, then *m* rooms, then the right stairs) where 0 indicates that the light is off and 1 indicates that the light is on. The floors are listed from top to bottom, so that the last line represents the ground floor.
The first and last characters of each string represent the left and the right stairs, respectively, so they are always 0.
|
Print a single integer — the minimum total time needed to turn off all the lights.
|
[
"2 2\n0010\n0100\n",
"3 4\n001000\n000010\n000010\n",
"4 3\n01110\n01110\n01110\n01110\n"
] |
[
"5\n",
"12\n",
"18\n"
] |
In the first example, Sagheer will go to room 1 in the ground floor, then he will go to room 2 in the second floor using the left or right stairs.
In the second example, he will go to the fourth room in the ground floor, use right stairs, go to the fourth room in the second floor, use right stairs again, then go to the second room in the last floor.
In the third example, he will walk through the whole corridor alternating between the left and right stairs at each floor.
| 1,000
|
[
{
"input": "2 2\n0010\n0100",
"output": "5"
},
{
"input": "3 4\n001000\n000010\n000010",
"output": "12"
},
{
"input": "4 3\n01110\n01110\n01110\n01110",
"output": "18"
},
{
"input": "3 2\n0000\n0100\n0100",
"output": "4"
},
{
"input": "1 89\n0000000000000000000000000000000100000000000000010000000000010000000000000000000000000000000",
"output": "59"
},
{
"input": "2 73\n000000000000000000000000000000000000000000000000000000000000000000000000000\n000000000000000000000000000000000000000100000010000000000000000000000000000",
"output": "46"
},
{
"input": "3 61\n000000000000000000000000000000000000000000000000000000000000000\n000000000000000000000000000000000000000000000000000000000000000\n000000000000000000000000000000000000000000000000000000000000000",
"output": "0"
},
{
"input": "4 53\n0000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000",
"output": "0"
},
{
"input": "5 93\n00000000000000000000000000000000000000000000000000000000100000000000000000000000000000000001010\n00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n00000010000000000000000000000000000000000000000000000000000000000000000000000000000000000000000\n00000000000000000000000000000010000000000000000000100000000000000000000000000000000000000000000\n00000000000000000000000000001000000000000000000000000000000000000000000000000000000000000000000",
"output": "265"
},
{
"input": "6 77\n0000000000000000100000000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000010000000000000\n0000000000010000000000000000000000000000000000000000000000000000000000000000010\n0000000000000000000001000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000100000000000000000000000000000",
"output": "311"
},
{
"input": "7 65\n0000000001000000000000000010000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000\n0000000001000001000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000\n0000000000000000000000000000000000000000000000000000000000000000000",
"output": "62"
},
{
"input": "8 57\n00000000100000000000000000000000000000000000000000000000000\n00000000000000010000000000000000000000000000000000000000000\n00000000000000000000000000000000000100000000000000000000000\n00000000000000000000000000000000000000000000000000000000000\n00000000000000000000000000000000000100000000000000000000000\n00000000000000000000000000000000000000000000000000000000000\n00000000000010000000000000000000000000000000000000000000000\n00000000000000000000000000000000000000000000000001000000000",
"output": "277"
},
{
"input": "12 13\n000000000000000\n000000000000000\n000000000000000\n000000000000000\n000000000000000\n000000000000000\n010000000000000\n000000000000000\n000000000000000\n000000000000000\n000010000000000\n000000000000000",
"output": "14"
},
{
"input": "13 1\n000\n000\n000\n000\n000\n000\n000\n000\n000\n000\n000\n000\n000",
"output": "0"
},
{
"input": "1 33\n00000100101110001101000000110100010",
"output": "33"
},
{
"input": "2 21\n00100110100010010010010\n01000001111001010000000",
"output": "43"
},
{
"input": "3 5\n0001010\n0100000\n0100000",
"output": "11"
},
{
"input": "4 45\n00010000101101100000101101000000100000001101100\n01110000100111010011000000100000000001000001100\n00000000001000100110100001000010011010001010010\n01111110100100000101101010011000100100001000000",
"output": "184"
},
{
"input": "5 37\n010100000000000000000110000110010000010\n001101100010110011101000001010101101110\n010000001000100010010100000000001010000\n000000000100101000000101100001000001110\n000010000000000000100001001000011100110",
"output": "193"
},
{
"input": "6 25\n011001000100111010000101000\n000000000010000010001000010\n011001100001100001001001010\n000000100000010000000000110\n010001100001000001000000010\n011000001001010111110000100",
"output": "160"
},
{
"input": "7 61\n010000111100010100001000011010100001000000000011100000100010000\n000010011000001000000100110101010001000000010001100000100100100\n000010001000001000000100001000000100100011001110000111000000100\n000000000101000011010000011000000101000001011001000011101010010\n000010010011000000100000110000001000000101000000101000010000010\n000010010101101100100100100011001011101010000101000010000101010\n000100001100001001000000001000000001011000110010100000000010110",
"output": "436"
},
{
"input": "8 49\n000100100000000111110010011100110100010010000011000\n001000000101111000000001111100010010100000010000000\n000000010000011100001000000000101000110010000100100\n000000000001000110000011101101000000100000101010000\n000000110001000101101000000001000000110001000110000\n000100000000000000100100010011000001111101010100110\n000000001000000010101111000100001100000000010111000\n001000010000110000011100000000100110000010001000000",
"output": "404"
},
{
"input": "9 41\n0011000000000101001101001000000001110000010\n0000110000001010110010110010110010010001000\n0001100010100000000001110100100001101000100\n0001010101111010000000010010001001011111000\n0101000101000011101011000000001100110010000\n0001010000000000000001011000000100010101000\n0000010011000000001000110001000010110001000\n0000100010000110100001000000100010001111100\n0000001110100001000001000110001110000100000",
"output": "385"
},
{
"input": "10 29\n0000000000101001100001001011000\n0001110100000000000000100010000\n0010001001000011000100010001000\n0001000010101000000010100010100\n0111000000000000100100100010100\n0001000100011111000100010100000\n0000000000000001000001001011000\n0000101110000001010001011001110\n0000001000101010011000001100100\n0100010000101011010000000000000",
"output": "299"
},
{
"input": "1 57\n00011101100001110001111000000100101111000111101100111001000",
"output": "55"
},
{
"input": "2 32\n0011110111011011011101111101011110\n0111000110111111011110011101011110",
"output": "65"
},
{
"input": "3 20\n0110011111110101101100\n0111110000111010100100\n0110111110010100011110",
"output": "63"
},
{
"input": "4 4\n011100\n001010\n010000\n011110",
"output": "22"
},
{
"input": "5 44\n0001010010001111111001111111000010100100000010\n0001111001111001101111011111010110001001111110\n0111111010111111011101100011101010100101110110\n0011010011101011101111001001010110000111111100\n0110100111011100110101110010010011011101100100",
"output": "228"
},
{
"input": "6 36\n01110101111111110101011000011111110010\n00011101100010110111111111110001100100\n00001111110010111111101110101110111110\n00110110011100100111011110000000000010\n01100101101001010001011111100111101100\n00011111111011001000011001011110011110",
"output": "226"
},
{
"input": "7 24\n01111001111001011010010100\n00111011010101000111101000\n01001110110010010110011110\n00000101111011011111111000\n01111111101111001001010010\n01110000111101011111111010\n00000100011100110000110000",
"output": "179"
},
{
"input": "8 8\n0011101110\n0110010100\n0100111110\n0111111100\n0011010100\n0001101110\n0111100000\n0110111000",
"output": "77"
},
{
"input": "9 48\n00011010111110111011111001111111111101001111110010\n01000101000101101101111110111101011100001011010010\n00110111110110101110101110111111011011101111011000\n00110111111100010110110110111001001111011010101110\n01111111100101010011111100100111110011001101110100\n01111011110011111101010101010100001110111111111000\n01110101101101110001000010110100010110101111111100\n00111101001010110010110100000111110101010100001000\n00011011010110011111001100111100100011100110110100",
"output": "448"
},
{
"input": "10 40\n010011001001111011011011101111010001010010\n011000000110000010001011111010100000110000\n011010101001110010110110011111010101101000\n000111111010101111000110011111011011011010\n010110101110001001001111111000110011101010\n010011010100111110010100100111100111011110\n001111101100111111111111001010111010000110\n001111110010101100110100101110001011100110\n010111010010001111110101111111111110111000\n011101101111000100111111111001111100111010",
"output": "418"
},
{
"input": "11 28\n011100111101101001011111001110\n010001111110011101101011001000\n001010011011011010101101101100\n001100011001101011011001110100\n010111110011101110000110111100\n010010001111110000011111010100\n001011111111110011101101111010\n001101101011100100011011001110\n001111110110100110101011000010\n000101101011100001101101100100\n010011101101111011100111110100",
"output": "328"
},
{
"input": "1 68\n0101111110111111111111111111110111111111111111111110111111101111111110",
"output": "68"
},
{
"input": "2 56\n0011111111111110111111111111111111011111111111011111011110\n0111111111010111111111110111111111111110111111010111111110",
"output": "113"
},
{
"input": "3 17\n0111111101111111110\n0111111111101011110\n0101111111111111110",
"output": "55"
},
{
"input": "4 4\n011110\n010110\n010110\n011110",
"output": "22"
},
{
"input": "5 89\n0011111111111101110110111111111101111011111011101110111111111111111111111111111111111111110\n0111111111111111111111111101111111111111111111111111111111111111111111111111111111111111110\n0111111111111011111111111111111111101111011111111111111111110110111101111111111111111011010\n0111111111111111011011111111111011111111111111111111111111111111111111111111111110111111010\n0111111101111011111110101011111111110111100100101111111011111111111111011011101111111111110",
"output": "453"
},
{
"input": "6 77\n0111111110101011111111111111111111111111111111111111100111111111101111111111110\n0111111111111111111101111101111111111011111111011111111001011111111111101111110\n0111101111111111111111111111111111111110110011111111111011111111101111111111110\n0111110111111111111111111111111111111111111111111111011011111111111111111111110\n0101111110111111111111111111111111111111111011111111111111111111101111011011110\n0110111111101111110111111111111011111111101011111101111111111111111111110111100",
"output": "472"
},
{
"input": "7 20\n0111111111111111111100\n0111110111111111111110\n0111111111111111111100\n0111111011111111111110\n0111111111111011101110\n0111101011110111111010\n0111111111111111111010",
"output": "151"
},
{
"input": "8 8\n0111111110\n0111101110\n0111111110\n0111111110\n0111111110\n0110111100\n0101111110\n0110111110",
"output": "78"
},
{
"input": "11 24\n01111111111101111111111110\n01111111111111111111111110\n01110111111111111111111110\n01111111111111111111011110\n01111111111111111110111110\n01111010111111100111101110\n01111111111111010101111100\n01111111111111110111111110\n01011101111111111101111110\n00111111011111111110111110\n01111111101111111101111110",
"output": "284"
},
{
"input": "12 12\n01111111111000\n01101111110110\n01111110111110\n01111111111110\n01111111111010\n01011111110110\n01111111111110\n01101101011110\n01111111111110\n01111101011110\n00111111111110\n01111111011110",
"output": "166"
},
{
"input": "15 28\n011111111101011111111101111110\n011111111111111111111111111110\n011101110111011011101111011110\n011111111011111011110111111110\n011111111110101111111111111110\n011111011111110011111111011010\n011110111111001101111111111110\n011111111110111111111011111110\n011111111111111111111111011110\n011111011111111111111011001010\n011111111101111111111101111110\n011111111110111111101111011110\n010111111111101111111111111110\n011111111111111111011111111110\n011011111111111110110111110110",
"output": "448"
},
{
"input": "2 11\n0100000000000\n0000000010000",
"output": "18"
},
{
"input": "1 100\n010010010011100001101101110111101010000101010001111001001101011110000011101110101000100111111001101110",
"output": "100"
},
{
"input": "15 1\n010\n010\n010\n010\n010\n010\n000\n000\n000\n010\n000\n010\n000\n000\n000",
"output": "29"
},
{
"input": "3 3\n00010\n00000\n00010",
"output": "7"
}
] | 1,681,835,142
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n, m = map(int, input().split())
p = [input() for y in range(n)][::-1]
l = r = d = 0
i = j = -1
for y, t in enumerate(p):
if '1' in t:
if i == -1 and j == -1:
i, j = t.find('1'), t.rfind('1')
l, r = i, j
else:
prev_i, prev_j = i, j
i, j = t.find('1'), t.rfind('1')
l = max(l - (j - prev_j), i) + m + 1
r = min(r + (i - prev_i), j) + m + 1
d = y
print(min(l, r) + d)
|
Title: Sagheer, the Hausmeister
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some people leave the lights at their workplaces on when they leave that is a waste of resources. As a hausmeister of DHBW, Sagheer waits till all students and professors leave the university building, then goes and turns all the lights off.
The building consists of *n* floors with stairs at the left and the right sides. Each floor has *m* rooms on the same line with a corridor that connects the left and right stairs passing by all the rooms. In other words, the building can be represented as a rectangle with *n* rows and *m*<=+<=2 columns, where the first and the last columns represent the stairs, and the *m* columns in the middle represent rooms.
Sagheer is standing at the ground floor at the left stairs. He wants to turn all the lights off in such a way that he will not go upstairs until all lights in the floor he is standing at are off. Of course, Sagheer must visit a room to turn the light there off. It takes one minute for Sagheer to go to the next floor using stairs or to move from the current room/stairs to a neighboring room/stairs on the same floor. It takes no time for him to switch the light off in the room he is currently standing in. Help Sagheer find the minimum total time to turn off all the lights.
Note that Sagheer does not have to go back to his starting position, and he does not have to visit rooms where the light is already switched off.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=15 and 1<=≤<=*m*<=≤<=100) — the number of floors and the number of rooms in each floor, respectively.
The next *n* lines contains the building description. Each line contains a binary string of length *m*<=+<=2 representing a floor (the left stairs, then *m* rooms, then the right stairs) where 0 indicates that the light is off and 1 indicates that the light is on. The floors are listed from top to bottom, so that the last line represents the ground floor.
The first and last characters of each string represent the left and the right stairs, respectively, so they are always 0.
Output Specification:
Print a single integer — the minimum total time needed to turn off all the lights.
Demo Input:
['2 2\n0010\n0100\n', '3 4\n001000\n000010\n000010\n', '4 3\n01110\n01110\n01110\n01110\n']
Demo Output:
['5\n', '12\n', '18\n']
Note:
In the first example, Sagheer will go to room 1 in the ground floor, then he will go to room 2 in the second floor using the left or right stairs.
In the second example, he will go to the fourth room in the ground floor, use right stairs, go to the fourth room in the second floor, use right stairs again, then go to the second room in the last floor.
In the third example, he will walk through the whole corridor alternating between the left and right stairs at each floor.
|
```python
n, m = map(int, input().split())
p = [input() for y in range(n)][::-1]
l = r = d = 0
i = j = -1
for y, t in enumerate(p):
if '1' in t:
if i == -1 and j == -1:
i, j = t.find('1'), t.rfind('1')
l, r = i, j
else:
prev_i, prev_j = i, j
i, j = t.find('1'), t.rfind('1')
l = max(l - (j - prev_j), i) + m + 1
r = min(r + (i - prev_i), j) + m + 1
d = y
print(min(l, r) + d)
```
| 0
|
|
955
|
B
|
Not simply beatiful strings
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Let's call a string adorable if its letters can be realigned in such a way that they form two consequent groups of equal symbols (note that different groups must contain different symbols). For example, ababa is adorable (you can transform it to aaabb, where the first three letters form a group of *a*-s and others — a group of *b*-s), but cccc is not since in each possible consequent partition letters in these two groups coincide.
You're given a string *s*. Check whether it can be split into two non-empty subsequences such that the strings formed by these subsequences are adorable. Here a subsequence is an arbitrary set of indexes of the string.
|
The only line contains *s* (1<=≤<=|*s*|<=≤<=105) consisting of lowercase latin letters.
|
Print «Yes» if the string can be split according to the criteria above or «No» otherwise.
Each letter can be printed in arbitrary case.
|
[
"ababa\n",
"zzcxx\n",
"yeee\n"
] |
[
"Yes\n",
"Yes\n",
"No\n"
] |
In sample case two zzcxx can be split into subsequences zc and zxx each of which is adorable.
There's no suitable partition in sample case three.
| 1,000
|
[
{
"input": "ababa",
"output": "Yes"
},
{
"input": "zzcxx",
"output": "Yes"
},
{
"input": "yeee",
"output": "No"
},
{
"input": "a",
"output": "No"
},
{
"input": "bbab",
"output": "No"
},
{
"input": "abcd",
"output": "Yes"
},
{
"input": "abc",
"output": "No"
},
{
"input": "abcdaaaa",
"output": "Yes"
},
{
"input": "aaaaaaaaaaaaaaa",
"output": "No"
},
{
"input": "adb",
"output": "No"
},
{
"input": "dcccbad",
"output": "Yes"
},
{
"input": "bcbccccccca",
"output": "Yes"
},
{
"input": "abcdefgh",
"output": "No"
},
{
"input": "aabcdef",
"output": "No"
},
{
"input": "aabc",
"output": "Yes"
},
{
"input": "ssab",
"output": "Yes"
},
{
"input": "ccdd",
"output": "Yes"
},
{
"input": "abcc",
"output": "Yes"
},
{
"input": "ab",
"output": "No"
},
{
"input": "abcde",
"output": "No"
},
{
"input": "aa",
"output": "No"
},
{
"input": "aaabbb",
"output": "Yes"
},
{
"input": "bbbba",
"output": "No"
},
{
"input": "abbbc",
"output": "Yes"
},
{
"input": "baabaa",
"output": "Yes"
},
{
"input": "abacabadde",
"output": "No"
},
{
"input": "aabbcc",
"output": "Yes"
},
{
"input": "abbc",
"output": "Yes"
},
{
"input": "aaaaaaabbbbbbcder",
"output": "No"
},
{
"input": "aabb",
"output": "Yes"
},
{
"input": "aabbccddee",
"output": "No"
},
{
"input": "abca",
"output": "Yes"
},
{
"input": "aaabbbccc",
"output": "Yes"
}
] | 1,521,824,589
| 1,689
|
Python 3
|
OK
|
TESTS
| 56
| 109
| 7,270,400
|
T = input()
D = {}
for i in T:
if i in D:
D[i]+=1
else:
D[i]=1
R = []
for i in D:
R.append(D[i])
if len(R) == 4:
print('YES')
elif len(R) == 3:
if max(R)>=2:
print('YES')
else:
print('NO')
elif len(R) == 2:
if min(R)>=2:
print('YES')
else:
print('NO')
else:
print('NO')
|
Title: Not simply beatiful strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's call a string adorable if its letters can be realigned in such a way that they form two consequent groups of equal symbols (note that different groups must contain different symbols). For example, ababa is adorable (you can transform it to aaabb, where the first three letters form a group of *a*-s and others — a group of *b*-s), but cccc is not since in each possible consequent partition letters in these two groups coincide.
You're given a string *s*. Check whether it can be split into two non-empty subsequences such that the strings formed by these subsequences are adorable. Here a subsequence is an arbitrary set of indexes of the string.
Input Specification:
The only line contains *s* (1<=≤<=|*s*|<=≤<=105) consisting of lowercase latin letters.
Output Specification:
Print «Yes» if the string can be split according to the criteria above or «No» otherwise.
Each letter can be printed in arbitrary case.
Demo Input:
['ababa\n', 'zzcxx\n', 'yeee\n']
Demo Output:
['Yes\n', 'Yes\n', 'No\n']
Note:
In sample case two zzcxx can be split into subsequences zc and zxx each of which is adorable.
There's no suitable partition in sample case three.
|
```python
T = input()
D = {}
for i in T:
if i in D:
D[i]+=1
else:
D[i]=1
R = []
for i in D:
R.append(D[i])
if len(R) == 4:
print('YES')
elif len(R) == 3:
if max(R)>=2:
print('YES')
else:
print('NO')
elif len(R) == 2:
if min(R)>=2:
print('YES')
else:
print('NO')
else:
print('NO')
```
| 3
|
|
2
|
A
|
Winner
|
PROGRAMMING
| 1,500
|
[
"hashing",
"implementation"
] |
A. Winner
|
1
|
64
|
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
|
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
|
Print the name of the winner.
|
[
"3\nmike 3\nandrew 5\nmike 2\n",
"3\nandrew 3\nandrew 2\nmike 5\n"
] |
[
"andrew\n",
"andrew\n"
] |
none
| 0
|
[
{
"input": "3\nmike 3\nandrew 5\nmike 2",
"output": "andrew"
},
{
"input": "3\nandrew 3\nandrew 2\nmike 5",
"output": "andrew"
},
{
"input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303",
"output": "kaxqybeultn"
},
{
"input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734",
"output": "ksjuuerbnlklcfdjeyq"
},
{
"input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879",
"output": "fcgslzkicjrpbqaifgweyzreajjfdo"
},
{
"input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735",
"output": "aawtvezfntstrcpgbzjbf"
},
{
"input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158",
"output": "ivhgbxiv"
}
] | 1,672,240,319
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 154
| 2,048,000
|
used={}
b=[]
mx=-1000000000000000000000000000000000000000000000
for i in range(int(input())):
s,n=input().split()
n=int(n)
if s in used:
used[s]+=n
else:
used[s]=n
b.append([s,used[s]])
for i in used:
if used[i]>mx:
mx=used[i]
for i,j in b:
if used[i]==mx and j>=mx:
print(i)
break
'''used=[]
for i in range(int(input())):
s,n=input().split()
if i==0:
used.append((s,n))
for i in used:
if s in i:
i[1]+=n
print(i)
'''
|
Title: Winner
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
Input Specification:
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Output Specification:
Print the name of the winner.
Demo Input:
['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n']
Demo Output:
['andrew\n', 'andrew\n']
Note:
none
|
```python
used={}
b=[]
mx=-1000000000000000000000000000000000000000000000
for i in range(int(input())):
s,n=input().split()
n=int(n)
if s in used:
used[s]+=n
else:
used[s]=n
b.append([s,used[s]])
for i in used:
if used[i]>mx:
mx=used[i]
for i,j in b:
if used[i]==mx and j>=mx:
print(i)
break
'''used=[]
for i in range(int(input())):
s,n=input().split()
if i==0:
used.append((s,n))
for i in used:
if s in i:
i[1]+=n
print(i)
'''
```
| 3.907741
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.