contestId
int64
0
1.01k
index
stringclasses
57 values
name
stringlengths
2
58
type
stringclasses
2 values
rating
int64
0
3.5k
tags
listlengths
0
11
title
stringclasses
522 values
time-limit
stringclasses
8 values
memory-limit
stringclasses
8 values
problem-description
stringlengths
0
7.15k
input-specification
stringlengths
0
2.05k
output-specification
stringlengths
0
1.5k
demo-input
listlengths
0
7
demo-output
listlengths
0
7
note
stringlengths
0
5.24k
points
float64
0
425k
test_cases
listlengths
0
402
creationTimeSeconds
int64
1.37B
1.7B
relativeTimeSeconds
int64
8
2.15B
programmingLanguage
stringclasses
3 values
verdict
stringclasses
14 values
testset
stringclasses
12 values
passedTestCount
int64
0
1k
timeConsumedMillis
int64
0
15k
memoryConsumedBytes
int64
0
805M
code
stringlengths
3
65.5k
prompt
stringlengths
262
8.2k
response
stringlengths
17
65.5k
score
float64
-1
3.99
431
A
Black Square
PROGRAMMING
800
[ "implementation" ]
null
null
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Print a single integer — the total number of calories that Jury wastes.
[ "1 2 3 4\n123214\n", "1 5 3 2\n11221\n" ]
[ "13\n", "13\n" ]
none
500
[ { "input": "1 2 3 4\n123214", "output": "13" }, { "input": "1 5 3 2\n11221", "output": "13" }, { "input": "5 5 5 1\n3422", "output": "16" }, { "input": "4 3 2 1\n2", "output": "3" }, { "input": "5651 6882 6954 4733\n2442313421", "output": "60055" }, { "input": "0 0 0 0\n4132", "output": "0" }, { "input": "3163 5778 83 7640\n11141442444", "output": "64270" }, { "input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442", "output": "420780" }, { "input": "0 0 0 0\n1", "output": "0" }, { "input": "1 2 3 4\n4", "output": "4" }, { "input": "2343 7653 1242 5432\n1", "output": "2343" }, { "input": "2343 7653 1242 5432\n2", "output": "7653" }, { "input": "2343 7653 1242 5432\n3", "output": "1242" }, { "input": "2343 7653 1242 5432\n4", "output": "5432" }, { "input": "1 2 3 4\n123412", "output": "13" }, { "input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111", "output": "2650" }, { "input": "1 2 3 4\n11111111111111111111111111111111111111111111111111", "output": "50" }, { "input": "1 2 3 4\n23123231321231231231231231221232123121312321", "output": "87" }, { "input": "1 2 3 4\n1111111111111222222222233333333333444444444444444", "output": "126" }, { "input": "2 3 1 4\n121321232412342112312313213123123412131231231232", "output": "105" } ]
1,657,181,146
2,147,483,647
Python 3
OK
TESTS
49
77
0
num=list(map(int,input().split(" "))) s=input() sum=0 for i in s: if i=='1': sum+=num[0] elif i=='2': sum+=num[1] elif i =='3': sum+=num[2] elif i== '4': sum+=num[3] print(sum)
Title: Black Square Time Limit: None seconds Memory Limit: None megabytes Problem Description: Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone. In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip. You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares? Input Specification: The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104). The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip. Output Specification: Print a single integer — the total number of calories that Jury wastes. Demo Input: ['1 2 3 4\n123214\n', '1 5 3 2\n11221\n'] Demo Output: ['13\n', '13\n'] Note: none
```python num=list(map(int,input().split(" "))) s=input() sum=0 for i in s: if i=='1': sum+=num[0] elif i=='2': sum+=num[1] elif i =='3': sum+=num[2] elif i== '4': sum+=num[3] print(sum) ```
3
281
A
Word Capitalization
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged.
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output the given word after capitalization.
[ "ApPLe\n", "konjac\n" ]
[ "ApPLe\n", "Konjac\n" ]
none
500
[ { "input": "ApPLe", "output": "ApPLe" }, { "input": "konjac", "output": "Konjac" }, { "input": "a", "output": "A" }, { "input": "A", "output": "A" }, { "input": "z", "output": "Z" }, { "input": "ABACABA", "output": "ABACABA" }, { "input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX", "output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX" }, { "input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO", "output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO" }, { "input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD", "output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD" }, { "input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW", "output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW" }, { "input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL", "output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL" }, { "input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC", "output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC" }, { "input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN", "output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN" }, { "input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE", "output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE" }, { "input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP", "output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP" }, { "input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG", "output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG" }, { "input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV", "output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV" }, { "input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI", "output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI" }, { "input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX", "output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX" }, { "input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ", "output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ" }, { "input": "P", "output": "P" }, { "input": "Xyzzy", "output": "Xyzzy" }, { "input": "Zzz", "output": "Zzz" }, { "input": "Zp", "output": "Zp" } ]
1,697,646,670
2,147,483,647
Python 3
OK
TESTS
25
92
0
s=input() print(s[0].upper()+s[1:len(s)])
Title: Word Capitalization Time Limit: None seconds Memory Limit: None megabytes Problem Description: Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word. Note, that during capitalization all the letters except the first one remains unchanged. Input Specification: A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103. Output Specification: Output the given word after capitalization. Demo Input: ['ApPLe\n', 'konjac\n'] Demo Output: ['ApPLe\n', 'Konjac\n'] Note: none
```python s=input() print(s[0].upper()+s[1:len(s)]) ```
3
447
B
DZY Loves Strings
PROGRAMMING
1,000
[ "greedy", "implementation" ]
null
null
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103). The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103). The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Print a single integer — the largest possible value of the resulting string DZY could get.
[ "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n" ]
[ "41\n" ]
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
1,000
[ { "input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "41" }, { "input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453", "output": "29978" }, { "input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314", "output": "1762894" }, { "input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585", "output": "2960349" }, { "input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933", "output": "99140444" }, { "input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686", "output": "301124161" }, { "input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495", "output": "30125295" }, { "input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165", "output": "136422" }, { "input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348", "output": "2578628" }, { "input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338", "output": "9168707" }, { "input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657", "output": "144901921" }, { "input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860", "output": "809931" }, { "input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "5" }, { "input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "21" } ]
1,616,828,199
2,147,483,647
PyPy 3
OK
TESTS
24
109
0
s=input() k=int(input()) lst=list(map(int,input().split())) lst2=[chr(i) for i in range(97,123)] dct={} for i in range(len(lst2)): dct[lst2[i]]=lst[i] value=0 alpha=max(dct.values()) for i in range(len(s)): value+=(i+1)*dct[s[i]] #print(value) alpha=max(dct.values()) #print(alpha) value+=alpha*(k*(k+2*len(s)+1)/2) print(int(value))
Title: DZY Loves Strings Time Limit: None seconds Memory Limit: None megabytes Problem Description: DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get? Input Specification: The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103). The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103). The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000. Output Specification: Print a single integer — the largest possible value of the resulting string DZY could get. Demo Input: ['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n'] Demo Output: ['41\n'] Note: In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
```python s=input() k=int(input()) lst=list(map(int,input().split())) lst2=[chr(i) for i in range(97,123)] dct={} for i in range(len(lst2)): dct[lst2[i]]=lst[i] value=0 alpha=max(dct.values()) for i in range(len(s)): value+=(i+1)*dct[s[i]] #print(value) alpha=max(dct.values()) #print(alpha) value+=alpha*(k*(k+2*len(s)+1)/2) print(int(value)) ```
3
764
A
Taymyr is calling you
PROGRAMMING
800
[ "brute force", "implementation", "math" ]
null
null
Comrade Dujikov is busy choosing artists for Timofey's birthday and is recieving calls from Taymyr from Ilia-alpinist. Ilia-alpinist calls every *n* minutes, i.e. in minutes *n*, 2*n*, 3*n* and so on. Artists come to the comrade every *m* minutes, i.e. in minutes *m*, 2*m*, 3*m* and so on. The day is *z* minutes long, i.e. the day consists of minutes 1,<=2,<=...,<=*z*. How many artists should be killed so that there are no artists in the room when Ilia calls? Consider that a call and a talk with an artist take exactly one minute.
The only string contains three integers — *n*, *m* and *z* (1<=≤<=*n*,<=*m*,<=*z*<=≤<=104).
Print single integer — the minimum number of artists that should be killed so that there are no artists in the room when Ilia calls.
[ "1 1 10\n", "1 2 5\n", "2 3 9\n" ]
[ "10\n", "2\n", "1\n" ]
Taymyr is a place in the north of Russia. In the first test the artists come each minute, as well as the calls, so we need to kill all of them. In the second test we need to kill artists which come on the second and the fourth minutes. In the third test — only the artist which comes on the sixth minute.
500
[ { "input": "1 1 10", "output": "10" }, { "input": "1 2 5", "output": "2" }, { "input": "2 3 9", "output": "1" }, { "input": "4 8 9", "output": "1" }, { "input": "7 9 2", "output": "0" }, { "input": "10000 10000 10000", "output": "1" }, { "input": "24 22 9235", "output": "34" }, { "input": "74 8 417", "output": "1" }, { "input": "972 1 203", "output": "0" }, { "input": "550 1 754", "output": "1" }, { "input": "860 1 884", "output": "1" }, { "input": "358 2 809", "output": "2" }, { "input": "33 27 216", "output": "0" }, { "input": "2940 1 9311", "output": "3" }, { "input": "4624 1 1953", "output": "0" }, { "input": "2696 2 7345", "output": "2" }, { "input": "3443 2 6701", "output": "0" }, { "input": "3 613 2275", "output": "1" }, { "input": "1 10000 10000", "output": "1" }, { "input": "10000 1 10000", "output": "1" }, { "input": "1 1 1", "output": "1" }, { "input": "1 1 10000", "output": "10000" }, { "input": "34 27 10000", "output": "10" }, { "input": "2 2 9999", "output": "4999" }, { "input": "2 2 1", "output": "0" }, { "input": "6 4 36", "output": "3" }, { "input": "33 6 3005", "output": "45" }, { "input": "5 1 20", "output": "4" }, { "input": "1 2 10", "output": "5" }, { "input": "2 1 100", "output": "50" }, { "input": "10 20 10000", "output": "500" }, { "input": "8 12 12", "output": "0" } ]
1,679,416,960
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
31
0
p,q,r=list(map(int,input().split())) r=0 for i in range(p,r+1,i=i+p): for j in range(q,i+1,j=j+q): if i==j: r=r+1 print(r)
Title: Taymyr is calling you Time Limit: None seconds Memory Limit: None megabytes Problem Description: Comrade Dujikov is busy choosing artists for Timofey's birthday and is recieving calls from Taymyr from Ilia-alpinist. Ilia-alpinist calls every *n* minutes, i.e. in minutes *n*, 2*n*, 3*n* and so on. Artists come to the comrade every *m* minutes, i.e. in minutes *m*, 2*m*, 3*m* and so on. The day is *z* minutes long, i.e. the day consists of minutes 1,<=2,<=...,<=*z*. How many artists should be killed so that there are no artists in the room when Ilia calls? Consider that a call and a talk with an artist take exactly one minute. Input Specification: The only string contains three integers — *n*, *m* and *z* (1<=≤<=*n*,<=*m*,<=*z*<=≤<=104). Output Specification: Print single integer — the minimum number of artists that should be killed so that there are no artists in the room when Ilia calls. Demo Input: ['1 1 10\n', '1 2 5\n', '2 3 9\n'] Demo Output: ['10\n', '2\n', '1\n'] Note: Taymyr is a place in the north of Russia. In the first test the artists come each minute, as well as the calls, so we need to kill all of them. In the second test we need to kill artists which come on the second and the fourth minutes. In the third test — only the artist which comes on the sixth minute.
```python p,q,r=list(map(int,input().split())) r=0 for i in range(p,r+1,i=i+p): for j in range(q,i+1,j=j+q): if i==j: r=r+1 print(r) ```
-1
466
C
Number of Ways
PROGRAMMING
1,700
[ "binary search", "brute force", "data structures", "dp", "two pointers" ]
null
null
You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same. More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that .
The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*.
Print a single integer — the number of ways to split the array into three parts with the same sum.
[ "5\n1 2 3 0 3\n", "4\n0 1 -1 0\n", "2\n4 1\n" ]
[ "2\n", "1\n", "0\n" ]
none
1,500
[ { "input": "5\n1 2 3 0 3", "output": "2" }, { "input": "4\n0 1 -1 0", "output": "1" }, { "input": "2\n4 1", "output": "0" }, { "input": "9\n0 0 0 0 0 0 0 0 0", "output": "28" }, { "input": "10\n2 5 -2 2 -3 -2 3 5 -5 -2", "output": "0" }, { "input": "1\n1", "output": "0" }, { "input": "3\n1 2 3", "output": "0" }, { "input": "100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1", "output": "2030" }, { "input": "6\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000", "output": "1" }, { "input": "10\n1 0 0 0 1 1 1 0 1 1", "output": "2" }, { "input": "10\n-2 2 -2 0 -2 -1 1 -1 2 0", "output": "0" }, { "input": "4\n0 2 -1 2", "output": "0" }, { "input": "5\n3 3 -3 3 3", "output": "3" }, { "input": "5\n1 1 1 1 1", "output": "0" }, { "input": "8\n-1 -1 -1 -1 -1 -1 -1 -1", "output": "0" }, { "input": "2\n0 0", "output": "0" }, { "input": "4\n1 -1 0 0", "output": "1" }, { "input": "3\n6 -3 6", "output": "0" } ]
1,699,950,293
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
31
0
n = int(input()) nimlist = list(map(int,input().split())) if sum(nimlist) % 3 == 0: three = sum(nimlist) // 3 l = 0 r = n -1 while l < r -1: mid = (r +l) // 2 if sum(nimlist[:mid+1]) <= three: l = mid else: r = mid if three == sum(nimlist[:l+1]): count1 = 0 p = l while nimlist[p] == 0 and p != 0: p -= 1 count1 += 1 newlist = nimlist[l+1:] x = 0 y = len(newlist) - 1 while x < y - 1: mid = (x + y) // 2 if sum(newlist[:mid + 1]) <= three: x = mid else: y = mid if three == sum(newlist[:x+1]): count2 = 0 g = x while newlist[g] == 0 and x != 0: g -= 1 count2 += 1 print(2**(count2 + count1)) else: print(0) else: print(0) else: print(0)
Title: Number of Ways Time Limit: None seconds Memory Limit: None megabytes Problem Description: You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same. More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that . Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*. Output Specification: Print a single integer — the number of ways to split the array into three parts with the same sum. Demo Input: ['5\n1 2 3 0 3\n', '4\n0 1 -1 0\n', '2\n4 1\n'] Demo Output: ['2\n', '1\n', '0\n'] Note: none
```python n = int(input()) nimlist = list(map(int,input().split())) if sum(nimlist) % 3 == 0: three = sum(nimlist) // 3 l = 0 r = n -1 while l < r -1: mid = (r +l) // 2 if sum(nimlist[:mid+1]) <= three: l = mid else: r = mid if three == sum(nimlist[:l+1]): count1 = 0 p = l while nimlist[p] == 0 and p != 0: p -= 1 count1 += 1 newlist = nimlist[l+1:] x = 0 y = len(newlist) - 1 while x < y - 1: mid = (x + y) // 2 if sum(newlist[:mid + 1]) <= three: x = mid else: y = mid if three == sum(newlist[:x+1]): count2 = 0 g = x while newlist[g] == 0 and x != 0: g -= 1 count2 += 1 print(2**(count2 + count1)) else: print(0) else: print(0) else: print(0) ```
0
500
A
New Year Transportation
PROGRAMMING
1,000
[ "dfs and similar", "graphs", "implementation" ]
null
null
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
[ "8 4\n1 2 1 2 1 2 1\n", "8 5\n1 2 1 2 1 1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
500
[ { "input": "8 4\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "8 5\n1 2 1 2 1 1 1", "output": "NO" }, { "input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1", "output": "YES" }, { "input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1", "output": "YES" }, { "input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1", "output": "NO" }, { "input": "10 3\n8 3 5 4 2 3 2 2 1", "output": "NO" }, { "input": "10 9\n8 3 5 4 2 3 2 2 1", "output": "YES" }, { "input": "3 2\n1 1", "output": "YES" }, { "input": "3 2\n2 1", "output": "NO" }, { "input": "4 2\n2 1 1", "output": "NO" }, { "input": "4 4\n2 2 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 2 1", "output": "YES" }, { "input": "3 3\n1 1", "output": "YES" }, { "input": "8 8\n1 2 1 2 1 1 1", "output": "YES" }, { "input": "3 3\n2 1", "output": "YES" }, { "input": "4 4\n1 1 1", "output": "YES" }, { "input": "8 8\n1 1 1 1 1 1 1", "output": "YES" }, { "input": "5 5\n1 1 1 1", "output": "YES" } ]
1,647,459,988
2,147,483,647
PyPy 3-64
COMPILATION_ERROR
TESTS
0
0
0
#include<bits/stdc++.h> using namespace std; int main(){ int n,k; cin>>n>>k; int a[n-1],i = 0; string Mensaje = "NO"; while((n-1) > i)cin>>a[i++]; for (int i = 0; i < (n-1); i+= a[i]) { if(a[i] + i + 1 == k){ Mensaje = "YES" ; } } cout<<Mensaje; }
Title: New Year Transportation Time Limit: None seconds Memory Limit: None megabytes Problem Description: New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells. So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals. Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system. Input Specification: The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to. The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World. Output Specification: If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO". Demo Input: ['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4. In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
```python #include<bits/stdc++.h> using namespace std; int main(){ int n,k; cin>>n>>k; int a[n-1],i = 0; string Mensaje = "NO"; while((n-1) > i)cin>>a[i++]; for (int i = 0; i < (n-1); i+= a[i]) { if(a[i] + i + 1 == k){ Mensaje = "YES" ; } } cout<<Mensaje; } ```
-1
312
A
Whose sentence is it?
PROGRAMMING
1,100
[ "implementation", "strings" ]
null
null
One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is.
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100.
For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG&gt;.&lt; I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions.
[ "5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n" ]
[ "Freda's\nOMG&gt;.&lt; I don't know!\nOMG&gt;.&lt; I don't know!\nRainbow's\nOMG&gt;.&lt; I don't know!\n" ]
none
500
[ { "input": "5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .", "output": "Freda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!" }, { "input": "10\nLpAEKiHVJrzSZqBVSSyY\nYECGBlala.\nUZeGpeM.UCwiHmmA\nqt_,.b_.LSwJtJ.\nFAnXZtHlala.\nmiao.iapelala.\nCFPlbUgObrXLejPNu.F\nZSUfvisiHyrIMjMlala.\nmiao. lala.\nd,IWSeumytrVlala.", "output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's" }, { "input": "10\nmiao.,taUvXPVlala.\nmiao.txEeId.X_lala.\nLZIeAEd JaeBVlala.\ncKPIsWpwIlala.\nfYp.eSvn,g\nKMx,nFEslala.\nmiao.QtMyxYqiajjuM\nDutxNkCqywgcnCYskcd\ngFLKACjeqfD\n,Ss UmY.wJvcX", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nmiao.Plala.\nDVm,VYslala.\nmiao.rlala.\nmiao.,KQNL.fO_.QRc\nUBLCKEUePlala.\nIouS.Alala.\nmiao.lala.\nmiao.rlala.\nEJZwRJeKlala.\nmiao.Olala.", "output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nRainbow's\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!" }, { "input": "10\nmiao.grFTpju.jCLRnZ\ng.pVHYA_Usnm\nlloWONolcMFElala.\nAW,n.JJkOTe.Nd\n.bP.HvKlala.\nGziqPGQa,lala.\nmiao.,QkOCH.vFlala.\n.PUtOwImvUsoeh \nmiao.Z,KIds.R\nmiao.,_MDzoaAiJlala.", "output": "Rainbow's\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!" }, { "input": "10\nmiao.xWfjV\nHFVrGCDQXyZ,Sbm\nLMDS.xVkTCAY.vm\nmiao.lLBglala.\nnl,jRPyClala.\nFYnHoXlala.\nmiao. oxaHE\n.WTrw_mNpOQCa\nHOk..wHYoyMhl\nQX,XpMuPIROM", "output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nJBQqiXlala.\npUNUWQRiMPCXv\nAiLnfNHWznwkC.lala.\nmiao.Dl_Oy\nxJJJkVkdfOzQBH_SmKh\nfgD_IHvdHiorE,W\nmiao.usBKixglala.\nwCpqPUzEtD\nmiao.rlala.\nmiao.JylcGvWlala.", "output": "Freda's\nOMG>.< I don't know!\nFreda's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nmiao..FLhPl_Wjslala.\nmiao. tdEGtfdJlala.\nGAzEUlala.\nKCcmOa .aKBlZyYsdu.V\nmiao.lala.\njKylnM,FXK\nmiao.GBWqjGH.v\nmiao.RefxS Cni.\nOxaaEihuHQR_s,\nmiao.a,Axtlala.", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nNo.I_aTXlala.\nmiao.JKSCoRZS\nnOBMIlala.\nmiao.nlala.\nmiao._xqxoHIIlala.\nmiao.NJPy SWyiUDWc\nmiao.cCnahFaqqj.Xqp\nnreSMDeXPPYAQxI,W\nAktPajWimdd_qRn\nmiao.QHwKCYlala.", "output": "Freda's\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\n \n,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ ,.._ \n \nmiao.miao.miao.\nlala.lala.lala.\nlala.miao.\nmiaolala. \nmiao.lala\nmiaolala_\n,.._ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nduClyjMIPsEuWmx_Ce.byVoizYlTM,sF\nuZHsNip_,Mwtg,FZjM_LzPC,_pSvEOyTHfAOvoZXvxCZdgYDTCDdCAoSVZWyxXGcLgWlala.\nEGtJFPAvTEcqjkhaGxdduaQ_rmUzF.WaU, EIuX B,aVzFFpFrxpwADXuayRD azDfj \n_tJqYzXyqc.,u.F,mUYukveBPWnPq,f,dJnPHuBazdnbRHfzwNUdRbheAIjcoaPcnLvocrzcioxCapb R\n.YUBeb_zmwUt.QQuUdQIiOXtqshcsycEe,HLytHlala.\ndJndLqGBHt.GfpN.BgvsbXoLh_DIzAJOtFDmLSCYEztvPcS_GHPxivzV,NPMmSAtfk.Mg.w,A UcCt_lCD.csEzyJJBYtSMkzqiA\nmiao.qlala.\nmiao.FmDlY\nmiao.UQI.aJmnanNvRLskuVaMybDMsOlala.\nmiao.lala.", "output": "OMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nmiao.vyscfysAtWcPkpFHdwZqAQ,UPPcjhKQTlala.\nmiao.KESqus DybUuYFoWVpo..LWZh.UqEdUsTHFlKfzqkThAUPklala.\nUNoE vfZIAdxkiWKhsHPfsqRPTNQoHgAxooVLYxRzugHjo jaEHWQFF\nCCmdIwr.UkoiYWK.Z,,ZesMpISTXNgnpYnJaWquCyL,gO\n.JvOayhXK_bgoYbfAtnXg\nbvdSzRrXoGxVgWvdXnsjEnEfxDzIQo_aZVGDGrzwuAMtzVAHioMBx_DHuTxyieGbGuSRNUojOREqxBBxvCgqAOMzwIWT\nMBuaWduZmRaOGyIPzWOsBVeqtDrblAbXxmM_uRfqMvnVlLEuhVKlhidN_aigiXyq,ZEDqQAx\nmiao.wCHVCuVKNePKmIUFLL_lala.\nmiao.iAqstXHUv\n pMO yvPkNtnNwmUCao W,wW.OvIMVaEeVYHmqaniWq.ivlala.", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nFreda's" }, { "input": "10\nmiao.\nmiao.jrwLBCpNaDCjyoK.PFzbwWU.h.. wfQquG_P..lala.\nmiao.LGlYdKjw__.Chlala.\nW.wtr qG KDOHj.xWxPbXIXjD_,GJZDaAZ,JBHphsjWJwSKcZAIAi\nmiao.pHsGAZQDWPJQwKC.zHjJituLgp.eUrzObTI.wrpect.FMUJqu,Zuslala.\nmiao.YVlOpXccUA_YU igbsbZbhOVwyYTyOjnWqgiTmxwAuFa.flCHn.,MtVbqxZQl_BGHXWkwijGjuL, ,ezyNlala.\nmiao.xCrVSz.aMv UOSOroDlQxWeBmlWe.FA.ZfUmviMlala.\nxebAlala.\nmiao.qVSxqf vOTlala.\nD.oBUwsLQRgXAoNkQJhQN.w.oMhuvtujnmiwgQYMfjlNTSHh .lSKgI.OEp", "output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nZXXzYlTiQU\nkXE.DdcbOojSaSgjMcFBPubKHefEVAzbi,PDFgSZIz,lala.\nxEfrTCjKhhwBC.UNmJXgTGUdkQeVDlala.\nLfaEw.jvMmuOBWtfoiJNtDIlQAVWNU,xWK_efBBtfkM\nqtBpqKZMWZMX_NKrUAEKYyQcLZWQlqbM\nmiao.PrJEbUtInremuaKRItqXOrfQEjQcAak VQ\nMpGCq awvQaHRvDr uvtVMKsvZI\nmiao.A.RVGu.szCEp.pXQJwL EuTltlN.WradoTvWHJyhcNSoulala.\nmiao.rzlUHzUdxtDRpWRuc,QZwEBfsKKGHMLGtFymPPQdptLFlzZ_ORWqrlfOrlntuDkpXEvz.CxwAsFYUvpnOnFWG\nmiao.VXUoNBwlgBwcna_n.CgAAcKKUuiVA.doOJKHpMdwNwlHAcLpdfN.Awa SthrlEWpUcuOonUTxIQNszYcHDXxnhArrM..A", "output": "OMG>.< I don't know!\nFreda's\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's" }, { "input": "10\nmiao.qbxBFzrjtWv.yOk\nDBgi,loApO AACrGnwssCHN\nmiao.LV.wbQEE_V.BSAtdTIHTQOJVJ_nGOthbL,nJvQ.UeWFpsa.GGsK_Uv,HQxHS,AN_bkrolala.\nmiao.tBEqk rIQuByGKhfq_iP.BW,nySZEfrfySEcqnnIzxC,lrjIiivbxlkoVXJFiegGFRn NO,txGPhVBcv.CVhMmNO zlala.\nmiao.aBZWDWxk.wkR ,NyCzGxJnJDqBZpetdUPAmmBZDXl_Tbflala.\nmiao. XN,uMwWm. VqloYr..jTLszlala.\n.rshcgfZ.eZOdMu_RMh\nmiao.ahiwpECEe.lala.\nLeoUSroTekQAMSO__M L_ZEeRD_tUihYvQETFB,RzJmFtFiKrU\nBtygQG_OoFEFBL.KsVWTYbtqtalXoStFCZ RINHda.NuLmlkRB.vAQJFvelbsfoJ.T,M sJn", "output": "Rainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nYoYBCcaqhXLfvKKf.UYMODTHyPZlala.\ncxgWn J.Q\nmiao.nwH.IHntgKYDhdsjU DMTHXEVRyeJP ZaAecCIBJXuv.YjhEmtbjvjKnK.U,oc,x\nmiao.EcQ.FDtRJgmpAzxhq.RwXBLxjyC,IeMqaFoheMPFCGWBcwUAFnbiwlbz_fcsEGPfJaeryCtFocBNEWTlala.\nmiao.W\nmiao. ZQpIeyCXJSnFgAIzu.THfrmyoogYWQzFqblala.\nmiao.ifzdCwnTDcxpvdr OTC.YqPv.MKDp..utICtAsbfYyGlala.\nmiao.\nmiao.tS.U.wH.s,CxORZJsBAHLi,fXeoDJWVBH\nrcUMpeupOVRKrcIRAvU.rP kgUEfoeXcrFPQOBYG.BNvAQPg.XHMWizhLpZNljXc .LQmVXCi", "output": "Freda's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!" }, { "input": "10\nlala.\nmiao.milalala.lmmialamiao.la.o.iao.a.ao.\nmialala.o.\nmiao.millala.allala.amiao..miao.miao.lala.ao.miammiao.iao.o.\nmiao.miaomiao..\nlalmiao.amiao..\nmiao.lala.lamiamiaolala..o.lalala.miao..\nmlala.iao.lalamiao..\nlmlala.iao.alalamiao.lmialala.lala.miao.o.alala..lala..lalmiaomiao..lalmiao.a.lalamiao..miao.alala..\nlalllamiao.la.lala.alamiao.lalalala.lala..miao.lamiao.la.lallalamiao..a..a.", "output": "Freda's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nlalllala.ala.lala.a.mmimiao.aomiao.lllala.ala.amiao.la.mialalala.la.o..imiao.miao.amlala.iao.o.\nmilala.alllala.ala.amiao.lamiao..o.\nlala.lalalala..lalalala..\nlala.miao.\nmimiao.ao.lala.\nlalmiao.amlala.iamialala.o.o..\nlalammlala.iaolammiao.imiao.ao.la..iao..\nmiao.mialala.omiao..mlala.iaolala..\nmiamiao.o.llallala.ala.la.miao.ala.miao.mimialmiao.ala.o.alala.miaomiao..olala..\nmialala.lamiao.la.lala.miao.ollala.allala.ala.lmiaommiao.imiao.ao.lallallala.a.miao.a..a..", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nFreda's\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "10\nlamiao.lamiao.mimiao.ao..\nllala.almiaomiao..lala.miao.a.\nlalala.lala.lalala.lala.lalala..la.\nlalala.la.miao.\nmiao.llalallala.miao.a.la.lala.almimiao.ao.a.\nmiao.mlala.ilala.aomilala.ao..\nmilala.ao.\nmmiao.iao.\nmlala.lala.ialalmiao.alala..olala.lala..\nlala.lmlalalalalala...iao.milala.aommiao.iao..alamiaolallala.milala.ao.a..lalalmiao.a..llala.amiao..", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nRainbow's\nRainbow's\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "4\n \n miao. \n lala. \n ", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" }, { "input": "1\nMiao.", "output": "OMG>.< I don't know!" }, { "input": "1\nm", "output": "OMG>.< I don't know!" }, { "input": "1\nMiAo.sdsdlala.", "output": "Freda's" }, { "input": "1\nLalA.", "output": "OMG>.< I don't know!" }, { "input": "3\n.\nm\nl", "output": "OMG>.< I don't know!\nOMG>.< I don't know!\nOMG>.< I don't know!" } ]
1,370,214,878
2,147,483,647
Python 3
OK
TESTS
36
187
5,222,400
import math import re from fractions import Fraction from collections import Counter class Task: sentences = [] answer = [] def __init__(self): self.sentences = ['' for _ in range(int(input()))] for i in range(len(self.sentences)): self.sentences[i] = input() def solve(self): sentences = self.sentences for current in sentences: matcherFirst = re.search('^miao\.', current) matcherSecond = re.search('lala\.$', current) if matcherFirst != None and matcherSecond == None: self.answer += ["Rainbow's"] continue if matcherFirst == None and matcherSecond != None: self.answer += ["Freda's"] continue self.answer += ["OMG>.< I don't know!"] def printAnswer(self): for line in self.answer: print(line) task = Task() task.solve() task.printAnswer()
Title: Whose sentence is it? Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day, liouzhou_101 got a chat record of Freda and Rainbow. Out of curiosity, he wanted to know which sentences were said by Freda, and which were said by Rainbow. According to his experience, he thought that Freda always said "lala." at the end of her sentences, while Rainbow always said "miao." at the beginning of his sentences. For each sentence in the chat record, help liouzhou_101 find whose sentence it is. Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=10), number of sentences in the chat record. Each of the next *n* lines contains a sentence. A sentence is a string that contains only Latin letters (A-Z, a-z), underline (_), comma (,), point (.) and space ( ). Its length doesn’t exceed 100. Output Specification: For each sentence, output "Freda's" if the sentence was said by Freda, "Rainbow's" if the sentence was said by Rainbow, or "OMG&gt;.&lt; I don't know!" if liouzhou_101 can’t recognize whose sentence it is. He can’t recognize a sentence if it begins with "miao." and ends with "lala.", or satisfies neither of the conditions. Demo Input: ['5\nI will go to play with you lala.\nwow, welcome.\nmiao.lala.\nmiao.\nmiao .\n'] Demo Output: ["Freda's\nOMG&gt;.&lt; I don't know!\nOMG&gt;.&lt; I don't know!\nRainbow's\nOMG&gt;.&lt; I don't know!\n"] Note: none
```python import math import re from fractions import Fraction from collections import Counter class Task: sentences = [] answer = [] def __init__(self): self.sentences = ['' for _ in range(int(input()))] for i in range(len(self.sentences)): self.sentences[i] = input() def solve(self): sentences = self.sentences for current in sentences: matcherFirst = re.search('^miao\.', current) matcherSecond = re.search('lala\.$', current) if matcherFirst != None and matcherSecond == None: self.answer += ["Rainbow's"] continue if matcherFirst == None and matcherSecond != None: self.answer += ["Freda's"] continue self.answer += ["OMG>.< I don't know!"] def printAnswer(self): for line in self.answer: print(line) task = Task() task.solve() task.printAnswer() ```
3
999
E
Reachability from the Capital
PROGRAMMING
2,000
[ "dfs and similar", "graphs", "greedy" ]
null
null
There are $n$ cities and $m$ roads in Berland. Each road connects a pair of cities. The roads in Berland are one-way. What is the minimum number of new roads that need to be built to make all the cities reachable from the capital? New roads will also be one-way.
The first line of input consists of three integers $n$, $m$ and $s$ ($1 \le n \le 5000, 0 \le m \le 5000, 1 \le s \le n$) — the number of cities, the number of roads and the index of the capital. Cities are indexed from $1$ to $n$. The following $m$ lines contain roads: road $i$ is given as a pair of cities $u_i$, $v_i$ ($1 \le u_i, v_i \le n$, $u_i \ne v_i$). For each pair of cities $(u, v)$, there can be at most one road from $u$ to $v$. Roads in opposite directions between a pair of cities are allowed (i.e. from $u$ to $v$ and from $v$ to $u$).
Print one integer — the minimum number of extra roads needed to make all the cities reachable from city $s$. If all the cities are already reachable from $s$, print 0.
[ "9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1\n", "5 4 5\n1 2\n2 3\n3 4\n4 1\n" ]
[ "3\n", "1\n" ]
The first example is illustrated by the following: For example, you can add roads ($6, 4$), ($7, 9$), ($1, 7$) to make all the cities reachable from $s = 1$. The second example is illustrated by the following: In this example, you can add any one of the roads ($5, 1$), ($5, 2$), ($5, 3$), ($5, 4$) to make all the cities reachable from $s = 5$.
0
[ { "input": "9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1", "output": "3" }, { "input": "5 4 5\n1 2\n2 3\n3 4\n4 1", "output": "1" }, { "input": "5000 0 2956", "output": "4999" }, { "input": "2 0 2", "output": "1" }, { "input": "2 1 1\n1 2", "output": "0" }, { "input": "2 1 2\n1 2", "output": "1" }, { "input": "2 2 2\n1 2\n2 1", "output": "0" }, { "input": "5000 2 238\n3212 238\n238 3212", "output": "4998" }, { "input": "5000 2 3810\n3225 1137\n1137 3225", "output": "4998" }, { "input": "100 1 30\n69 81", "output": "98" }, { "input": "500 1 209\n183 107", "output": "498" }, { "input": "1000 1 712\n542 916", "output": "998" }, { "input": "39 40 38\n4 8\n24 28\n16 17\n7 25\n4 29\n34 35\n16 24\n21 10\n23 36\n36 14\n28 16\n34 19\n15 21\n22 38\n22 37\n37 27\n28 33\n3 29\n32 22\n12 30\n9 15\n5 19\n23 27\n19 17\n25 17\n24 11\n39 10\n6 20\n16 6\n3 18\n34 21\n15 38\n11 19\n11 3\n32 4\n15 13\n16 11\n11 7\n33 7\n3 33", "output": "12" }, { "input": "8 8 1\n3 2\n3 4\n4 5\n5 3\n6 4\n6 7\n7 8\n8 6", "output": "1" }, { "input": "7 7 1\n2 3\n4 2\n7 4\n5 7\n4 5\n4 6\n6 4", "output": "1" }, { "input": "2333 1 1\n1 2", "output": "2331" }, { "input": "7 4 2\n1 2\n3 4\n5 6\n7 1", "output": "3" }, { "input": "1 0 1", "output": "0" }, { "input": "9 9 1\n2 3\n3 4\n4 5\n6 2\n7 6\n8 7\n6 8\n5 9\n9 2", "output": "1" }, { "input": "30 30 29\n29 9\n1 3\n15 5\n14 24\n7 18\n17 12\n5 9\n22 7\n26 20\n7 29\n8 2\n10 12\n17 18\n17 24\n8 12\n23 28\n10 15\n18 2\n29 13\n25 29\n9 2\n7 13\n11 5\n19 26\n10 5\n25 5\n20 10\n5 26\n24 23\n22 8", "output": "13" }, { "input": "30 30 28\n16 28\n5 30\n7 17\n6 1\n12 28\n15 28\n14 30\n25 11\n25 10\n25 8\n12 30\n27 5\n30 10\n22 14\n30 13\n20 27\n15 25\n24 20\n20 15\n1 30\n3 10\n3 4\n3 18\n15 14\n18 22\n20 26\n10 3\n15 27\n23 29\n10 24", "output": "9" } ]
1,682,955,062
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
46
0
class Graph: def __init__(self, n): self.vertexList = [] self.edges = 0 self.vertices = 0 self.current = 1 for _ in range(n): self.addVertex() def __repr__(self): if self.vertices <= 0: return "" else: r = str(self.vertexList[0]) for i in range(1,self.vertices): r += "\n" + str(self.vertexList[i]) return r def __str__(self): return self.__repr__() def _getVertex(self, u): return self.vertexList[u-1] def addVertex(self): new_vertex = [] self.vertexList.append(new_vertex) self.current += 1 self.vertices += 1 def _addEdgeAux(self, u, v): # currentVertex = self._getVertex(v) currentVertex = self._getVertex(u) currentVertex.append(v) def addEdge(self, u, v): self._addEdgeAux(u, v) # self._addEdgeAux(v, u) self.edges += 1 n, m, s = [int(x) for x in input().split()] G = Graph(n) for _ in range(m): u, v = [int(x) for x in input().split()] G.addEdge(u, v) print(G) visited = [0]*(n+1) def dfs(G, v, visited): visited[v] = 1 adj = G._getVertex(v) if not adj: return else: for w in adj: if visited[w] == 0: visited[0] += 1 dfs(G, w, visited) dfs(G, 1, visited) print(n - 1 - visited[0])
Title: Reachability from the Capital Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are $n$ cities and $m$ roads in Berland. Each road connects a pair of cities. The roads in Berland are one-way. What is the minimum number of new roads that need to be built to make all the cities reachable from the capital? New roads will also be one-way. Input Specification: The first line of input consists of three integers $n$, $m$ and $s$ ($1 \le n \le 5000, 0 \le m \le 5000, 1 \le s \le n$) — the number of cities, the number of roads and the index of the capital. Cities are indexed from $1$ to $n$. The following $m$ lines contain roads: road $i$ is given as a pair of cities $u_i$, $v_i$ ($1 \le u_i, v_i \le n$, $u_i \ne v_i$). For each pair of cities $(u, v)$, there can be at most one road from $u$ to $v$. Roads in opposite directions between a pair of cities are allowed (i.e. from $u$ to $v$ and from $v$ to $u$). Output Specification: Print one integer — the minimum number of extra roads needed to make all the cities reachable from city $s$. If all the cities are already reachable from $s$, print 0. Demo Input: ['9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1\n', '5 4 5\n1 2\n2 3\n3 4\n4 1\n'] Demo Output: ['3\n', '1\n'] Note: The first example is illustrated by the following: For example, you can add roads ($6, 4$), ($7, 9$), ($1, 7$) to make all the cities reachable from $s = 1$. The second example is illustrated by the following: In this example, you can add any one of the roads ($5, 1$), ($5, 2$), ($5, 3$), ($5, 4$) to make all the cities reachable from $s = 5$.
```python class Graph: def __init__(self, n): self.vertexList = [] self.edges = 0 self.vertices = 0 self.current = 1 for _ in range(n): self.addVertex() def __repr__(self): if self.vertices <= 0: return "" else: r = str(self.vertexList[0]) for i in range(1,self.vertices): r += "\n" + str(self.vertexList[i]) return r def __str__(self): return self.__repr__() def _getVertex(self, u): return self.vertexList[u-1] def addVertex(self): new_vertex = [] self.vertexList.append(new_vertex) self.current += 1 self.vertices += 1 def _addEdgeAux(self, u, v): # currentVertex = self._getVertex(v) currentVertex = self._getVertex(u) currentVertex.append(v) def addEdge(self, u, v): self._addEdgeAux(u, v) # self._addEdgeAux(v, u) self.edges += 1 n, m, s = [int(x) for x in input().split()] G = Graph(n) for _ in range(m): u, v = [int(x) for x in input().split()] G.addEdge(u, v) print(G) visited = [0]*(n+1) def dfs(G, v, visited): visited[v] = 1 adj = G._getVertex(v) if not adj: return else: for w in adj: if visited[w] == 0: visited[0] += 1 dfs(G, w, visited) dfs(G, 1, visited) print(n - 1 - visited[0]) ```
0
570
A
Elections
PROGRAMMING
1,100
[ "implementation" ]
null
null
The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate. The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index. At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index. Determine who will win the elections.
The first line of the input contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of candidates and of cities, respectively. Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*j*<=≤<=*n*, 1<=≤<=*i*<=≤<=*m*, 0<=≤<=*a**ij*<=≤<=109) denotes the number of votes for candidate *j* in city *i*. It is guaranteed that the total number of people in all the cities does not exceed 109.
Print a single number — the index of the candidate who won the elections. The candidates are indexed starting from one.
[ "3 3\n1 2 3\n2 3 1\n1 2 1\n", "3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n" ]
[ "2", "1" ]
Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes. Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
500
[ { "input": "3 3\n1 2 3\n2 3 1\n1 2 1", "output": "2" }, { "input": "3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7", "output": "1" }, { "input": "1 3\n5\n3\n2", "output": "1" }, { "input": "3 1\n1 2 3", "output": "3" }, { "input": "3 1\n100 100 100", "output": "1" }, { "input": "2 2\n1 2\n2 1", "output": "1" }, { "input": "2 2\n2 1\n2 1", "output": "1" }, { "input": "2 2\n1 2\n1 2", "output": "2" }, { "input": "3 3\n0 0 0\n1 1 1\n2 2 2", "output": "1" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 2 3 4 5\n2 3 4 5 6\n3 4 5 6 7\n4 5 6 7 8\n5 6 7 8 9", "output": "5" }, { "input": "4 4\n1 3 1 3\n3 1 3 1\n2 0 0 2\n0 1 1 0", "output": "1" }, { "input": "4 4\n1 4 1 3\n3 1 2 1\n1 0 0 2\n0 1 10 0", "output": "1" }, { "input": "4 4\n1 4 1 300\n3 1 2 1\n5 0 0 2\n0 1 10 100", "output": "1" }, { "input": "5 5\n15 45 15 300 10\n53 15 25 51 10\n5 50 50 2 10\n1000 1 10 100 10\n10 10 10 10 10", "output": "1" }, { "input": "1 100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "1" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1" }, { "input": "1 100\n859\n441\n272\n47\n355\n345\n612\n569\n545\n599\n410\n31\n720\n303\n58\n537\n561\n730\n288\n275\n446\n955\n195\n282\n153\n455\n996\n121\n267\n702\n769\n560\n353\n89\n990\n282\n801\n335\n573\n258\n722\n768\n324\n41\n249\n125\n557\n303\n664\n945\n156\n884\n985\n816\n433\n65\n976\n963\n85\n647\n46\n877\n665\n523\n714\n182\n377\n549\n994\n385\n184\n724\n447\n99\n766\n353\n494\n747\n324\n436\n915\n472\n879\n582\n928\n84\n627\n156\n972\n651\n159\n372\n70\n903\n590\n480\n184\n540\n270\n892", "output": "1" }, { "input": "100 1\n439 158 619 538 187 153 973 781 610 475 94 947 449 531 220 51 788 118 189 501 54 434 465 902 280 635 688 214 737 327 682 690 683 519 261 923 254 388 529 659 662 276 376 735 976 664 521 285 42 147 187 259 407 977 879 465 522 17 550 701 114 921 577 265 668 812 232 267 135 371 586 201 608 373 771 358 101 412 195 582 199 758 507 882 16 484 11 712 916 699 783 618 405 124 904 257 606 610 230 718", "output": "54" }, { "input": "1 99\n511\n642\n251\n30\n494\n128\n189\n324\n884\n656\n120\n616\n959\n328\n411\n933\n895\n350\n1\n838\n996\n761\n619\n131\n824\n751\n707\n688\n915\n115\n244\n476\n293\n986\n29\n787\n607\n259\n756\n864\n394\n465\n303\n387\n521\n582\n485\n355\n299\n997\n683\n472\n424\n948\n339\n383\n285\n957\n591\n203\n866\n79\n835\n980\n344\n493\n361\n159\n160\n947\n46\n362\n63\n553\n793\n754\n429\n494\n523\n227\n805\n313\n409\n243\n927\n350\n479\n971\n825\n460\n544\n235\n660\n327\n216\n729\n147\n671\n738", "output": "1" }, { "input": "99 1\n50 287 266 159 551 198 689 418 809 43 691 367 160 664 86 805 461 55 127 950 576 351 721 493 972 560 934 885 492 92 321 759 767 989 883 7 127 413 404 604 80 645 666 874 371 718 893 158 722 198 563 293 134 255 742 913 252 378 859 721 502 251 839 284 133 209 962 514 773 124 205 903 785 859 911 93 861 786 747 213 690 69 942 697 211 203 284 961 351 137 962 952 408 249 238 850 944 40 346", "output": "34" }, { "input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2", "output": "100" }, { "input": "1 1\n0", "output": "1" }, { "input": "2 1\n0 0", "output": "1" }, { "input": "2 2\n0 0\n0 0", "output": "1" }, { "input": "2 2\n1 2\n0 0", "output": "1" }, { "input": "3 3\n0 0 0\n0 0 0\n0 0 0", "output": "1" }, { "input": "2 3\n0 0\n0 0\n0 1", "output": "1" }, { "input": "3 2\n1 1 3\n0 0 0", "output": "1" }, { "input": "3 4\n1 10 3\n0 0 0\n0 0 0\n0 0 0", "output": "1" }, { "input": "2 4\n2 1\n1 2\n0 0\n1 2", "output": "1" }, { "input": "2 2\n0 1\n0 1", "output": "2" }, { "input": "2 3\n1 2\n0 0\n2 1", "output": "1" }, { "input": "2 2\n0 0\n4 5", "output": "1" }, { "input": "3 2\n10 15 20\n0 0 0", "output": "1" }, { "input": "3 4\n0 0 0\n0 0 0\n0 0 0\n1 2 3", "output": "1" }, { "input": "3 3\n0 0 0\n0 0 0\n0 0 1", "output": "1" }, { "input": "3 3\n0 0 0\n1 2 3\n1 3 2", "output": "1" }, { "input": "3 1\n0 0 0", "output": "1" }, { "input": "3 3\n0 0 1\n0 0 0\n0 0 0", "output": "1" } ]
1,604,991,088
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
12
109
0
n,m=map(int,input().split()) l=[0]*n for i in range(m): l1=list(map(int,input().split())) for i in range(n): l[i]+=l1[i] print(1+l.index(max(l)))
Title: Elections Time Limit: None seconds Memory Limit: None megabytes Problem Description: The country of Byalechinsk is running elections involving *n* candidates. The country consists of *m* cities. We know how many people in each city voted for each candidate. The electoral system in the country is pretty unusual. At the first stage of elections the votes are counted for each city: it is assumed that in each city won the candidate who got the highest number of votes in this city, and if several candidates got the maximum number of votes, then the winner is the one with a smaller index. At the second stage of elections the winner is determined by the same principle over the cities: the winner of the elections is the candidate who won in the maximum number of cities, and among those who got the maximum number of cities the winner is the one with a smaller index. Determine who will win the elections. Input Specification: The first line of the input contains two integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of candidates and of cities, respectively. Each of the next *m* lines contains *n* non-negative integers, the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*j*<=≤<=*n*, 1<=≤<=*i*<=≤<=*m*, 0<=≤<=*a**ij*<=≤<=109) denotes the number of votes for candidate *j* in city *i*. It is guaranteed that the total number of people in all the cities does not exceed 109. Output Specification: Print a single number — the index of the candidate who won the elections. The candidates are indexed starting from one. Demo Input: ['3 3\n1 2 3\n2 3 1\n1 2 1\n', '3 4\n10 10 3\n5 1 6\n2 2 2\n1 5 7\n'] Demo Output: ['2', '1'] Note: Note to the first sample test. At the first stage city 1 chosen candidate 3, city 2 chosen candidate 2, city 3 chosen candidate 2. The winner is candidate 2, he gained 2 votes. Note to the second sample test. At the first stage in city 1 candidates 1 and 2 got the same maximum number of votes, but candidate 1 has a smaller index, so the city chose candidate 1. City 2 chosen candidate 3. City 3 chosen candidate 1, due to the fact that everyone has the same number of votes, and 1 has the smallest index. City 4 chosen the candidate 3. On the second stage the same number of cities chose candidates 1 and 3. The winner is candidate 1, the one with the smaller index.
```python n,m=map(int,input().split()) l=[0]*n for i in range(m): l1=list(map(int,input().split())) for i in range(n): l[i]+=l1[i] print(1+l.index(max(l))) ```
0
365
A
Good Number
PROGRAMMING
1,100
[ "implementation" ]
null
null
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
Print a single integer — the number of *k*-good numbers in *a*.
[ "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n", "2 1\n1\n10\n" ]
[ "10\n", "1\n" ]
none
500
[ { "input": "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560", "output": "10" }, { "input": "2 1\n1\n10", "output": "1" }, { "input": "1 0\n1000000000", "output": "1" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "6 0\n10\n102\n120\n1032\n1212103\n1999999", "output": "5" }, { "input": "1 3\n1000000000", "output": "0" }, { "input": "1 9\n1000000000", "output": "0" }, { "input": "1 0\n1", "output": "0" }, { "input": "1 1\n1", "output": "0" }, { "input": "1 3\n1", "output": "0" }, { "input": "1 9\n1", "output": "0" }, { "input": "2 8\n123456780\n123", "output": "1" }, { "input": "2 8\n12345678\n1230", "output": "0" }, { "input": "6 1\n10\n102\n120\n1032\n1212103\n1999999", "output": "5" }, { "input": "6 2\n10\n102\n120\n1032\n1212103\n1999999", "output": "4" }, { "input": "6 3\n10\n102\n120\n1032\n1212103\n1999999", "output": "2" }, { "input": "6 9\n10\n102\n120\n1032\n1212103\n1999999", "output": "0" }, { "input": "1 2\n2220", "output": "0" } ]
1,692,303,500
2,147,483,647
PyPy 3-64
OK
TESTS
37
62
0
n,k = map(int , input().split()) l_comp = [x for x in range(k+1)] ans = 0 for i in range (n): new_l = sorted([int(x) for x in list(input())]) if set(l_comp).issubset(set(new_l)): ans+=1 print(ans)
Title: Good Number Time Limit: None seconds Memory Limit: None megabytes Problem Description: Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*). Input Specification: The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109). Output Specification: Print a single integer — the number of *k*-good numbers in *a*. Demo Input: ['10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n', '2 1\n1\n10\n'] Demo Output: ['10\n', '1\n'] Note: none
```python n,k = map(int , input().split()) l_comp = [x for x in range(k+1)] ans = 0 for i in range (n): new_l = sorted([int(x) for x in list(input())]) if set(l_comp).issubset(set(new_l)): ans+=1 print(ans) ```
3
219
A
k-String
PROGRAMMING
1,000
[ "implementation", "strings" ]
null
null
A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string.
The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*.
Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes).
[ "2\naazz\n", "3\nabcabcabz\n" ]
[ "azaz\n", "-1\n" ]
none
500
[ { "input": "2\naazz", "output": "azaz" }, { "input": "3\nabcabcabz", "output": "-1" }, { "input": "1\na", "output": "a" }, { "input": "2\nabba", "output": "abab" }, { "input": "2\naaab", "output": "-1" }, { "input": "7\nabacaba", "output": "-1" }, { "input": "5\naaaaa", "output": "aaaaa" }, { "input": "3\naabaaaaabb", "output": "-1" }, { "input": "2\naaab", "output": "-1" }, { "input": "2\nbabac", "output": "-1" }, { "input": "3\nbbbccc", "output": "bcbcbc" }, { "input": "2\naa", "output": "aa" }, { "input": "250\ncececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece", "output": "cececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececececece" }, { "input": "15\nabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaaabaabbbcababaaa", "output": "aaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbcaaaaaaaabbbbbbc" }, { "input": "1\naaa", "output": "aaa" }, { "input": "1\naabaab", "output": "aaaabb" }, { "input": "2\naabbbbccccccdddddddd", "output": "abbcccddddabbcccdddd" }, { "input": "3\naaaaaaaaacccdddddd", "output": "aaacddaaacddaaacdd" }, { "input": "3\naaaaaaaaacccbbbbbb", "output": "aaabbcaaabbcaaabbc" }, { "input": "2\naazzzz", "output": "azzazz" }, { "input": "2\naaaa", "output": "aaaa" }, { "input": "2\naaaazz", "output": "aazaaz" }, { "input": "2\naaaabb", "output": "aabaab" }, { "input": "2\naabbbb", "output": "abbabb" }, { "input": "2\naaaazzzz", "output": "aazzaazz" }, { "input": "2\naaazz", "output": "-1" }, { "input": "2\nbbbbaa", "output": "abbabb" }, { "input": "2\naaaaaabbbb", "output": "aaabbaaabb" }, { "input": "2\naaaaaazz", "output": "aaazaaaz" }, { "input": "2\naaaabbbb", "output": "aabbaabb" }, { "input": "2\naabaab", "output": "aabaab" }, { "input": "1\naaaaa", "output": "aaaaa" }, { "input": "2\nbbaaaa", "output": "aabaab" }, { "input": "2\nacaccc", "output": "accacc" } ]
1,690,777,926
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
9
60
307,200
from collections import Counter n=int(input()) x=input() lis=Counter(x) if n==1: print(x) else: v=list(lis.values()) v.sort() k=list(lis.keys()) f=True for i in v: if i%n!=0: f=False break if f==False: print(-1) else: rs="".join(k) print(rs*n)
Title: k-String Time Limit: None seconds Memory Limit: None megabytes Problem Description: A string is called a *k*-string if it can be represented as *k* concatenated copies of some string. For example, the string "aabaabaabaab" is at the same time a 1-string, a 2-string and a 4-string, but it is not a 3-string, a 5-string, or a 6-string and so on. Obviously any string is a 1-string. You are given a string *s*, consisting of lowercase English letters and a positive integer *k*. Your task is to reorder the letters in the string *s* in such a way that the resulting string is a *k*-string. Input Specification: The first input line contains integer *k* (1<=≤<=*k*<=≤<=1000). The second line contains *s*, all characters in *s* are lowercase English letters. The string length *s* satisfies the inequality 1<=≤<=|*s*|<=≤<=1000, where |*s*| is the length of string *s*. Output Specification: Rearrange the letters in string *s* in such a way that the result is a *k*-string. Print the result on a single output line. If there are multiple solutions, print any of them. If the solution doesn't exist, print "-1" (without quotes). Demo Input: ['2\naazz\n', '3\nabcabcabz\n'] Demo Output: ['azaz\n', '-1\n'] Note: none
```python from collections import Counter n=int(input()) x=input() lis=Counter(x) if n==1: print(x) else: v=list(lis.values()) v.sort() k=list(lis.keys()) f=True for i in v: if i%n!=0: f=False break if f==False: print(-1) else: rs="".join(k) print(rs*n) ```
0
136
A
Presents
PROGRAMMING
800
[ "implementation" ]
null
null
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
[ "4\n2 3 4 1\n", "3\n1 3 2\n", "2\n1 2\n" ]
[ "4 1 2 3\n", "1 3 2\n", "1 2\n" ]
none
500
[ { "input": "4\n2 3 4 1", "output": "4 1 2 3" }, { "input": "3\n1 3 2", "output": "1 3 2" }, { "input": "2\n1 2", "output": "1 2" }, { "input": "1\n1", "output": "1" }, { "input": "10\n1 3 2 6 4 5 7 9 8 10", "output": "1 3 2 5 6 4 7 9 8 10" }, { "input": "5\n5 4 3 2 1", "output": "5 4 3 2 1" }, { "input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19", "output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19" }, { "input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19", "output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19" }, { "input": "10\n3 4 5 6 7 8 9 10 1 2", "output": "9 10 1 2 3 4 5 6 7 8" }, { "input": "8\n1 5 3 7 2 6 4 8", "output": "1 5 3 7 2 6 4 8" }, { "input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47", "output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19" }, { "input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17", "output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25" }, { "input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85", "output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30" }, { "input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49", "output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49" }, { "input": "12\n3 8 7 4 6 5 2 1 11 9 10 12", "output": "8 7 1 4 6 5 3 2 10 11 9 12" }, { "input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76", "output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4" }, { "input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43", "output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1" }, { "input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27", "output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3" }, { "input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22", "output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53" }, { "input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13", "output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24" }, { "input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21", "output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61" }, { "input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33", "output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14" }, { "input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23", "output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21" }, { "input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12", "output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9" }, { "input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31", "output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13" }, { "input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3", "output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16" }, { "input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8", "output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6" }, { "input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71", "output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90" }, { "input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9", "output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9" }, { "input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44", "output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20" }, { "input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17", "output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28" }, { "input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7", "output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5" }, { "input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16", "output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43" }, { "input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65", "output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43" }, { "input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16", "output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45" }, { "input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51", "output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64" }, { "input": "12\n12 3 1 5 11 6 7 10 2 8 9 4", "output": "3 9 2 12 4 6 7 10 11 8 5 1" }, { "input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17", "output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44" }, { "input": "8\n1 3 5 2 4 8 6 7", "output": "1 4 2 5 3 7 8 6" }, { "input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14", "output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12" }, { "input": "10\n2 9 4 6 10 1 7 5 3 8", "output": "6 1 9 3 8 4 7 10 2 5" }, { "input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3", "output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7" }, { "input": "10\n2 4 9 3 6 8 10 5 1 7", "output": "9 1 4 2 8 5 10 6 3 7" }, { "input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15", "output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23" }, { "input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1", "output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27" }, { "input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30", "output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23" }, { "input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52", "output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50" }, { "input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18", "output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98" }, { "input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16", "output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25" }, { "input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37", "output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54" }, { "input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71", "output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71" }, { "input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22", "output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8" }, { "input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12", "output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51" }, { "input": "7\n2 1 5 7 3 4 6", "output": "2 1 5 6 3 7 4" }, { "input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35", "output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31" }, { "input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16", "output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21" }, { "input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52", "output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11" }, { "input": "9\n8 5 2 6 1 9 4 7 3", "output": "5 3 9 7 2 4 8 1 6" }, { "input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27", "output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13" }, { "input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34", "output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6" }, { "input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29", "output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14" }, { "input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7", "output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16" }, { "input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34", "output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24" }, { "input": "9\n4 8 6 5 3 9 2 7 1", "output": "9 7 5 1 4 3 8 2 6" }, { "input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29", "output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32" }, { "input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47", "output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11" }, { "input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6", "output": "10 4 1 8 6 13 12 5 3 11 9 2 7" }, { "input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29", "output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37" }, { "input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3", "output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25" }, { "input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20", "output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24" }, { "input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42", "output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59" }, { "input": "6\n4 3 6 5 1 2", "output": "5 6 2 1 4 3" }, { "input": "9\n7 8 5 3 1 4 2 9 6", "output": "5 7 4 6 3 9 1 2 8" }, { "input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37", "output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13" }, { "input": "1\n1", "output": "1" }, { "input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11", "output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13" }, { "input": "2\n2 1", "output": "2 1" }, { "input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28", "output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18" }, { "input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13", "output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1" }, { "input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14", "output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36" }, { "input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29", "output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32" }, { "input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5", "output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40" }, { "input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54", "output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21" }, { "input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29", "output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4" }, { "input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23", "output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50" }, { "input": "10\n2 10 7 4 1 5 8 6 3 9", "output": "5 1 9 4 6 8 3 7 10 2" }, { "input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13", "output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1" }, { "input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2", "output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11" }, { "input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53", "output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37" }, { "input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53", "output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53" }, { "input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64", "output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49" }, { "input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86", "output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38" }, { "input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75", "output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2" }, { "input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53", "output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5" }, { "input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39", "output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12" }, { "input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87", "output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82" }, { "input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25", "output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97" }, { "input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61", "output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96" }, { "input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92", "output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96" }, { "input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6", "output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36" }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1" } ]
1,685,116,779
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
60
0
n = int(input()) numbers = list(map(int, input().split())) numbers.reverse() pairs=[] if n==1: print(numbers[0]) else: if n % 2 != 0: pairs.append((numbers[0],)) numbers = numbers[1:] pairs += [(numbers[i], numbers[i+1]) for i in range(0, len(numbers), 2)] for pair in pairs: for num in pair[::-1]: print(num, end=' ')
Title: Presents Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there. If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift. Now Petya wants to know for each friend *i* the number of a friend who has given him a gift. Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves. Output Specification: Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*. Demo Input: ['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n'] Demo Output: ['4 1 2 3\n', '1 3 2\n', '1 2\n'] Note: none
```python n = int(input()) numbers = list(map(int, input().split())) numbers.reverse() pairs=[] if n==1: print(numbers[0]) else: if n % 2 != 0: pairs.append((numbers[0],)) numbers = numbers[1:] pairs += [(numbers[i], numbers[i+1]) for i in range(0, len(numbers), 2)] for pair in pairs: for num in pair[::-1]: print(num, end=' ') ```
0
106
A
Card Game
PROGRAMMING
1,000
[ "implementation" ]
A. Card Game
2
256
There is a card game called "Durak", which means "Fool" in Russian. The game is quite popular in the countries that used to form USSR. The problem does not state all the game's rules explicitly — you can find them later yourselves if you want. To play durak you need a pack of 36 cards. Each card has a suit ("S", "H", "D" and "C") and a rank (in the increasing order "6", "7", "8", "9", "T", "J", "Q", "K" and "A"). At the beginning of the game one suit is arbitrarily chosen as trump. The players move like that: one player puts one or several of his cards on the table and the other one should beat each of them with his cards. A card beats another one if both cards have similar suits and the first card has a higher rank then the second one. Besides, a trump card can beat any non-trump card whatever the cards’ ranks are. In all other cases you can not beat the second card with the first one. You are given the trump suit and two different cards. Determine whether the first one beats the second one or not.
The first line contains the tramp suit. It is "S", "H", "D" or "C". The second line contains the description of the two different cards. Each card is described by one word consisting of two symbols. The first symbol stands for the rank ("6", "7", "8", "9", "T", "J", "Q", "K" and "A"), and the second one stands for the suit ("S", "H", "D" and "C").
Print "YES" (without the quotes) if the first cards beats the second one. Otherwise, print "NO" (also without the quotes).
[ "H\nQH 9S\n", "S\n8D 6D\n", "C\n7H AS\n" ]
[ "YES\n", "YES", "NO" ]
none
500
[ { "input": "H\nQH 9S", "output": "YES" }, { "input": "S\n8D 6D", "output": "YES" }, { "input": "C\n7H AS", "output": "NO" }, { "input": "C\nKC 9C", "output": "YES" }, { "input": "D\n7D KD", "output": "NO" }, { "input": "H\n7H KD", "output": "YES" }, { "input": "D\nAS AH", "output": "NO" }, { "input": "H\nKH KS", "output": "YES" }, { "input": "C\n9H 6C", "output": "NO" }, { "input": "C\n9H JC", "output": "NO" }, { "input": "D\nTD JD", "output": "NO" }, { "input": "H\n6S 7S", "output": "NO" }, { "input": "D\n7S 8S", "output": "NO" }, { "input": "S\n8H 9H", "output": "NO" }, { "input": "C\n9D TD", "output": "NO" }, { "input": "H\nTC JC", "output": "NO" }, { "input": "C\nJH QH", "output": "NO" }, { "input": "H\nQD KD", "output": "NO" }, { "input": "D\nKS AS", "output": "NO" }, { "input": "S\nAH 6H", "output": "YES" }, { "input": "H\n7D 6D", "output": "YES" }, { "input": "S\n8H 7H", "output": "YES" }, { "input": "D\n9S 8S", "output": "YES" }, { "input": "S\nTC 9C", "output": "YES" }, { "input": "H\nJS TS", "output": "YES" }, { "input": "S\nQD JD", "output": "YES" }, { "input": "D\nKH QH", "output": "YES" }, { "input": "H\nAD KD", "output": "YES" }, { "input": "H\nQS QD", "output": "NO" }, { "input": "C\nTS TH", "output": "NO" }, { "input": "C\n6C 6D", "output": "YES" }, { "input": "H\n8H 8D", "output": "YES" }, { "input": "S\n7D 7S", "output": "NO" }, { "input": "H\nJC JH", "output": "NO" }, { "input": "H\n8H 9C", "output": "YES" }, { "input": "D\n9D 6S", "output": "YES" }, { "input": "C\nJC AH", "output": "YES" }, { "input": "S\nAS KD", "output": "YES" }, { "input": "S\n7S JS", "output": "NO" }, { "input": "H\nTH 8H", "output": "YES" }, { "input": "S\n7S QS", "output": "NO" }, { "input": "C\nKC QC", "output": "YES" }, { "input": "S\nAD 9S", "output": "NO" }, { "input": "D\n7H 8D", "output": "NO" }, { "input": "H\nJC 9H", "output": "NO" }, { "input": "C\n7S AC", "output": "NO" }, { "input": "C\n8C 7C", "output": "YES" }, { "input": "H\n9D 8S", "output": "NO" }, { "input": "D\nAC KS", "output": "NO" }, { "input": "H\n8C QH", "output": "NO" }, { "input": "S\n7S TS", "output": "NO" }, { "input": "C\nAH 6S", "output": "NO" }, { "input": "S\nKS QS", "output": "YES" }, { "input": "H\nAC QC", "output": "YES" }, { "input": "S\n9H 8D", "output": "NO" }, { "input": "S\nTS JS", "output": "NO" }, { "input": "S\n8H 7C", "output": "NO" }, { "input": "C\nAH 6S", "output": "NO" }, { "input": "S\n7S QS", "output": "NO" }, { "input": "C\nAH 6S", "output": "NO" }, { "input": "S\nTS KS", "output": "NO" }, { "input": "C\nTH KH", "output": "NO" }, { "input": "H\n9C 6D", "output": "NO" }, { "input": "H\n9C 8D", "output": "NO" }, { "input": "H\nTH AH", "output": "NO" }, { "input": "H\nTH JH", "output": "NO" }, { "input": "H\nQS 9C", "output": "NO" }, { "input": "H\nKC AC", "output": "NO" }, { "input": "H\nAH KH", "output": "YES" }, { "input": "H\nKS QS", "output": "YES" }, { "input": "C\nAD KS", "output": "NO" }, { "input": "H\nQS 9C", "output": "NO" }, { "input": "H\n9D 7S", "output": "NO" }, { "input": "D\n6D 9S", "output": "YES" }, { "input": "H\nAH KH", "output": "YES" }, { "input": "H\nKC AC", "output": "NO" }, { "input": "D\n8S 6C", "output": "NO" }, { "input": "S\nAC KC", "output": "YES" } ]
1,572,876,293
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
8
248
0
x=input() p=["6","7","8","9","T","J","Q","K","A"] a,b=[i for i in input().split()] if a[1]==x: if a[1]!=b[1]: print('YES') elif p.index(a[0])>p.index(b[0]): print('YES') else: print('NO') else: if p.index(a[0])>p.index(b[0]): print('YES') else: print('NO')
Title: Card Game Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: There is a card game called "Durak", which means "Fool" in Russian. The game is quite popular in the countries that used to form USSR. The problem does not state all the game's rules explicitly — you can find them later yourselves if you want. To play durak you need a pack of 36 cards. Each card has a suit ("S", "H", "D" and "C") and a rank (in the increasing order "6", "7", "8", "9", "T", "J", "Q", "K" and "A"). At the beginning of the game one suit is arbitrarily chosen as trump. The players move like that: one player puts one or several of his cards on the table and the other one should beat each of them with his cards. A card beats another one if both cards have similar suits and the first card has a higher rank then the second one. Besides, a trump card can beat any non-trump card whatever the cards’ ranks are. In all other cases you can not beat the second card with the first one. You are given the trump suit and two different cards. Determine whether the first one beats the second one or not. Input Specification: The first line contains the tramp suit. It is "S", "H", "D" or "C". The second line contains the description of the two different cards. Each card is described by one word consisting of two symbols. The first symbol stands for the rank ("6", "7", "8", "9", "T", "J", "Q", "K" and "A"), and the second one stands for the suit ("S", "H", "D" and "C"). Output Specification: Print "YES" (without the quotes) if the first cards beats the second one. Otherwise, print "NO" (also without the quotes). Demo Input: ['H\nQH 9S\n', 'S\n8D 6D\n', 'C\n7H AS\n'] Demo Output: ['YES\n', 'YES', 'NO'] Note: none
```python x=input() p=["6","7","8","9","T","J","Q","K","A"] a,b=[i for i in input().split()] if a[1]==x: if a[1]!=b[1]: print('YES') elif p.index(a[0])>p.index(b[0]): print('YES') else: print('NO') else: if p.index(a[0])>p.index(b[0]): print('YES') else: print('NO') ```
0
633
A
Ebony and Ivory
PROGRAMMING
1,100
[ "brute force", "math", "number theory" ]
null
null
Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots. For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible.
The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively.
Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise.
[ "4 6 15\n", "3 2 7\n", "6 11 6\n" ]
[ "No\n", "Yes\n", "Yes\n" ]
In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage.
250
[ { "input": "4 6 15", "output": "No" }, { "input": "3 2 7", "output": "Yes" }, { "input": "6 11 6", "output": "Yes" }, { "input": "3 12 15", "output": "Yes" }, { "input": "5 5 10", "output": "Yes" }, { "input": "6 6 7", "output": "No" }, { "input": "1 1 20", "output": "Yes" }, { "input": "12 14 19", "output": "No" }, { "input": "15 12 26", "output": "No" }, { "input": "2 4 8", "output": "Yes" }, { "input": "4 5 30", "output": "Yes" }, { "input": "4 5 48", "output": "Yes" }, { "input": "2 17 105", "output": "Yes" }, { "input": "10 25 282", "output": "No" }, { "input": "6 34 323", "output": "No" }, { "input": "2 47 464", "output": "Yes" }, { "input": "4 53 113", "output": "Yes" }, { "input": "6 64 546", "output": "Yes" }, { "input": "1 78 725", "output": "Yes" }, { "input": "1 84 811", "output": "Yes" }, { "input": "3 100 441", "output": "Yes" }, { "input": "20 5 57", "output": "No" }, { "input": "14 19 143", "output": "No" }, { "input": "17 23 248", "output": "No" }, { "input": "11 34 383", "output": "Yes" }, { "input": "20 47 568", "output": "Yes" }, { "input": "16 58 410", "output": "Yes" }, { "input": "11 70 1199", "output": "Yes" }, { "input": "16 78 712", "output": "Yes" }, { "input": "20 84 562", "output": "No" }, { "input": "19 100 836", "output": "Yes" }, { "input": "23 10 58", "output": "No" }, { "input": "25 17 448", "output": "Yes" }, { "input": "22 24 866", "output": "Yes" }, { "input": "24 35 67", "output": "No" }, { "input": "29 47 264", "output": "Yes" }, { "input": "23 56 45", "output": "No" }, { "input": "25 66 1183", "output": "Yes" }, { "input": "21 71 657", "output": "Yes" }, { "input": "29 81 629", "output": "No" }, { "input": "23 95 2226", "output": "Yes" }, { "input": "32 4 62", "output": "No" }, { "input": "37 15 789", "output": "Yes" }, { "input": "39 24 999", "output": "Yes" }, { "input": "38 32 865", "output": "No" }, { "input": "32 50 205", "output": "No" }, { "input": "31 57 1362", "output": "Yes" }, { "input": "38 68 1870", "output": "Yes" }, { "input": "36 76 549", "output": "No" }, { "input": "35 84 1257", "output": "No" }, { "input": "39 92 2753", "output": "Yes" }, { "input": "44 1 287", "output": "Yes" }, { "input": "42 12 830", "output": "No" }, { "input": "42 27 9", "output": "No" }, { "input": "49 40 1422", "output": "No" }, { "input": "44 42 2005", "output": "No" }, { "input": "50 55 2479", "output": "No" }, { "input": "48 65 917", "output": "No" }, { "input": "45 78 152", "output": "No" }, { "input": "43 90 4096", "output": "Yes" }, { "input": "43 94 4316", "output": "Yes" }, { "input": "60 7 526", "output": "Yes" }, { "input": "53 11 735", "output": "Yes" }, { "input": "52 27 609", "output": "Yes" }, { "input": "57 32 992", "output": "Yes" }, { "input": "52 49 421", "output": "No" }, { "input": "57 52 2634", "output": "Yes" }, { "input": "54 67 3181", "output": "Yes" }, { "input": "52 73 638", "output": "No" }, { "input": "57 84 3470", "output": "No" }, { "input": "52 100 5582", "output": "No" }, { "input": "62 1 501", "output": "Yes" }, { "input": "63 17 858", "output": "Yes" }, { "input": "70 24 1784", "output": "Yes" }, { "input": "65 32 1391", "output": "Yes" }, { "input": "62 50 2775", "output": "No" }, { "input": "62 58 88", "output": "No" }, { "input": "66 68 3112", "output": "Yes" }, { "input": "61 71 1643", "output": "No" }, { "input": "69 81 3880", "output": "No" }, { "input": "63 100 1960", "output": "Yes" }, { "input": "73 6 431", "output": "Yes" }, { "input": "75 19 736", "output": "Yes" }, { "input": "78 25 247", "output": "No" }, { "input": "79 36 2854", "output": "Yes" }, { "input": "80 43 1864", "output": "Yes" }, { "input": "76 55 2196", "output": "Yes" }, { "input": "76 69 4122", "output": "Yes" }, { "input": "76 76 4905", "output": "No" }, { "input": "75 89 3056", "output": "Yes" }, { "input": "73 100 3111", "output": "Yes" }, { "input": "84 9 530", "output": "No" }, { "input": "82 18 633", "output": "No" }, { "input": "85 29 2533", "output": "Yes" }, { "input": "89 38 2879", "output": "Yes" }, { "input": "89 49 2200", "output": "Yes" }, { "input": "88 60 4140", "output": "Yes" }, { "input": "82 68 1299", "output": "No" }, { "input": "90 76 2207", "output": "No" }, { "input": "83 84 4923", "output": "Yes" }, { "input": "89 99 7969", "output": "Yes" }, { "input": "94 9 168", "output": "No" }, { "input": "91 20 1009", "output": "No" }, { "input": "93 23 2872", "output": "Yes" }, { "input": "97 31 3761", "output": "Yes" }, { "input": "99 46 1341", "output": "Yes" }, { "input": "98 51 2845", "output": "No" }, { "input": "93 66 3412", "output": "No" }, { "input": "95 76 3724", "output": "Yes" }, { "input": "91 87 6237", "output": "Yes" }, { "input": "98 97 7886", "output": "Yes" }, { "input": "12 17 15", "output": "No" }, { "input": "93 94 95", "output": "No" }, { "input": "27 43 27", "output": "Yes" }, { "input": "17 43 68", "output": "Yes" }, { "input": "44 12 12", "output": "Yes" }, { "input": "44 50 150", "output": "Yes" }, { "input": "1 1 10000", "output": "Yes" }, { "input": "2 3 10000", "output": "Yes" }, { "input": "100 1 10", "output": "Yes" }, { "input": "3 2 1", "output": "No" }, { "input": "1 1 1", "output": "Yes" }, { "input": "9 9 10000", "output": "No" }, { "input": "2 3 9995", "output": "Yes" }, { "input": "3 5 4", "output": "No" }, { "input": "99 98 100", "output": "No" }, { "input": "6 10 2", "output": "No" }, { "input": "1 6 5", "output": "Yes" }, { "input": "1 4 3", "output": "Yes" }, { "input": "3 2 3", "output": "Yes" }, { "input": "1 7 6", "output": "Yes" }, { "input": "2 3 9871", "output": "Yes" }, { "input": "10 5 5", "output": "Yes" }, { "input": "10 8 2", "output": "No" } ]
1,578,428,960
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
22
155
0
from math import gcd a, b, c = map(int, input().split()) if not(c%gcd(a, b)): print("YES") else: print("NO")
Title: Ebony and Ivory Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots. For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible. Input Specification: The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively. Output Specification: Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise. Demo Input: ['4 6 15\n', '3 2 7\n', '6 11 6\n'] Demo Output: ['No\n', 'Yes\n', 'Yes\n'] Note: In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage.
```python from math import gcd a, b, c = map(int, input().split()) if not(c%gcd(a, b)): print("YES") else: print("NO") ```
0
716
A
Crazy Computer
PROGRAMMING
800
[ "implementation" ]
null
null
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
[ "6 5\n1 3 8 14 19 20\n", "6 1\n1 3 5 7 9 10\n" ]
[ "3", "2" ]
The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
500
[ { "input": "6 5\n1 3 8 14 19 20", "output": "3" }, { "input": "6 1\n1 3 5 7 9 10", "output": "2" }, { "input": "1 1\n1000000000", "output": "1" }, { "input": "5 5\n1 7 12 13 14", "output": "4" }, { "input": "2 1000000000\n1 1000000000", "output": "2" }, { "input": "3 5\n1 10 20", "output": "1" }, { "input": "3 10\n1 2 3", "output": "3" }, { "input": "2 1\n1 100", "output": "1" }, { "input": "3 1\n1 2 10", "output": "1" }, { "input": "2 1\n1 2", "output": "2" } ]
1,591,019,515
2,147,483,647
PyPy 3
OK
TESTS
81
280
10,752,000
n, c = map(int, input().split()) l = list(map(int, input().split())) ws = 0 for i in range(n-1): if l[i+1] - l[i] <= c: ws += 1 else: ws = 0 print(ws+1)
Title: Crazy Computer Time Limit: None seconds Memory Limit: None megabytes Problem Description: ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear! More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=&gt;<=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen. For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen. You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything. Input Specification: The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively. The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=&lt;<=*t*2<=&lt;<=...<=&lt;<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word. Output Specification: Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*. Demo Input: ['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n'] Demo Output: ['3', '2'] Note: The first sample is already explained in the problem statement. For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 &gt; 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
```python n, c = map(int, input().split()) l = list(map(int, input().split())) ws = 0 for i in range(n-1): if l[i+1] - l[i] <= c: ws += 1 else: ws = 0 print(ws+1) ```
3
17
A
Noldbach problem
PROGRAMMING
1,000
[ "brute force", "math", "number theory" ]
A. Noldbach problem
2
64
Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1. Two prime numbers are called neighboring if there are no other prime numbers between them. You are to help Nick, and find out if he is right or wrong.
The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000).
Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO.
[ "27 2\n", "45 7\n" ]
[ "YES", "NO" ]
In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
0
[ { "input": "27 2", "output": "YES" }, { "input": "45 7", "output": "NO" }, { "input": "2 0", "output": "YES" }, { "input": "15 1", "output": "YES" }, { "input": "17 1", "output": "YES" }, { "input": "34 5", "output": "NO" }, { "input": "37 4", "output": "YES" }, { "input": "43 5", "output": "YES" }, { "input": "47 7", "output": "NO" }, { "input": "50 5", "output": "YES" }, { "input": "57 6", "output": "YES" }, { "input": "60 8", "output": "NO" }, { "input": "62 7", "output": "YES" }, { "input": "76 9", "output": "NO" }, { "input": "69 7", "output": "YES" }, { "input": "113 10", "output": "YES" }, { "input": "141 11", "output": "YES" }, { "input": "207 16", "output": "NO" }, { "input": "231 18", "output": "NO" }, { "input": "296 19", "output": "YES" }, { "input": "332 20", "output": "YES" }, { "input": "378 24", "output": "NO" }, { "input": "428 23", "output": "YES" }, { "input": "497 27", "output": "NO" }, { "input": "640 32", "output": "YES" }, { "input": "798 35", "output": "YES" }, { "input": "802 35", "output": "YES" }, { "input": "864 40", "output": "NO" }, { "input": "953 44", "output": "NO" }, { "input": "995 44", "output": "YES" }, { "input": "1000 44", "output": "YES" }, { "input": "1000 0", "output": "YES" }, { "input": "1000 1000", "output": "NO" }, { "input": "2 1000", "output": "NO" }, { "input": "2 0", "output": "YES" } ]
1,572,933,501
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
218
0
def isPrime(n): for i in range(2, n // 2 + 1): if n % i == 0: return False return True X, PrimeNumbers = list(map(int, input().split())), [2, 3] for i in range(4, X[0] + 1): if isPrime(i): PrimeNumbers.append(i) for index in range(0, len(PrimeNumbers) - 1): if PrimeNumbers[index] + PrimeNumbers[index + 1] + 1 == i: X[1] -= 1 if X[1] == 0: print("YES") exit() break print("NO")
Title: Noldbach problem Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1. Two prime numbers are called neighboring if there are no other prime numbers between them. You are to help Nick, and find out if he is right or wrong. Input Specification: The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000). Output Specification: Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO. Demo Input: ['27 2\n', '45 7\n'] Demo Output: ['YES', 'NO'] Note: In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
```python def isPrime(n): for i in range(2, n // 2 + 1): if n % i == 0: return False return True X, PrimeNumbers = list(map(int, input().split())), [2, 3] for i in range(4, X[0] + 1): if isPrime(i): PrimeNumbers.append(i) for index in range(0, len(PrimeNumbers) - 1): if PrimeNumbers[index] + PrimeNumbers[index + 1] + 1 == i: X[1] -= 1 if X[1] == 0: print("YES") exit() break print("NO") ```
0
455
A
Boredom
PROGRAMMING
1,500
[ "dp" ]
null
null
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it. Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player. Alex is a perfectionist, so he decided to get as many points as possible. Help him.
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Print a single integer — the maximum number of points that Alex can earn.
[ "2\n1 2\n", "3\n1 2 3\n", "9\n1 2 1 3 2 2 2 2 3\n" ]
[ "2\n", "4\n", "10\n" ]
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
500
[ { "input": "2\n1 2", "output": "2" }, { "input": "3\n1 2 3", "output": "4" }, { "input": "9\n1 2 1 3 2 2 2 2 3", "output": "10" }, { "input": "5\n3 3 4 5 4", "output": "11" }, { "input": "5\n5 3 5 3 4", "output": "16" }, { "input": "5\n4 2 3 2 5", "output": "9" }, { "input": "10\n10 5 8 9 5 6 8 7 2 8", "output": "46" }, { "input": "10\n1 1 1 1 1 1 2 3 4 4", "output": "14" }, { "input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4", "output": "296" }, { "input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2", "output": "313" }, { "input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9", "output": "298" }, { "input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5", "output": "312" }, { "input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2", "output": "287" }, { "input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8", "output": "380" }, { "input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8", "output": "380" }, { "input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2", "output": "265" }, { "input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9", "output": "328" }, { "input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9", "output": "324" }, { "input": "10\n7 4 5 3 9 1 10 3 4 5", "output": "34" }, { "input": "10\n8 9 6 5 6 4 10 9 1 4", "output": "39" }, { "input": "10\n1 7 1 4 9 10 8 2 9 9", "output": "40" }, { "input": "1\n100000", "output": "100000" } ]
1,699,365,643
2,147,483,647
PyPy 3-64
OK
TESTS
47
93
14,336,000
n = int(input()) sequence = list(map(int, input().split())) count = [0] * 100001 for num in sequence: count[num] += 1 prev_key = None prev_points = 0 current_points = 0 for key in range(1, 100001): if count[key] > 0: if prev_key is not None and key - prev_key == 1: current_points, prev_points = max(current_points, prev_points + count[key] * key), current_points else: current_points, prev_points = max(current_points + count[key] * key, prev_points), current_points prev_key = key print(current_points)
Title: Boredom Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it. Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player. Alex is a perfectionist, so he decided to get as many points as possible. Help him. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence. The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). Output Specification: Print a single integer — the maximum number of points that Alex can earn. Demo Input: ['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n'] Demo Output: ['2\n', '4\n', '10\n'] Note: Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points.
```python n = int(input()) sequence = list(map(int, input().split())) count = [0] * 100001 for num in sequence: count[num] += 1 prev_key = None prev_points = 0 current_points = 0 for key in range(1, 100001): if count[key] > 0: if prev_key is not None and key - prev_key == 1: current_points, prev_points = max(current_points, prev_points + count[key] * key), current_points else: current_points, prev_points = max(current_points + count[key] * key, prev_points), current_points prev_key = key print(current_points) ```
3
34
B
Sale
PROGRAMMING
900
[ "greedy", "sortings" ]
B. Sale
2
256
Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn.
The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets.
Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets.
[ "5 3\n-6 0 35 -2 4\n", "4 2\n7 0 0 -7\n" ]
[ "8\n", "7\n" ]
none
1,000
[ { "input": "5 3\n-6 0 35 -2 4", "output": "8" }, { "input": "4 2\n7 0 0 -7", "output": "7" }, { "input": "6 6\n756 -611 251 -66 572 -818", "output": "1495" }, { "input": "5 5\n976 437 937 788 518", "output": "0" }, { "input": "5 3\n-2 -2 -2 -2 -2", "output": "6" }, { "input": "5 1\n998 997 985 937 998", "output": "0" }, { "input": "2 2\n-742 -187", "output": "929" }, { "input": "3 3\n522 597 384", "output": "0" }, { "input": "4 2\n-215 -620 192 647", "output": "835" }, { "input": "10 6\n557 605 685 231 910 633 130 838 -564 -85", "output": "649" }, { "input": "20 14\n932 442 960 943 624 624 955 998 631 910 850 517 715 123 1000 155 -10 961 966 59", "output": "10" }, { "input": "30 5\n991 997 996 967 977 999 991 986 1000 965 984 997 998 1000 958 983 974 1000 991 999 1000 978 961 992 990 998 998 978 998 1000", "output": "0" }, { "input": "50 20\n-815 -947 -946 -993 -992 -846 -884 -954 -963 -733 -940 -746 -766 -930 -821 -937 -937 -999 -914 -938 -936 -975 -939 -981 -977 -952 -925 -901 -952 -978 -994 -957 -946 -896 -905 -836 -994 -951 -887 -939 -859 -953 -985 -988 -946 -829 -956 -842 -799 -886", "output": "19441" }, { "input": "88 64\n999 999 1000 1000 999 996 995 1000 1000 999 1000 997 998 1000 999 1000 997 1000 993 998 994 999 998 996 1000 997 1000 1000 1000 997 1000 998 997 1000 1000 998 1000 998 999 1000 996 999 999 999 996 995 999 1000 998 999 1000 999 999 1000 1000 1000 996 1000 1000 1000 997 1000 1000 997 999 1000 1000 1000 1000 1000 999 999 1000 1000 996 999 1000 1000 995 999 1000 996 1000 998 999 999 1000 999", "output": "0" }, { "input": "99 17\n-993 -994 -959 -989 -991 -995 -976 -997 -990 -1000 -996 -994 -999 -995 -1000 -983 -979 -1000 -989 -968 -994 -992 -962 -993 -999 -983 -991 -979 -995 -993 -973 -999 -995 -995 -999 -993 -995 -992 -947 -1000 -999 -998 -982 -988 -979 -993 -963 -988 -980 -990 -979 -976 -995 -999 -981 -988 -998 -999 -970 -1000 -983 -994 -943 -975 -998 -977 -973 -997 -959 -999 -983 -985 -950 -977 -977 -991 -998 -973 -987 -985 -985 -986 -984 -994 -978 -998 -989 -989 -988 -970 -985 -974 -997 -981 -962 -972 -995 -988 -993", "output": "16984" }, { "input": "100 37\n205 19 -501 404 912 -435 -322 -469 -655 880 -804 -470 793 312 -108 586 -642 -928 906 605 -353 -800 745 -440 -207 752 -50 -28 498 -800 -62 -195 602 -833 489 352 536 404 -775 23 145 -512 524 759 651 -461 -427 -557 684 -366 62 592 -563 -811 64 418 -881 -308 591 -318 -145 -261 -321 -216 -18 595 -202 960 -4 219 226 -238 -882 -963 425 970 -434 -160 243 -672 -4 873 8 -633 904 -298 -151 -377 -61 -72 -677 -66 197 -716 3 -870 -30 152 -469 981", "output": "21743" }, { "input": "100 99\n-931 -806 -830 -828 -916 -962 -660 -867 -952 -966 -820 -906 -724 -982 -680 -717 -488 -741 -897 -613 -986 -797 -964 -939 -808 -932 -810 -860 -641 -916 -858 -628 -821 -929 -917 -976 -664 -985 -778 -665 -624 -928 -940 -958 -884 -757 -878 -896 -634 -526 -514 -873 -990 -919 -988 -878 -650 -973 -774 -783 -733 -648 -756 -895 -833 -974 -832 -725 -841 -748 -806 -613 -924 -867 -881 -943 -864 -991 -809 -926 -777 -817 -998 -682 -910 -996 -241 -722 -964 -904 -821 -920 -835 -699 -805 -632 -779 -317 -915 -654", "output": "81283" }, { "input": "100 14\n995 994 745 684 510 737 984 690 979 977 542 933 871 603 758 653 962 997 747 974 773 766 975 770 527 960 841 989 963 865 974 967 950 984 757 685 986 809 982 959 931 880 978 867 805 562 970 900 834 782 616 885 910 608 974 918 576 700 871 980 656 941 978 759 767 840 573 859 841 928 693 853 716 927 976 851 962 962 627 797 707 873 869 988 993 533 665 887 962 880 929 980 877 887 572 790 721 883 848 782", "output": "0" }, { "input": "100 84\n768 946 998 752 931 912 826 1000 991 910 875 962 901 952 958 733 959 908 872 840 923 826 952 980 974 980 947 955 959 822 997 963 966 933 829 923 971 999 926 932 865 984 974 858 994 855 949 941 992 861 951 949 991 711 763 728 935 485 716 907 869 952 960 859 909 963 978 942 968 933 923 909 997 962 687 764 924 774 875 1000 961 951 987 974 848 921 966 859 995 997 974 931 886 941 974 986 906 978 998 823", "output": "0" }, { "input": "100 80\n-795 -994 -833 -930 -974 -980 -950 -940 -788 -927 -583 -956 -945 -949 -809 -974 -957 -736 -967 -908 -975 -961 -986 -983 -963 -771 -952 -847 -751 -741 -982 -959 -925 -931 -839 -937 -880 -914 -858 -998 -812 -911 -862 -965 -943 -984 -738 -920 -950 -998 -909 -998 -781 -901 -677 -940 -985 -951 -675 -952 -967 -949 -882 -641 -969 -937 -975 -993 -913 -941 -807 -851 -832 -960 -939 -943 -895 -929 -528 -880 -823 -930 -888 -862 -948 -966 -962 -857 -799 -969 -833 -998 -952 -878 -946 -971 -976 -974 -723 -992", "output": "75068" }, { "input": "1 1\n0", "output": "0" }, { "input": "1 1\n1", "output": "0" }, { "input": "1 1\n555", "output": "0" }, { "input": "1 1\n-1", "output": "1" }, { "input": "1 1\n-24", "output": "24" } ]
1,687,195,666
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
62
0
n,m=map(int,input().split()) a=list(map(int,input().split())) l=[] for i in range (m): l.append(min(a)) a.remove(min(a)) print(abs(sum(l)))
Title: Sale Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Once Bob got to a sale of old TV sets. There were *n* TV sets at that sale. TV set with index *i* costs *a**i* bellars. Some TV sets have a negative price — their owners are ready to pay Bob if he buys their useless apparatus. Bob can «buy» any TV sets he wants. Though he's very strong, Bob can carry at most *m* TV sets, and he has no desire to go to the sale for the second time. Please, help Bob find out the maximum sum of money that he can earn. Input Specification: The first line contains two space-separated integers *n* and *m* (1<=≤<=*m*<=≤<=*n*<=≤<=100) — amount of TV sets at the sale, and amount of TV sets that Bob can carry. The following line contains *n* space-separated integers *a**i* (<=-<=1000<=≤<=*a**i*<=≤<=1000) — prices of the TV sets. Output Specification: Output the only number — the maximum sum of money that Bob can earn, given that he can carry at most *m* TV sets. Demo Input: ['5 3\n-6 0 35 -2 4\n', '4 2\n7 0 0 -7\n'] Demo Output: ['8\n', '7\n'] Note: none
```python n,m=map(int,input().split()) a=list(map(int,input().split())) l=[] for i in range (m): l.append(min(a)) a.remove(min(a)) print(abs(sum(l))) ```
0
177
D1
Encrypting Messages
PROGRAMMING
1,200
[ "brute force" ]
null
null
The Smart Beaver from ABBYY invented a new message encryption method and now wants to check its performance. Checking it manually is long and tiresome, so he decided to ask the ABBYY Cup contestants for help. A message is a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Encryption uses a key which is a sequence of *m* integers *b*1,<=*b*2,<=...,<=*b**m* (*m*<=≤<=*n*). All numbers from the message and from the key belong to the interval from 0 to *c*<=-<=1, inclusive, and all the calculations are performed modulo *c*. Encryption is performed in *n*<=-<=*m*<=+<=1 steps. On the first step we add to each number *a*1,<=*a*2,<=...,<=*a**m* a corresponding number *b*1,<=*b*2,<=...,<=*b**m*. On the second step we add to each number *a*2,<=*a*3,<=...,<=*a**m*<=+<=1 (changed on the previous step) a corresponding number *b*1,<=*b*2,<=...,<=*b**m*. And so on: on step number *i* we add to each number *a**i*,<=*a**i*<=+<=1,<=...,<=*a**i*<=+<=*m*<=-<=1 a corresponding number *b*1,<=*b*2,<=...,<=*b**m*. The result of the encryption is the sequence *a*1,<=*a*2,<=...,<=*a**n* after *n*<=-<=*m*<=+<=1 steps. Help the Beaver to write a program that will encrypt messages in the described manner.
The first input line contains three integers *n*, *m* and *c*, separated by single spaces. The second input line contains *n* integers *a**i* (0<=≤<=*a**i*<=&lt;<=*c*), separated by single spaces — the original message. The third input line contains *m* integers *b**i* (0<=≤<=*b**i*<=&lt;<=*c*), separated by single spaces — the encryption key. The input limitations for getting 30 points are: - 1<=≤<=*m*<=≤<=*n*<=≤<=103 - 1<=≤<=*c*<=≤<=103 The input limitations for getting 100 points are: - 1<=≤<=*m*<=≤<=*n*<=≤<=105 - 1<=≤<=*c*<=≤<=103
Print *n* space-separated integers — the result of encrypting the original message.
[ "4 3 2\n1 1 1 1\n1 1 1\n", "3 1 5\n1 2 3\n4\n" ]
[ "0 1 1 0\n", "0 1 2\n" ]
In the first sample the encryption is performed in two steps: after the first step *a* = (0, 0, 0, 1) (remember that the calculations are performed modulo 2), after the second step *a* = (0, 1, 1, 0), and that is the answer.
30
[ { "input": "4 3 2\n1 1 1 1\n1 1 1", "output": "0 1 1 0" }, { "input": "3 1 5\n1 2 3\n4", "output": "0 1 2" }, { "input": "5 2 7\n0 0 1 2 4\n3 5", "output": "3 1 2 3 2" }, { "input": "20 15 17\n4 9 14 11 15 16 15 4 0 10 7 12 10 1 8 6 7 14 1 13\n6 3 14 8 8 11 16 4 5 9 2 13 6 14 15", "output": "10 1 3 8 3 15 7 14 1 12 3 10 15 16 16 5 4 15 13 11" }, { "input": "80 6 99\n48 97 9 77 73 21 86 78 48 5 71 16 42 67 90 27 30 52 41 86 53 4 60 17 66 38 94 46 51 51 70 11 1 16 74 53 17 12 82 95 51 33 83 70 45 27 90 57 67 2 68 15 20 61 47 90 11 5 95 33 69 35 79 51 95 45 10 17 12 88 93 43 31 31 85 68 85 81 70 43\n47 92 59 85 73 38", "output": "95 38 9 63 33 19 84 76 46 3 69 14 40 65 88 25 28 50 39 84 51 2 58 15 64 36 92 44 49 49 68 9 98 14 72 51 15 10 80 93 49 31 81 68 43 25 88 55 65 0 66 13 18 59 45 88 9 3 93 31 67 33 77 49 93 43 8 15 10 86 91 41 29 29 83 19 43 79 82 81" } ]
1,614,456,798
2,147,483,647
PyPy 3
OK
TESTS1
12
216
2,048,000
n,m,c=list(map(int,input().split())) a=list(map(int,input().split())) b=list(map(int,input().split())) for i in range(n-m+1): for j in range(m): a[j+i]+=b[j] a[j+i]%=c print(*a)
Title: Encrypting Messages Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Smart Beaver from ABBYY invented a new message encryption method and now wants to check its performance. Checking it manually is long and tiresome, so he decided to ask the ABBYY Cup contestants for help. A message is a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Encryption uses a key which is a sequence of *m* integers *b*1,<=*b*2,<=...,<=*b**m* (*m*<=≤<=*n*). All numbers from the message and from the key belong to the interval from 0 to *c*<=-<=1, inclusive, and all the calculations are performed modulo *c*. Encryption is performed in *n*<=-<=*m*<=+<=1 steps. On the first step we add to each number *a*1,<=*a*2,<=...,<=*a**m* a corresponding number *b*1,<=*b*2,<=...,<=*b**m*. On the second step we add to each number *a*2,<=*a*3,<=...,<=*a**m*<=+<=1 (changed on the previous step) a corresponding number *b*1,<=*b*2,<=...,<=*b**m*. And so on: on step number *i* we add to each number *a**i*,<=*a**i*<=+<=1,<=...,<=*a**i*<=+<=*m*<=-<=1 a corresponding number *b*1,<=*b*2,<=...,<=*b**m*. The result of the encryption is the sequence *a*1,<=*a*2,<=...,<=*a**n* after *n*<=-<=*m*<=+<=1 steps. Help the Beaver to write a program that will encrypt messages in the described manner. Input Specification: The first input line contains three integers *n*, *m* and *c*, separated by single spaces. The second input line contains *n* integers *a**i* (0<=≤<=*a**i*<=&lt;<=*c*), separated by single spaces — the original message. The third input line contains *m* integers *b**i* (0<=≤<=*b**i*<=&lt;<=*c*), separated by single spaces — the encryption key. The input limitations for getting 30 points are: - 1<=≤<=*m*<=≤<=*n*<=≤<=103 - 1<=≤<=*c*<=≤<=103 The input limitations for getting 100 points are: - 1<=≤<=*m*<=≤<=*n*<=≤<=105 - 1<=≤<=*c*<=≤<=103 Output Specification: Print *n* space-separated integers — the result of encrypting the original message. Demo Input: ['4 3 2\n1 1 1 1\n1 1 1\n', '3 1 5\n1 2 3\n4\n'] Demo Output: ['0 1 1 0\n', '0 1 2\n'] Note: In the first sample the encryption is performed in two steps: after the first step *a* = (0, 0, 0, 1) (remember that the calculations are performed modulo 2), after the second step *a* = (0, 1, 1, 0), and that is the answer.
```python n,m,c=list(map(int,input().split())) a=list(map(int,input().split())) b=list(map(int,input().split())) for i in range(n-m+1): for j in range(m): a[j+i]+=b[j] a[j+i]%=c print(*a) ```
3
981
B
Businessmen Problems
PROGRAMMING
1,000
[ "sortings" ]
null
null
Two famous competing companies ChemForces and TopChemist decided to show their sets of recently discovered chemical elements on an exhibition. However they know that no element should be present in the sets of both companies. In order to avoid this representatives of both companies decided to make an agreement on the sets the companies should present. The sets should be chosen in the way that maximizes the total income of the companies. All elements are enumerated with integers. The ChemForces company has discovered $n$ distinct chemical elements with indices $a_1, a_2, \ldots, a_n$, and will get an income of $x_i$ Berland rubles if the $i$-th element from this list is in the set of this company. The TopChemist company discovered $m$ distinct chemical elements with indices $b_1, b_2, \ldots, b_m$, and it will get an income of $y_j$ Berland rubles for including the $j$-th element from this list to its set. In other words, the first company can present any subset of elements from $\{a_1, a_2, \ldots, a_n\}$ (possibly empty subset), the second company can present any subset of elements from $\{b_1, b_2, \ldots, b_m\}$ (possibly empty subset). There shouldn't be equal elements in the subsets. Help the representatives select the sets in such a way that no element is presented in both sets and the total income is the maximum possible.
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$)  — the number of elements discovered by ChemForces. The $i$-th of the next $n$ lines contains two integers $a_i$ and $x_i$ ($1 \leq a_i \leq 10^9$, $1 \leq x_i \leq 10^9$)  — the index of the $i$-th element and the income of its usage on the exhibition. It is guaranteed that all $a_i$ are distinct. The next line contains a single integer $m$ ($1 \leq m \leq 10^5$)  — the number of chemicals invented by TopChemist. The $j$-th of the next $m$ lines contains two integers $b_j$ and $y_j$, ($1 \leq b_j \leq 10^9$, $1 \leq y_j \leq 10^9$)  — the index of the $j$-th element and the income of its usage on the exhibition. It is guaranteed that all $b_j$ are distinct.
Print the maximum total income you can obtain by choosing the sets for both companies in such a way that no element is presented in both sets.
[ "3\n1 2\n7 2\n3 10\n4\n1 4\n2 4\n3 4\n4 4\n", "1\n1000000000 239\n3\n14 15\n92 65\n35 89\n" ]
[ "24\n", "408\n" ]
In the first example ChemForces can choose the set ($3, 7$), while TopChemist can choose ($1, 2, 4$). This way the total income is $(10 + 2) + (4 + 4 + 4) = 24$. In the second example ChemForces can choose the only element $10^9$, while TopChemist can choose ($14, 92, 35$). This way the total income is $(239) + (15 + 65 + 89) = 408$.
750
[ { "input": "3\n1 2\n7 2\n3 10\n4\n1 4\n2 4\n3 4\n4 4", "output": "24" }, { "input": "1\n1000000000 239\n3\n14 15\n92 65\n35 89", "output": "408" }, { "input": "10\n598654597 488228616\n544064902 21923894\n329635457 980089248\n988262691 654502493\n967529230 543358150\n835120075 128123793\n809901567 613170206\n152157661 479980560\n859252956 318029856\n614959273 735298093\n10\n849172317 361325206\n341655282 740807372\n453949939 809030434\n813199219 765838311\n725032511 427644854\n631233366 115983627\n825067417 721190169\n463026366 953335259\n881501578 987288937\n500099903 427659916", "output": "11272808994" }, { "input": "10\n598654597 488228616\n544064902 21923894\n329635457 980089248\n988262691 654502493\n967529230 543358150\n835120075 128123793\n809901567 613170206\n152157661 479980560\n859252956 318029856\n614959273 735298093\n10\n544064902 740807372\n859252956 765838311\n835120075 115983627\n825067417 463026366\n809901567 500099903\n614959273 322932832\n33955432 657532637\n816892960 927933923\n916770606 754371712\n967529230 566149252", "output": "8955052582" }, { "input": "1\n259021863 682413763\n1\n554146726 693647287", "output": "1376061050" }, { "input": "1\n259021863 682413763\n1\n554146726 425883728", "output": "1108297491" }, { "input": "1\n1000000000 1\n1\n1000000000 1000000000", "output": "1000000000" }, { "input": "2\n1 4\n2 4\n2\n1 4\n2 4", "output": "8" }, { "input": "1\n14 15\n3\n35 89\n92 65\n1000000000 239", "output": "408" } ]
1,527,434,998
2,398
Python 3
RUNTIME_ERROR
PRETESTS
0
77
0
n=int(input()) m=int(input()) i1={} i2={} sum=0 for i in range(n): index1_ele=int(input()) cost1_ele=int(input()) i1[index1_ele]=cost1_ele for j in range(m): index2_ele=int(input()) cost2_ele=int(input()) i2[index2_ele]=cost2_ele for key in i1 : if key in i2 : if i1[key]>i2[key]: sum +=i1[key] else : sum +=i2[key] i2[key]=0 i1[key]=0 else : sum +=i1[key] for key2 in i2 : sum += i2[key] print (sum)
Title: Businessmen Problems Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two famous competing companies ChemForces and TopChemist decided to show their sets of recently discovered chemical elements on an exhibition. However they know that no element should be present in the sets of both companies. In order to avoid this representatives of both companies decided to make an agreement on the sets the companies should present. The sets should be chosen in the way that maximizes the total income of the companies. All elements are enumerated with integers. The ChemForces company has discovered $n$ distinct chemical elements with indices $a_1, a_2, \ldots, a_n$, and will get an income of $x_i$ Berland rubles if the $i$-th element from this list is in the set of this company. The TopChemist company discovered $m$ distinct chemical elements with indices $b_1, b_2, \ldots, b_m$, and it will get an income of $y_j$ Berland rubles for including the $j$-th element from this list to its set. In other words, the first company can present any subset of elements from $\{a_1, a_2, \ldots, a_n\}$ (possibly empty subset), the second company can present any subset of elements from $\{b_1, b_2, \ldots, b_m\}$ (possibly empty subset). There shouldn't be equal elements in the subsets. Help the representatives select the sets in such a way that no element is presented in both sets and the total income is the maximum possible. Input Specification: The first line contains a single integer $n$ ($1 \leq n \leq 10^5$)  — the number of elements discovered by ChemForces. The $i$-th of the next $n$ lines contains two integers $a_i$ and $x_i$ ($1 \leq a_i \leq 10^9$, $1 \leq x_i \leq 10^9$)  — the index of the $i$-th element and the income of its usage on the exhibition. It is guaranteed that all $a_i$ are distinct. The next line contains a single integer $m$ ($1 \leq m \leq 10^5$)  — the number of chemicals invented by TopChemist. The $j$-th of the next $m$ lines contains two integers $b_j$ and $y_j$, ($1 \leq b_j \leq 10^9$, $1 \leq y_j \leq 10^9$)  — the index of the $j$-th element and the income of its usage on the exhibition. It is guaranteed that all $b_j$ are distinct. Output Specification: Print the maximum total income you can obtain by choosing the sets for both companies in such a way that no element is presented in both sets. Demo Input: ['3\n1 2\n7 2\n3 10\n4\n1 4\n2 4\n3 4\n4 4\n', '1\n1000000000 239\n3\n14 15\n92 65\n35 89\n'] Demo Output: ['24\n', '408\n'] Note: In the first example ChemForces can choose the set ($3, 7$), while TopChemist can choose ($1, 2, 4$). This way the total income is $(10 + 2) + (4 + 4 + 4) = 24$. In the second example ChemForces can choose the only element $10^9$, while TopChemist can choose ($14, 92, 35$). This way the total income is $(239) + (15 + 65 + 89) = 408$.
```python n=int(input()) m=int(input()) i1={} i2={} sum=0 for i in range(n): index1_ele=int(input()) cost1_ele=int(input()) i1[index1_ele]=cost1_ele for j in range(m): index2_ele=int(input()) cost2_ele=int(input()) i2[index2_ele]=cost2_ele for key in i1 : if key in i2 : if i1[key]>i2[key]: sum +=i1[key] else : sum +=i2[key] i2[key]=0 i1[key]=0 else : sum +=i1[key] for key2 in i2 : sum += i2[key] print (sum) ```
-1
801
B
Valued Keys
PROGRAMMING
900
[ "constructive algorithms", "greedy", "strings" ]
null
null
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length. The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2. For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel". You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
The first line of input contains the string *x*. The second line of input contains the string *y*. Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1. Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
[ "ab\naa\n", "nzwzl\nniwel\n", "ab\nba\n" ]
[ "ba\n", "xiyez\n", "-1\n" ]
The first case is from the statement. Another solution for the second case is "zizez" There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) =  "ba".
1,000
[ { "input": "ab\naa", "output": "ba" }, { "input": "nzwzl\nniwel", "output": "xiyez" }, { "input": "ab\nba", "output": "-1" }, { "input": "r\nl", "output": "l" }, { "input": "d\ny", "output": "-1" }, { "input": "yvowz\ncajav", "output": "cajav" }, { "input": "lwzjp\ninjit", "output": "-1" }, { "input": "epqnlxmiicdidyscjaxqznwur\neodnlemiicdedmkcgavqbnqmm", "output": "eodnlemiicdedmkcgavqbnqmm" }, { "input": "qqdabbsxiibnnjgsgxllfvdqj\nuxmypqtwfdezewdxfgplannrs", "output": "-1" }, { "input": "aanerbaqslfmqmuciqbxyznkevukvznpkmxlcorpmrenwxhzfgbmlfpxtkqpxdrmcqcmbf\naanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf", "output": "aanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf" }, { "input": "mbyrkhjctrcrayisflptgfudwgrtegidhqicsjqafvdloritbjhciyxuwavxknezwwudnk\nvvixsutlbdewqoabqhpuerfkzrddcqptfwmxdlxwbvsaqfjoxztlddvwgflcteqbwaiaen", "output": "-1" }, { "input": "eufycwztywhbjrpqobvknwfqmnboqcfdiahkagykeibbsqpljcghhmsgfmswwsanzyiwtvuirwmppfivtekaywkzskyydfvkjgxb\necfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb", "output": "ecfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb" }, { "input": "qvpltcffyeghtbdhjyhfteojezyzziardduzrbwuxmzzkkoehfnxecafizxglboauhynfbawlfxenmykquyhrxswhjuovvogntok\nchvkcvzxptbcepdjfezcpuvtehewbnvqeoezlcnzhpfwujbmhafoeqmjhtwisnobauinkzyigrvahpuetkgpdjfgbzficsmuqnym", "output": "-1" }, { "input": "nmuwjdihouqrnsuahimssnrbxdpwvxiyqtenahtrlshjkmnfuttnpqhgcagoptinnaptxaccptparldzrhpgbyrzedghudtsswxi\nnilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib", "output": "nilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib" }, { "input": "dyxgwupoauwqtcfoyfjdotzirwztdfrueqiypxoqvkmhiehdppwtdoxrbfvtairdbuvlqohjflznggjpifhwjrshcrfbjtklpykx\ngzqlnoizhxolnditjdhlhptjsbczehicudoybzilwnshmywozwnwuipcgirgzldtvtowdsokfeafggwserzdazkxyddjttiopeew", "output": "-1" }, { "input": "hbgwuqzougqzlxemvyjpeizjfwhgugrfnhbrlxkmkdalikfyunppwgdzmalbwewybnjzqsohwhjkdcyhhzmysflambvhpsjilsyv\nfbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv", "output": "fbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv" }, { "input": "xnjjhjfuhgyxqhpzmvgbaohqarugdoaczcfecofltwemieyxolswkcwhlfagfrgmoiqrgftokbqwtxgxzweozzlikrvafiabivlk\npjfosalbsitcnqiazhmepfifjxvmazvdgffcnozmnqubhonwjldmpdsjagmamniylzjdbklcyrzivjyzgnogahobpkwpwpvraqns", "output": "-1" }, { "input": "zrvzedssbsrfldqvjpgmsefrmsatspzoitwvymahiptphiystjlsauzquzqqbmljobdhijcpdvatorwmyojqgnezvzlgjibxepcf\npesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf", "output": "pesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf" }, { "input": "pdvkuwyzntzfqpblzmbynknyhlnqbxijuqaincviugxohcsrofozrrsategwkbwxcvkyzxhurokefpbdnmcfogfhsojayysqbrow\nbvxruombdrywlcjkrltyayaazwpauuhbtgwfzdrmfwwucgffucwelzvpsdgtapogchblzahsrfymjlaghkbmbssghrpxalkslcvp", "output": "-1" }, { "input": "tgharsjyihroiiahwgbjezlxvlterxivdhtzjcqegzmtigqmrehvhiyjeywegxaseoyoacouijudbiruoghgxvxadwzgdxtnxlds\ntghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp", "output": "tghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp" }, { "input": "jsinejpfwhzloulxndzvzftgogfdagrsscxmatldssqsgaknnbkcvhptebjjpkjhrjegrotzwcdosezkedzxeoyibmyzunkguoqj\nkfmvybobocdpipiripysioruqvloopvbggpjksgmwzyqwyxnesmvhsawnbbmntulspvsysfkjqwpvoelliopbaukyagedextzoej", "output": "-1" }, { "input": "nttdcfceptruiomtmwzestrfchnqpgqeztpcvthzelfyggjgqadylzubpvbrlgndrcsursczpxlnoyoadxezncqalupfzmjeqihe\nkttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe", "output": "kttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe" }, { "input": "diuopwglduasnaxgduwslbzoyayoypzznqspljcyqehweydhlwifcvnjmaowuvyqfwynjghecqvxdvuquuwpvwrjljozocaxnktv\ntrdydprdzmjhgbhzytelrfjpgsebijicsigmwhynmcyjtqrvojcndodchzxfcvyqjxqzwibccdvsjqhsnectdjyrrhzkeamukang", "output": "-1" }, { "input": "ftfr\nftfr", "output": "ftfr" }, { "input": "ftr\nftr", "output": "ftr" }, { "input": "shftr\nshftr", "output": "shftr" }, { "input": "vkvkkv\nvkvkkv", "output": "vkvkkv" }, { "input": "ftrd\nftrd", "output": "ftrd" }, { "input": "fztr\nfztr", "output": "fztr" }, { "input": "frtr\nfrtr", "output": "frtr" }, { "input": "shdftr\nshdftr", "output": "shdftr" }, { "input": "zzz\nzzz", "output": "zzz" }, { "input": "shtr\nshtr", "output": "shtr" }, { "input": "aaaaa\nzzzzz", "output": "-1" }, { "input": "efr\nefr", "output": "efr" } ]
1,598,240,557
2,147,483,647
PyPy 3
OK
TESTS
35
233
22,220,800
import string x = input() y = input() alph = string.ascii_lowercase ans = 1 for i in range(len(y)): if x[i] < y[i]: ans = 0 break if ans == 0: print(-1) else: print(y)
Title: Valued Keys Time Limit: None seconds Memory Limit: None megabytes Problem Description: You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length. The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2. For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel". You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists. Input Specification: The first line of input contains the string *x*. The second line of input contains the string *y*. Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100. Output Specification: If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1. Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters. Demo Input: ['ab\naa\n', 'nzwzl\nniwel\n', 'ab\nba\n'] Demo Output: ['ba\n', 'xiyez\n', '-1\n'] Note: The first case is from the statement. Another solution for the second case is "zizez" There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) =  "ba".
```python import string x = input() y = input() alph = string.ascii_lowercase ans = 1 for i in range(len(y)): if x[i] < y[i]: ans = 0 break if ans == 0: print(-1) else: print(y) ```
3
253
C
Text Editor
PROGRAMMING
1,600
[ "data structures", "dfs and similar", "graphs", "greedy", "shortest paths" ]
null
null
Vasya is pressing the keys on the keyboard reluctantly, squeezing out his ideas on the classical epos depicted in Homer's Odysseus... How can he explain to his literature teacher that he isn't going to become a writer? In fact, he is going to become a programmer. So, he would take great pleasure in writing a program, but none — in writing a composition. As Vasya was fishing for a sentence in the dark pond of his imagination, he suddenly wondered: what is the least number of times he should push a key to shift the cursor from one position to another one? Let's describe his question more formally: to type a text, Vasya is using the text editor. He has already written *n* lines, the *i*-th line contains *a**i* characters (including spaces). If some line contains *k* characters, then this line overall contains (*k*<=+<=1) positions where the cursor can stand: before some character or after all characters (at the end of the line). Thus, the cursor's position is determined by a pair of integers (*r*,<=*c*), where *r* is the number of the line and *c* is the cursor's position in the line (the positions are indexed starting from one from the beginning of the line). Vasya doesn't use the mouse to move the cursor. He uses keys "Up", "Down", "Right" and "Left". When he pushes each of these keys, the cursor shifts in the needed direction. Let's assume that before the corresponding key is pressed, the cursor was located in the position (*r*,<=*c*), then Vasya pushed key: - "Up": if the cursor was located in the first line (*r*<==<=1), then it does not move. Otherwise, it moves to the previous line (with number *r*<=-<=1), to the same position. At that, if the previous line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=-<=1;- "Down": if the cursor was located in the last line (*r*<==<=*n*), then it does not move. Otherwise, it moves to the next line (with number *r*<=+<=1), to the same position. At that, if the next line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=+<=1;- "Right": if the cursor can move to the right in this line (*c*<=&lt;<=*a**r*<=+<=1), then it moves to the right (to position *c*<=+<=1). Otherwise, it is located at the end of the line and doesn't move anywhere when Vasya presses the "Right" key;- "Left": if the cursor can move to the left in this line (*c*<=&gt;<=1), then it moves to the left (to position *c*<=-<=1). Otherwise, it is located at the beginning of the line and doesn't move anywhere when Vasya presses the "Left" key. You've got the number of lines in the text file and the number of characters, written in each line of this file. Find the least number of times Vasya should push the keys, described above, to shift the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the file. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105), separated by single spaces. The third line contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*r*2<=≤<=*n*,<=1<=≤<=*c*1<=≤<=*a**r*1<=+<=1,<=1<=≤<=*c*2<=≤<=*a**r*2<=+<=1).
Print a single integer — the minimum number of times Vasya should push a key to move the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
[ "4\n2 1 6 4\n3 4 4 2\n", "4\n10 5 6 4\n1 11 4 2\n", "3\n10 1 10\n1 10 1 1\n" ]
[ "3\n", "6\n", "3\n" ]
In the first sample the editor contains four lines. Let's represent the cursor's possible positions in the line as numbers. Letter *s* represents the cursor's initial position, letter *t* represents the last one. Then all possible positions of the cursor in the text editor are described by the following table. 123 12 123s567 1t345 One of the possible answers in the given sample is: "Left", "Down", "Left".
1,500
[ { "input": "4\n2 1 6 4\n3 4 4 2", "output": "3" }, { "input": "4\n10 5 6 4\n1 11 4 2", "output": "6" }, { "input": "3\n10 1 10\n1 10 1 1", "output": "3" }, { "input": "4\n2 1 6 4\n4 2 3 5", "output": "4" }, { "input": "3\n20 3 20\n1 20 1 1", "output": "5" }, { "input": "2\n10 1\n1 3 2 1", "output": "2" }, { "input": "20\n3 1 9 9 6 1 3 4 5 6 7 3 1 9 9 1 9 1 5 7\n17 7 19 5", "output": "5" }, { "input": "20\n81 90 11 68 23 18 78 75 45 86 58 37 21 15 98 40 53 100 10 70\n11 55 8 19", "output": "7" }, { "input": "25\n55 47 5 63 55 11 8 32 0 62 41 7 17 70 33 6 41 68 37 82 33 64 28 33 12\n6 11 14 12", "output": "19" }, { "input": "30\n77 38 82 87 88 1 90 3 79 69 64 36 85 12 1 19 80 89 75 56 49 28 10 31 37 65 27 84 10 72\n26 65 19 3", "output": "15" }, { "input": "100\n119 384 220 357 394 123 371 57 6 221 219 79 305 292 71 113 428 326 166 235 120 404 77 223 2 171 81 1 119 307 200 323 89 294 178 421 125 197 89 154 335 46 210 311 216 182 246 262 195 99 175 153 310 302 417 167 222 349 63 325 175 345 6 78 9 147 126 308 229 295 175 368 230 116 95 254 443 15 299 265 322 171 179 184 435 115 384 324 213 359 414 159 322 49 209 296 376 173 369 302\n8 47 23 65", "output": "73" }, { "input": "100\n120 336 161 474 285 126 321 63 82 303 421 110 143 279 505 231 40 413 20 421 271 30 465 186 495 156 225 445 530 156 516 305 360 261 123 5 50 377 124 8 115 529 395 408 271 166 121 240 336 348 352 359 487 471 171 379 381 182 109 425 252 434 131 430 461 386 33 189 481 461 163 89 374 505 525 526 132 468 80 88 90 538 280 281 552 415 194 41 333 296 297 205 40 79 22 219 108 213 158 410\n58 119 82 196", "output": "186" }, { "input": "100\n9 8 5 2 10 6 10 10 1 9 8 5 0 9 1 6 6 2 3 9 9 3 2 7 2 7 8 10 6 6 2 8 5 0 0 8 7 3 0 4 7 5 9 0 3 6 9 6 5 0 4 9 4 7 7 1 5 8 2 4 10 3 9 8 10 6 10 7 4 9 0 1 3 6 6 2 1 1 5 7 0 9 6 0 4 6 8 4 7 6 1 9 4 3 10 9 7 0 0 7\n72 2 87 2", "output": "16" }, { "input": "100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44\n6 76 89 15", "output": "97" }, { "input": "100\n176 194 157 24 27 153 31 159 196 85 127 114 142 39 133 4 44 36 141 96 80 40 120 16 88 29 157 136 158 98 145 152 19 40 106 116 19 195 184 70 72 95 78 146 199 1 103 3 120 71 52 77 160 148 24 156 108 64 86 124 103 97 108 66 107 126 29 172 23 106 29 69 64 90 9 171 59 85 1 63 79 50 136 21 115 164 30 115 86 26 25 6 128 48 122 14 198 88 182 117\n71 4 85 80", "output": "92" }, { "input": "100\n1622 320 1261 282 1604 57 1427 1382 904 911 1719 1682 984 1727 1301 1799 1110 1057 248 764 1642 1325 1172 1677 182 32 665 397 1146 73 412 554 973 874 774 1948 1676 1959 518 280 1467 568 613 760 594 252 224 1359 876 253 760 1566 929 1614 940 1079 288 245 1432 1647 1534 1768 1947 733 225 495 1239 644 124 522 1859 1856 1464 485 1962 131 1693 1622 242 1119 1290 538 998 1342 791 711 809 1407 1369 414 124 758 1104 1142 355 324 665 1155 551 1611\n36 1383 51 21", "output": "47" }, { "input": "50\n966 151 777 841 507 884 487 813 29 230 966 819 390 482 137 365 391 693 56 756 327 500 895 22 361 619 8 516 21 770 572 53 497 682 162 32 308 309 110 470 699 318 947 658 720 679 435 645 481 42\n45 510 25 48", "output": "59" }, { "input": "50\n4143 2907 2028 539 3037 1198 6597 3658 972 9809 854 4931 642 3170 9777 2992 7121 8094 6634 684 5580 4684 3397 7909 3908 3822 2137 8299 8146 2105 7578 4338 7363 8237 530 301 4566 1153 4795 5342 3257 6953 4401 8311 9977 9260 7019 7705 5416 6754\n21 3413 23 218", "output": "112" }, { "input": "50\n8974 13208 81051 72024 84908 49874 22875 64935 27340 38682 28512 43441 78752 83458 63344 5723 83425 54009 61980 7824 59956 43184 49274 3896 44079 67313 68565 9138 55087 68458 43009 3685 22879 85032 84273 93643 64957 73428 57016 33405 85961 47708 90325 1352 1551 20935 76821 75406 59309 40757\n14 45232 2 6810", "output": "1102" }, { "input": "100\n34 80 42 99 7 49 109 61 20 7 92 2 62 96 65 77 70 5 16 83 99 39 88 66 106 1 80 68 71 74 28 75 19 97 38 100 30 1 55 86 3 13 61 82 72 50 68 18 77 89 96 27 26 35 46 13 83 77 40 31 85 108 15 5 40 80 1 108 44 18 66 26 46 7 36 80 34 76 17 9 23 57 109 90 88 1 54 66 71 94 6 89 50 22 93 82 32 74 41 74\n91 7 56 3", "output": "36" }, { "input": "100\n156 150 75 72 205 133 139 99 212 82 58 104 133 88 46 157 49 179 32 72 159 188 42 47 36 58 127 215 125 115 209 118 109 11 62 159 110 151 92 202 203 25 44 209 153 8 199 168 126 34 21 106 31 40 48 212 106 0 131 166 2 126 13 126 103 44 2 66 33 25 194 41 37 198 199 6 22 1 161 16 95 11 198 198 166 145 214 159 143 2 181 130 159 118 176 165 192 178 42 168\n49 12 66 23", "output": "39" }, { "input": "100\n289 16 321 129 0 121 61 86 93 5 63 276 259 144 275 236 309 257 244 138 107 18 158 14 295 162 7 113 58 101 142 196 181 329 115 109 62 237 110 87 19 205 68 257 252 0 166 45 310 244 140 251 262 315 213 206 290 128 287 230 198 83 135 40 8 273 319 295 288 274 34 260 288 252 172 129 201 110 294 111 95 180 34 98 16 188 170 40 274 153 11 159 245 51 328 290 112 11 105 182\n99 53 21 77", "output": "154" }, { "input": "10\n11284 10942 14160 10062 1858 6457 1336 13842 5498 4236\n1 7123 5 664", "output": "681" }, { "input": "53\n29496 9630 10781 25744 28508 15670 8252 14284 25995 20215 24251 14240 1370 15724 28268 30377 4839 16791 33515 23776 24252 1045 15245 12839 17531 28591 13091 27339 23361 10997 30438 26977 26789 18402 32938 2106 26599 10733 29549 9760 31507 33572 16934 7273 26477 15040 23704 19905 1941 3861 5950 1265 34\n11 6571 1 3145", "output": "1788" }, { "input": "31\n14324 29226 58374 19956 61695 71586 13261 11436 58443 34879 12689 62786 68194 34303 99201 67616 51364 67539 56799 60130 22021 64546 28331 75746 45036 43950 2150 61718 33030 37781 34319\n24 57393 7 6152", "output": "4024" }, { "input": "23\n5397 13279 11741 20182 18311 20961 16720 11864 2486 14081 15637 16216 3736 437 16346 12449 20205 10949 14237 2213 15281 15271 19138\n5 11479 13 68", "output": "380" }, { "input": "40\n41997 20736 34699 73866 45509 41964 36050 16673 10454 21166 28306 69335 6172 65943 78569 16794 10439 68061 40392 52510 78248 63851 45294 49929 22580 5574 40993 18334 73897 59148 47727 76645 4280 23651 58772 64500 13704 60366 37099 20336\n14 29991 16 11904", "output": "1468" }, { "input": "16\n922 7593 4748 4103 7672 6001 1573 3973 8524 8265 4747 3202 4796 2637 889 9359\n12 2165 12 1654", "output": "90" }, { "input": "18\n22746 9084 3942 1120 25391 25307 7409 1189 23473 26175 10964 13584 5541 500 24338 12272 15824 27656\n3 1395 12 90", "output": "424" }, { "input": "45\n2286 4425 14666 34959 10792 3723 30132 34266 18100 22813 28627 23310 33911 27285 1211 993 15526 4751 13611 21400 25712 24437 27435 34808 33950 18373 33685 23487 5444 10249 21415 16368 35398 7889 30918 19940 1552 12164 34292 13922 10011 31377 24102 34539 11992\n20 21252 28 2058", "output": "531" }, { "input": "29\n56328 80183 27682 79083 60680 12286 34299 8015 51808 50756 82133 45930 43695 65863 25178 70825 2288 15111 39667 39637 11453 62821 81484 84216 54524 53749 8396 67712 76146\n13 10739 9 3622", "output": "1345" }, { "input": "46\n67864 68218 3593 30646 66413 65542 65322 26801 28984 61330 15247 16522 39142 14013 49272 41585 56739 6881 44227 7101 57657 21121 51857 39351 13500 71528 8488 66118 14756 43923 21284 20018 49049 60198 6181 62460 44141 55828 42636 14623 59758 68321 12192 29978 24745 16467\n27 5545 4 3766", "output": "197" }, { "input": "70\n53691 15034 17444 13375 23285 29211 24567 21643 45514 10290 70111 24541 25072 5365 12162 34564 27535 48253 39581 13468 33718 35105 30468 50214 53365 74800 16749 33935 36346 54230 73796 26826 27866 41887 67566 40813 32267 58821 56828 26439 23708 32335 69515 33825 6092 20510 50174 11129 4592 74116 21498 77951 48056 28554 43904 21885 5967 40253 4990 70029 34374 41201 25399 6101 10354 61833 43646 20534 371 11111\n21 3911 45 1755", "output": "1455" }, { "input": "10\n8121 10681 10179 10221 9410 5214 19040 17893 7862 4611\n7 7780 7 3369", "output": "1249" }, { "input": "2\n1 2\n1 1 1 1", "output": "0" }, { "input": "3\n1 10 20\n2 10 3 1", "output": "4" } ]
1,689,348,364
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
7
92
0
import sys # input = sys.stdin.readline sys.stdin=open("input.txt") sys.stdout=open("output.txt",'w') n = int(input()) w = list(map(lambda x:int(x)+1, input().split())) + [1] r, c, R, C = map(int, input().split()) x = t = 10**9 if r <= R: q, a = min(min(w[i] for i in range(r-1, R)), c), R-r for i in range(r-1, -1, -1): t = min(w[i], t) b = min(t, q) x = min(x, a + abs(b-C)) a += 2 a = R-r for i in range(R, n+1): a += 2 t = min(q, w[i]) b = min(t, q) x = min(x, a + abs(b-C)) else: q, a = min(min(w[i] for i in range(R-1, r)), c), r-R for i in range(r-1, n+1): t = min(w[i], t) b = min(t, q) x = min(x, a + abs(b-C)) a += 2 a = r-R for i in range(R-1, -1, -1): a += 2 t = min(q, w[i]) b = min(t, q) x = min(x, a + abs(b - C)) print(x)
Title: Text Editor Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya is pressing the keys on the keyboard reluctantly, squeezing out his ideas on the classical epos depicted in Homer's Odysseus... How can he explain to his literature teacher that he isn't going to become a writer? In fact, he is going to become a programmer. So, he would take great pleasure in writing a program, but none — in writing a composition. As Vasya was fishing for a sentence in the dark pond of his imagination, he suddenly wondered: what is the least number of times he should push a key to shift the cursor from one position to another one? Let's describe his question more formally: to type a text, Vasya is using the text editor. He has already written *n* lines, the *i*-th line contains *a**i* characters (including spaces). If some line contains *k* characters, then this line overall contains (*k*<=+<=1) positions where the cursor can stand: before some character or after all characters (at the end of the line). Thus, the cursor's position is determined by a pair of integers (*r*,<=*c*), where *r* is the number of the line and *c* is the cursor's position in the line (the positions are indexed starting from one from the beginning of the line). Vasya doesn't use the mouse to move the cursor. He uses keys "Up", "Down", "Right" and "Left". When he pushes each of these keys, the cursor shifts in the needed direction. Let's assume that before the corresponding key is pressed, the cursor was located in the position (*r*,<=*c*), then Vasya pushed key: - "Up": if the cursor was located in the first line (*r*<==<=1), then it does not move. Otherwise, it moves to the previous line (with number *r*<=-<=1), to the same position. At that, if the previous line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=-<=1;- "Down": if the cursor was located in the last line (*r*<==<=*n*), then it does not move. Otherwise, it moves to the next line (with number *r*<=+<=1), to the same position. At that, if the next line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=+<=1;- "Right": if the cursor can move to the right in this line (*c*<=&lt;<=*a**r*<=+<=1), then it moves to the right (to position *c*<=+<=1). Otherwise, it is located at the end of the line and doesn't move anywhere when Vasya presses the "Right" key;- "Left": if the cursor can move to the left in this line (*c*<=&gt;<=1), then it moves to the left (to position *c*<=-<=1). Otherwise, it is located at the beginning of the line and doesn't move anywhere when Vasya presses the "Left" key. You've got the number of lines in the text file and the number of characters, written in each line of this file. Find the least number of times Vasya should push the keys, described above, to shift the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2). Input Specification: The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the file. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105), separated by single spaces. The third line contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*r*2<=≤<=*n*,<=1<=≤<=*c*1<=≤<=*a**r*1<=+<=1,<=1<=≤<=*c*2<=≤<=*a**r*2<=+<=1). Output Specification: Print a single integer — the minimum number of times Vasya should push a key to move the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2). Demo Input: ['4\n2 1 6 4\n3 4 4 2\n', '4\n10 5 6 4\n1 11 4 2\n', '3\n10 1 10\n1 10 1 1\n'] Demo Output: ['3\n', '6\n', '3\n'] Note: In the first sample the editor contains four lines. Let's represent the cursor's possible positions in the line as numbers. Letter *s* represents the cursor's initial position, letter *t* represents the last one. Then all possible positions of the cursor in the text editor are described by the following table. 123 12 123s567 1t345 One of the possible answers in the given sample is: "Left", "Down", "Left".
```python import sys # input = sys.stdin.readline sys.stdin=open("input.txt") sys.stdout=open("output.txt",'w') n = int(input()) w = list(map(lambda x:int(x)+1, input().split())) + [1] r, c, R, C = map(int, input().split()) x = t = 10**9 if r <= R: q, a = min(min(w[i] for i in range(r-1, R)), c), R-r for i in range(r-1, -1, -1): t = min(w[i], t) b = min(t, q) x = min(x, a + abs(b-C)) a += 2 a = R-r for i in range(R, n+1): a += 2 t = min(q, w[i]) b = min(t, q) x = min(x, a + abs(b-C)) else: q, a = min(min(w[i] for i in range(R-1, r)), c), r-R for i in range(r-1, n+1): t = min(w[i], t) b = min(t, q) x = min(x, a + abs(b-C)) a += 2 a = r-R for i in range(R-1, -1, -1): a += 2 t = min(q, w[i]) b = min(t, q) x = min(x, a + abs(b - C)) print(x) ```
0
606
A
Magic Spheres
PROGRAMMING
1,200
[ "implementation" ]
null
null
Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)?
The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal. The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get.
If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No".
[ "4 4 0\n2 1 2\n", "5 6 1\n2 7 2\n", "3 3 3\n2 2 2\n" ]
[ "Yes\n", "No\n", "Yes\n" ]
In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs.
500
[ { "input": "4 4 0\n2 1 2", "output": "Yes" }, { "input": "5 6 1\n2 7 2", "output": "No" }, { "input": "3 3 3\n2 2 2", "output": "Yes" }, { "input": "0 0 0\n0 0 0", "output": "Yes" }, { "input": "0 0 0\n0 0 1", "output": "No" }, { "input": "0 1 0\n0 0 0", "output": "Yes" }, { "input": "1 0 0\n1 0 0", "output": "Yes" }, { "input": "2 2 1\n1 1 2", "output": "No" }, { "input": "1 3 1\n2 1 1", "output": "Yes" }, { "input": "1000000 1000000 1000000\n1000000 1000000 1000000", "output": "Yes" }, { "input": "1000000 500000 500000\n0 750000 750000", "output": "Yes" }, { "input": "500000 1000000 500000\n750001 0 750000", "output": "No" }, { "input": "499999 500000 1000000\n750000 750000 0", "output": "No" }, { "input": "500000 500000 0\n0 0 500000", "output": "Yes" }, { "input": "0 500001 499999\n500000 0 0", "output": "No" }, { "input": "1000000 500000 1000000\n500000 1000000 500000", "output": "Yes" }, { "input": "1000000 1000000 499999\n500000 500000 1000000", "output": "No" }, { "input": "500000 1000000 1000000\n1000000 500001 500000", "output": "No" }, { "input": "1000000 500000 500000\n0 1000000 500000", "output": "Yes" }, { "input": "500000 500000 1000000\n500001 1000000 0", "output": "No" }, { "input": "500000 999999 500000\n1000000 0 500000", "output": "No" }, { "input": "4 0 3\n2 2 1", "output": "Yes" }, { "input": "0 2 4\n2 0 2", "output": "Yes" }, { "input": "3 1 0\n1 1 1", "output": "Yes" }, { "input": "4 4 1\n1 3 2", "output": "Yes" }, { "input": "1 2 4\n2 1 3", "output": "No" }, { "input": "1 1 0\n0 0 1", "output": "No" }, { "input": "4 0 0\n0 1 1", "output": "Yes" }, { "input": "0 3 0\n1 0 1", "output": "No" }, { "input": "0 0 3\n1 0 1", "output": "Yes" }, { "input": "1 12 1\n4 0 4", "output": "Yes" }, { "input": "4 0 4\n1 2 1", "output": "Yes" }, { "input": "4 4 0\n1 1 3", "output": "No" }, { "input": "0 9 0\n2 2 2", "output": "No" }, { "input": "0 10 0\n2 2 2", "output": "Yes" }, { "input": "9 0 9\n0 8 0", "output": "Yes" }, { "input": "0 9 9\n9 0 0", "output": "No" }, { "input": "9 10 0\n0 0 9", "output": "Yes" }, { "input": "10 0 9\n0 10 0", "output": "No" }, { "input": "0 10 10\n10 0 0", "output": "Yes" }, { "input": "10 10 0\n0 0 11", "output": "No" }, { "input": "307075 152060 414033\n381653 222949 123101", "output": "No" }, { "input": "569950 228830 153718\n162186 357079 229352", "output": "No" }, { "input": "149416 303568 749016\n238307 493997 190377", "output": "No" }, { "input": "438332 298094 225324\n194220 400244 245231", "output": "No" }, { "input": "293792 300060 511272\n400687 382150 133304", "output": "No" }, { "input": "295449 518151 368838\n382897 137148 471892", "output": "No" }, { "input": "191789 291147 691092\n324321 416045 176232", "output": "Yes" }, { "input": "286845 704749 266526\n392296 104421 461239", "output": "Yes" }, { "input": "135522 188282 377041\n245719 212473 108265", "output": "Yes" }, { "input": "404239 359124 133292\n180069 184791 332544", "output": "No" }, { "input": "191906 624432 244408\n340002 367217 205432", "output": "No" }, { "input": "275980 429361 101824\n274288 302579 166062", "output": "No" }, { "input": "136092 364927 395302\n149173 343146 390922", "output": "No" }, { "input": "613852 334661 146012\n363786 326286 275233", "output": "No" }, { "input": "348369 104625 525203\n285621 215396 366411", "output": "No" }, { "input": "225307 153572 114545\n154753 153282 149967", "output": "Yes" }, { "input": "438576 124465 629784\n375118 276028 390116", "output": "Yes" }, { "input": "447521 327510 158732\n395759 178458 259139", "output": "Yes" }, { "input": "8 5 5\n5 5 5", "output": "Yes" }, { "input": "100 100 100\n1 1 1", "output": "Yes" }, { "input": "100 100 100\n0 0 0", "output": "Yes" }, { "input": "3 2 3\n2 3 2", "output": "No" }, { "input": "5 4 3\n2 2 2", "output": "Yes" }, { "input": "14 9 8\n12 5 10", "output": "Yes" }, { "input": "10 10 10\n1 1 1", "output": "Yes" }, { "input": "6 3 3\n3 3 3", "output": "Yes" }, { "input": "10 0 4\n2 4 2", "output": "Yes" }, { "input": "100 100 100\n2 2 2", "output": "Yes" }, { "input": "4 6 0\n2 1 2", "output": "Yes" }, { "input": "4 6 3\n4 2 3", "output": "Yes" }, { "input": "5 5 5\n1 1 1", "output": "Yes" }, { "input": "41 17 34\n0 19 24", "output": "Yes" }, { "input": "8 8 8\n3 3 3", "output": "Yes" }, { "input": "7 7 1\n1 1 2", "output": "Yes" }, { "input": "6 6 0\n2 2 2", "output": "Yes" }, { "input": "5 5 5\n2 2 2", "output": "Yes" }, { "input": "400 400 400\n1 1 1", "output": "Yes" }, { "input": "4 4 4\n2 2 2", "output": "Yes" } ]
1,451,842,243
2,147,483,647
Python 3
OK
TESTS
79
62
0
a = list(map(int, input().split())) b = list(map(int, input().split())) z = 0 for i in range(3): z += max((a[i] - b[i])//2, 0) if a[i] < b[i]: z -= b[i] - a[i] print ('Yes' if z >= 0 else 'No')
Title: Magic Spheres Time Limit: None seconds Memory Limit: None megabytes Problem Description: Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)? Input Specification: The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal. The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get. Output Specification: If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No". Demo Input: ['4 4 0\n2 1 2\n', '5 6 1\n2 7 2\n', '3 3 3\n2 2 2\n'] Demo Output: ['Yes\n', 'No\n', 'Yes\n'] Note: In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs.
```python a = list(map(int, input().split())) b = list(map(int, input().split())) z = 0 for i in range(3): z += max((a[i] - b[i])//2, 0) if a[i] < b[i]: z -= b[i] - a[i] print ('Yes' if z >= 0 else 'No') ```
3
522
A
Reposts
PROGRAMMING
1,200
[ "*special", "dfs and similar", "dp", "graphs", "trees" ]
null
null
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on. These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed. Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive. We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
Print a single integer — the maximum length of a repost chain.
[ "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n", "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n", "1\nSoMeStRaNgEgUe reposted PoLyCaRp\n" ]
[ "6\n", "2\n", "2\n" ]
none
500
[ { "input": "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya", "output": "6" }, { "input": "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp", "output": "2" }, { "input": "1\nSoMeStRaNgEgUe reposted PoLyCaRp", "output": "2" }, { "input": "1\niuNtwVf reposted POlYcarP", "output": "2" }, { "input": "10\ncs reposted poLYCaRp\nAFIkDrY7Of4V7Mq reposted CS\nsoBiwyN7KOvoFUfbhux reposted aFikDry7Of4v7MQ\nvb6LbwA reposted sObIWYN7KOvoFufBHUx\nDtWKIcVwIHgj4Rcv reposted vb6lbwa\nkt reposted DTwKicvwihgJ4rCV\n75K reposted kT\njKzyxx1 reposted 75K\nuoS reposted jkZyXX1\npZJskHTCIqE3YyZ5ME reposted uoS", "output": "11" }, { "input": "10\nvxrUpCXvx8Isq reposted pOLYcaRP\nICb1 reposted vXRUpCxvX8ISq\nJFMt4b8jZE7iF2m8by7y2 reposted Icb1\nqkG6ZkMIf9QRrBFQU reposted ICb1\nnawsNfcR2palIMnmKZ reposted pOlYcaRP\nKksyH reposted jFMT4b8JzE7If2M8by7y2\nwJtWwQS5FvzN0h8CxrYyL reposted NawsNfcR2paLIMnmKz\nDpBcBPYAcTXEdhldI6tPl reposted NaWSnFCr2pALiMnmkZ\nlEnwTVnlwdQg2vaIRQry reposted kKSYh\nQUVFgwllaWO reposted Wjtwwqs5FVzN0H8cxRyyl", "output": "6" }, { "input": "10\nkkuLGEiHv reposted POLYcArp\n3oX1AoUqyw1eR3nCADY9hLwd reposted kkuLGeIHV\nwf97dqq5bx1dPIchCoT reposted 3OX1AOuQYW1eR3ncAdY9hLwD\nWANr8h reposted Wf97dQQ5bx1dpIcHcoT\n3Fb736lkljZK2LtSbfL reposted wANR8h\n6nq9xLOn reposted 3fB736lKlJZk2LtSbFL\nWL reposted 3Fb736lKLjZk2LTSbfl\ndvxn4Xtc6SBcvKf1 reposted wF97DQq5bX1dPiChCOt\nMCcPLIMISqxDzrj reposted 6nQ9XLOn\nxsQL4Z2Iu reposted MCcpLiMiSqxdzrj", "output": "9" }, { "input": "10\nsMA4 reposted pOLyCARP\nlq3 reposted pOlycARp\nEa16LSFTQxLJnE reposted polYcARp\nkvZVZhJwXcWsnC7NA1DV2WvS reposted polYCArp\nEYqqlrjRwddI reposted pOlyCArP\nsPqQCA67Y6PBBbcaV3EhooO reposted ea16LSFTqxLJne\njjPnneZdF6WLZ3v reposted Ea16LSFTqxLjNe\nWEoi6UpnfBUx79 reposted ea16LSFtqXljNe\nqi4yra reposted eYqqlRJrWDDI\ncw7E1UCSUD reposted eYqqLRJRwDdI", "output": "3" } ]
1,492,109,337
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
31
4,505,600
n = int(input()) count = 0 posters = [] for y in range(n): temp = input().split(' ') if temp[2].lower() not in posters: count += 1 posters.append(temp[2].lower()) print(count)
Title: Reposts Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on. These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed. Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke. Input Specification: The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive. We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user. Output Specification: Print a single integer — the maximum length of a repost chain. Demo Input: ['5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n', '6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n', '1\nSoMeStRaNgEgUe reposted PoLyCaRp\n'] Demo Output: ['6\n', '2\n', '2\n'] Note: none
```python n = int(input()) count = 0 posters = [] for y in range(n): temp = input().split(' ') if temp[2].lower() not in posters: count += 1 posters.append(temp[2].lower()) print(count) ```
0
454
B
Little Pony and Sort by Shift
PROGRAMMING
1,200
[ "implementation" ]
null
null
One day, Twilight Sparkle is interested in how to sort a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* in non-decreasing order. Being a young unicorn, the only operation she can perform is a unit shift. That is, she can move the last element of the sequence to its beginning: Help Twilight Sparkle to calculate: what is the minimum number of operations that she needs to sort the sequence?
The first line contains an integer *n* (2<=≤<=*n*<=≤<=105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
If it's impossible to sort the sequence output -1. Otherwise output the minimum number of operations Twilight Sparkle needs to sort it.
[ "2\n2 1\n", "3\n1 3 2\n", "2\n1 2\n" ]
[ "1\n", "-1\n", "0\n" ]
none
1,000
[ { "input": "2\n2 1", "output": "1" }, { "input": "3\n1 3 2", "output": "-1" }, { "input": "2\n1 2", "output": "0" }, { "input": "6\n3 4 5 6 3 2", "output": "-1" }, { "input": "3\n1 2 1", "output": "1" }, { "input": "5\n1 1 2 1 1", "output": "2" }, { "input": "4\n5 4 5 4", "output": "-1" }, { "input": "7\n3 4 5 5 5 1 2", "output": "2" }, { "input": "5\n2 2 1 2 2", "output": "3" }, { "input": "5\n5 4 1 2 3", "output": "-1" }, { "input": "4\n6 1 2 7", "output": "-1" }, { "input": "5\n4 5 6 2 3", "output": "2" }, { "input": "2\n1 1", "output": "0" }, { "input": "4\n1 2 2 1", "output": "1" }, { "input": "9\n4 5 6 7 1 2 3 4 10", "output": "-1" }, { "input": "7\n2 3 4 1 2 3 4", "output": "-1" }, { "input": "6\n1 2 1 2 1 2", "output": "-1" }, { "input": "3\n3 2 1", "output": "-1" }, { "input": "4\n1 4 4 1", "output": "1" }, { "input": "5\n1 2 1 1 1", "output": "3" }, { "input": "5\n4 6 7 3 5", "output": "-1" }, { "input": "4\n2 3 1 4", "output": "-1" }, { "input": "5\n5 4 3 2 1", "output": "-1" }, { "input": "4\n2 4 1 4", "output": "-1" }, { "input": "6\n4 5 6 1 2 7", "output": "-1" }, { "input": "6\n1 2 3 1 1 1", "output": "3" }, { "input": "5\n1 3 3 3 1", "output": "1" }, { "input": "6\n5 6 7 5 5 5", "output": "3" }, { "input": "5\n3 4 2 1 2", "output": "-1" }, { "input": "3\n3 4 2", "output": "1" }, { "input": "6\n1 1 2 2 1 1", "output": "2" }, { "input": "4\n2 3 4 2", "output": "1" }, { "input": "5\n3 5 7 7 3", "output": "1" }, { "input": "4\n1 1 4 1", "output": "1" }, { "input": "7\n1 5 6 1 1 1 1", "output": "4" }, { "input": "5\n7 8 6 7 8", "output": "-1" }, { "input": "4\n2 4 1 3", "output": "-1" } ]
1,585,412,895
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
5
187
7,577,600
n = int(input()) a = list(map(int, input().split())) if a == sorted(a): print(0) else: for i in range(len(a)): if a[i] > a[i+1]: break lst = list(a[i+1:]) if not sorted(lst) == lst[::-1]: print(-1) else: a = lst[::-1] + a[:i+1] if a == sorted(a): print(n-(i+1)) else: print(-1)
Title: Little Pony and Sort by Shift Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day, Twilight Sparkle is interested in how to sort a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* in non-decreasing order. Being a young unicorn, the only operation she can perform is a unit shift. That is, she can move the last element of the sequence to its beginning: Help Twilight Sparkle to calculate: what is the minimum number of operations that she needs to sort the sequence? Input Specification: The first line contains an integer *n* (2<=≤<=*n*<=≤<=105). The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105). Output Specification: If it's impossible to sort the sequence output -1. Otherwise output the minimum number of operations Twilight Sparkle needs to sort it. Demo Input: ['2\n2 1\n', '3\n1 3 2\n', '2\n1 2\n'] Demo Output: ['1\n', '-1\n', '0\n'] Note: none
```python n = int(input()) a = list(map(int, input().split())) if a == sorted(a): print(0) else: for i in range(len(a)): if a[i] > a[i+1]: break lst = list(a[i+1:]) if not sorted(lst) == lst[::-1]: print(-1) else: a = lst[::-1] + a[:i+1] if a == sorted(a): print(n-(i+1)) else: print(-1) ```
0
47
B
Coins
PROGRAMMING
1,200
[ "implementation" ]
B. Coins
2
256
One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal.
The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B.
It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights.
[ "A&gt;B\nC&lt;B\nA&gt;C\n", "A&lt;B\nB&gt;C\nC&gt;A\n" ]
[ "CBA", "ACB" ]
none
1,000
[ { "input": "A>B\nC<B\nA>C", "output": "CBA" }, { "input": "A<B\nB>C\nC>A", "output": "ACB" }, { "input": "A<C\nB<A\nB>C", "output": "Impossible" }, { "input": "A<B\nA<C\nB>C", "output": "ACB" }, { "input": "B>A\nC<B\nC>A", "output": "ACB" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "A>C\nA>B\nB<C", "output": "BCA" }, { "input": "C<B\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nA>B\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nA<C", "output": "ABC" }, { "input": "C<B\nB<A\nC>A", "output": "Impossible" }, { "input": "B<C\nC<A\nA>B", "output": "BCA" }, { "input": "A>B\nC<B\nC<A", "output": "CBA" }, { "input": "B>A\nC>B\nA>C", "output": "Impossible" }, { "input": "B<A\nC>B\nC>A", "output": "BAC" }, { "input": "A<B\nC>B\nA<C", "output": "ABC" }, { "input": "A<B\nC<A\nB<C", "output": "Impossible" }, { "input": "A>C\nC<B\nB>A", "output": "CAB" }, { "input": "C>A\nA<B\nB>C", "output": "ACB" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "B>C\nB>A\nA<C", "output": "ACB" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA<B\nB>C", "output": "ACB" }, { "input": "B>A\nA>C\nB>C", "output": "CAB" }, { "input": "B<A\nA<C\nC<B", "output": "Impossible" }, { "input": "A<C\nB>C\nA>B", "output": "Impossible" }, { "input": "B>A\nC<A\nC>B", "output": "Impossible" }, { "input": "A>C\nC>B\nB<A", "output": "BCA" }, { "input": "B<C\nB<A\nA>C", "output": "BCA" }, { "input": "A>B\nC>B\nA<C", "output": "BAC" }, { "input": "C<B\nC<A\nB<A", "output": "CBA" }, { "input": "A<C\nA>B\nB>C", "output": "Impossible" }, { "input": "B>A\nB>C\nA<C", "output": "ACB" }, { "input": "B>C\nC<A\nB<A", "output": "CBA" }, { "input": "C>A\nB>A\nB>C", "output": "ACB" }, { "input": "B<A\nB>C\nA<C", "output": "Impossible" }, { "input": "B<C\nA<B\nC>A", "output": "ABC" }, { "input": "C<B\nB>A\nA>C", "output": "CAB" }, { "input": "A>B\nC>A\nB<C", "output": "BAC" }, { "input": "A>B\nB>C\nC<A", "output": "CBA" }, { "input": "B>C\nC>A\nA>B", "output": "Impossible" }, { "input": "B<A\nB>C\nC<A", "output": "CBA" }, { "input": "C>B\nB>A\nC>A", "output": "ABC" }, { "input": "A>C\nA>B\nB>C", "output": "CBA" }, { "input": "B<C\nA>B\nA<C", "output": "BAC" }, { "input": "C>A\nC<B\nB>A", "output": "ACB" }, { "input": "C>B\nA<B\nC<A", "output": "Impossible" }, { "input": "A<C\nC<B\nA>B", "output": "Impossible" }, { "input": "B>C\nA<B\nA<C", "output": "ACB" }, { "input": "C>A\nA<B\nC>B", "output": "ABC" } ]
1,591,509,426
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
186
307,200
x=input() y=input() z=input() if(x[1]=='>'): firstbig=x[0] second=x[2] else: firstbig=x[2] second=x[0] if(firstbig in y): if(y[0]==firstbig): if(y[1]=='>'): thebigest=firstbig if(z[1]=='>'): mid=z[0] second=z[2] else: mid=z[2] second=z[0] else: mid=firstbig thebigest=y[2] elif(y[2]==firstbig): if (y[1] == '<'): thebigest = firstbig if (z[1] == '>'): mid = z[0] second = z[2] else: mid = z[2] second = z[0] else: mid = firstbig thebigest = y[2] elif(firstbig in z): if(z[0]==firstbig): if(z[1]=='>'): thebigest=firstbig if (y[1] == '>'): mid = y[0] second = y[2] else: mid = y[2] second = y[0] else: mid=firstbig thebigest=z[2] elif(z[2]==firstbig): if (z[1] == '<'): thebigest = firstbig if (y[1] == '>'): mid = y[0] second = y[2] else: mid = y[2] second = y[0] else: mid = firstbig thebigest = z[2] final=second+mid+thebigest print(final)
Title: Coins Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: One day Vasya came across three Berland coins. They didn't have any numbers that's why Vasya didn't understand how their denominations differ. He supposed that if one coin is heavier than the other one, then it should be worth more. Vasya weighed all the three pairs of coins on pan balance scales and told you the results. Find out how the deminations of the coins differ or if Vasya has a mistake in the weighting results. No two coins are equal. Input Specification: The input data contains the results of all the weighting, one result on each line. It is guaranteed that every coin pair was weighted exactly once. Vasya labelled the coins with letters «A», «B» and «C». Each result is a line that appears as (letter)(&gt; or &lt; sign)(letter). For example, if coin "A" proved lighter than coin "B", the result of the weighting is A&lt;B. Output Specification: It the results are contradictory, print Impossible. Otherwise, print without spaces the rearrangement of letters «A», «B» and «C» which represent the coins in the increasing order of their weights. Demo Input: ['A&gt;B\nC&lt;B\nA&gt;C\n', 'A&lt;B\nB&gt;C\nC&gt;A\n'] Demo Output: ['CBA', 'ACB'] Note: none
```python x=input() y=input() z=input() if(x[1]=='>'): firstbig=x[0] second=x[2] else: firstbig=x[2] second=x[0] if(firstbig in y): if(y[0]==firstbig): if(y[1]=='>'): thebigest=firstbig if(z[1]=='>'): mid=z[0] second=z[2] else: mid=z[2] second=z[0] else: mid=firstbig thebigest=y[2] elif(y[2]==firstbig): if (y[1] == '<'): thebigest = firstbig if (z[1] == '>'): mid = z[0] second = z[2] else: mid = z[2] second = z[0] else: mid = firstbig thebigest = y[2] elif(firstbig in z): if(z[0]==firstbig): if(z[1]=='>'): thebigest=firstbig if (y[1] == '>'): mid = y[0] second = y[2] else: mid = y[2] second = y[0] else: mid=firstbig thebigest=z[2] elif(z[2]==firstbig): if (z[1] == '<'): thebigest = firstbig if (y[1] == '>'): mid = y[0] second = y[2] else: mid = y[2] second = y[0] else: mid = firstbig thebigest = z[2] final=second+mid+thebigest print(final) ```
0
682
A
Alyona and Numbers
PROGRAMMING
1,100
[ "constructive algorithms", "math", "number theory" ]
null
null
After finishing eating her bun, Alyona came up with two integers *n* and *m*. She decided to write down two columns of integers — the first column containing integers from 1 to *n* and the second containing integers from 1 to *m*. Now the girl wants to count how many pairs of integers she can choose, one from the first column and the other from the second column, such that their sum is divisible by 5. Formally, Alyona wants to count the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and equals 0. As usual, Alyona has some troubles and asks you to help.
The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1<=000<=000).
Print the only integer — the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and (*x*<=+<=*y*) is divisible by 5.
[ "6 12\n", "11 14\n", "1 5\n", "3 8\n", "5 7\n", "21 21\n" ]
[ "14\n", "31\n", "1\n", "5\n", "7\n", "88\n" ]
Following pairs are suitable in the first sample case: - for *x* = 1 fits *y* equal to 4 or 9; - for *x* = 2 fits *y* equal to 3 or 8; - for *x* = 3 fits *y* equal to 2, 7 or 12; - for *x* = 4 fits *y* equal to 1, 6 or 11; - for *x* = 5 fits *y* equal to 5 or 10; - for *x* = 6 fits *y* equal to 4 or 9. Only the pair (1, 4) is suitable in the third sample case.
500
[ { "input": "6 12", "output": "14" }, { "input": "11 14", "output": "31" }, { "input": "1 5", "output": "1" }, { "input": "3 8", "output": "5" }, { "input": "5 7", "output": "7" }, { "input": "21 21", "output": "88" }, { "input": "10 15", "output": "30" }, { "input": "1 1", "output": "0" }, { "input": "1 1000000", "output": "200000" }, { "input": "1000000 1", "output": "200000" }, { "input": "1000000 1000000", "output": "200000000000" }, { "input": "944 844", "output": "159348" }, { "input": "368 984", "output": "72423" }, { "input": "792 828", "output": "131155" }, { "input": "920 969", "output": "178296" }, { "input": "640 325", "output": "41600" }, { "input": "768 170", "output": "26112" }, { "input": "896 310", "output": "55552" }, { "input": "320 154", "output": "9856" }, { "input": "744 999", "output": "148652" }, { "input": "630 843", "output": "106218" }, { "input": "54 688", "output": "7431" }, { "input": "478 828", "output": "79157" }, { "input": "902 184", "output": "33194" }, { "input": "31 29", "output": "180" }, { "input": "751 169", "output": "25384" }, { "input": "879 14", "output": "2462" }, { "input": "7 858", "output": "1201" }, { "input": "431 702", "output": "60512" }, { "input": "855 355", "output": "60705" }, { "input": "553 29", "output": "3208" }, { "input": "721767 525996", "output": "75929310986" }, { "input": "805191 74841", "output": "12052259926" }, { "input": "888615 590981", "output": "105030916263" }, { "input": "4743 139826", "output": "132638943" }, { "input": "88167 721374", "output": "12720276292" }, { "input": "171591 13322", "output": "457187060" }, { "input": "287719 562167", "output": "32349225415" }, { "input": "371143 78307", "output": "5812618980" }, { "input": "487271 627151", "output": "61118498984" }, { "input": "261436 930642", "output": "48660664382" }, { "input": "377564 446782", "output": "33737759810" }, { "input": "460988 28330", "output": "2611958008" }, { "input": "544412 352983", "output": "38433636199" }, { "input": "660540 869123", "output": "114818101284" }, { "input": "743964 417967", "output": "62190480238" }, { "input": "827388 966812", "output": "159985729411" }, { "input": "910812 515656", "output": "93933134534" }, { "input": "26940 64501", "output": "347531388" }, { "input": "110364 356449", "output": "7867827488" }, { "input": "636358 355531", "output": "45248999219" }, { "input": "752486 871672", "output": "131184195318" }, { "input": "803206 420516", "output": "67552194859" }, { "input": "919334 969361", "output": "178233305115" }, { "input": "35462 261309", "output": "1853307952" }, { "input": "118887 842857", "output": "20040948031" }, { "input": "202311 358998", "output": "14525848875" }, { "input": "285735 907842", "output": "51880446774" }, { "input": "401863 456686", "output": "36705041203" }, { "input": "452583 972827", "output": "88056992428" }, { "input": "235473 715013", "output": "33673251230" }, { "input": "318897 263858", "output": "16828704925" }, { "input": "402321 812702", "output": "65393416268" }, { "input": "518449 361546", "output": "37488632431" }, { "input": "634577 910391", "output": "115542637921" }, { "input": "685297 235043", "output": "32214852554" }, { "input": "801425 751183", "output": "120403367155" }, { "input": "884849 300028", "output": "53095895155" }, { "input": "977 848872", "output": "165869588" }, { "input": "51697 397716", "output": "4112144810" }, { "input": "834588 107199", "output": "17893399803" }, { "input": "918012 688747", "output": "126455602192" }, { "input": "1436 237592", "output": "68236422" }, { "input": "117564 753732", "output": "17722349770" }, { "input": "200988 302576", "output": "12162829017" }, { "input": "284412 818717", "output": "46570587880" }, { "input": "400540 176073", "output": "14104855884" }, { "input": "483964 724917", "output": "70166746198" }, { "input": "567388 241058", "output": "27354683301" }, { "input": "650812 789902", "output": "102815540084" }, { "input": "400999 756281", "output": "60653584944" }, { "input": "100 101", "output": "2020" }, { "input": "100 102", "output": "2040" }, { "input": "103 100", "output": "2060" }, { "input": "100 104", "output": "2080" }, { "input": "3 4", "output": "3" }, { "input": "11 23", "output": "50" }, { "input": "8 14", "output": "23" }, { "input": "23423 34234", "output": "160372597" }, { "input": "1 4", "output": "1" }, { "input": "999999 999999", "output": "199999600001" }, { "input": "82 99", "output": "1624" }, { "input": "21 18", "output": "75" }, { "input": "234 234", "output": "10952" }, { "input": "4 4", "output": "4" }, { "input": "6 13", "output": "15" }, { "input": "3 9", "output": "6" }, { "input": "99999 99999", "output": "1999960001" }, { "input": "34 33", "output": "225" }, { "input": "2 2", "output": "0" }, { "input": "333 1", "output": "66" }, { "input": "3 3", "output": "2" }, { "input": "8 2", "output": "3" }, { "input": "2179 2218", "output": "966605" }, { "input": "1000000 999999", "output": "199999800000" }, { "input": "873828 774207", "output": "135304750879" }, { "input": "13 19", "output": "50" }, { "input": "1648 576469", "output": "190004183" }, { "input": "11 13", "output": "28" }, { "input": "5 8", "output": "8" }, { "input": "650074 943659", "output": "122689636154" }, { "input": "1 3", "output": "0" }, { "input": "54 43", "output": "465" }, { "input": "14 9", "output": "26" }, { "input": "2 3", "output": "1" }, { "input": "543 534", "output": "57993" }, { "input": "321 123", "output": "7896" }, { "input": "21 3", "output": "12" }, { "input": "2 1", "output": "0" }, { "input": "4 3", "output": "3" }, { "input": "47474 74747", "output": "709707816" }, { "input": "4 9", "output": "8" }, { "input": "7 4", "output": "6" }, { "input": "9 4", "output": "8" }, { "input": "12414 4214", "output": "10462520" }, { "input": "2 9", "output": "4" }, { "input": "253 821", "output": "41542" }, { "input": "2 4", "output": "2" } ]
1,599,210,992
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
9
1,000
134,041,600
def solve(): n, m = map(int, input().split()) x = n+m -((n + m) % 5) div = list(range(0, x+1, 5))[1:] res = set([]) for i in range(1, n+1): for j in div: if (j - i % j) <= max(n, m): res.add((i, (j - i % j))) print(len(res)) solve()
Title: Alyona and Numbers Time Limit: None seconds Memory Limit: None megabytes Problem Description: After finishing eating her bun, Alyona came up with two integers *n* and *m*. She decided to write down two columns of integers — the first column containing integers from 1 to *n* and the second containing integers from 1 to *m*. Now the girl wants to count how many pairs of integers she can choose, one from the first column and the other from the second column, such that their sum is divisible by 5. Formally, Alyona wants to count the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and equals 0. As usual, Alyona has some troubles and asks you to help. Input Specification: The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1<=000<=000). Output Specification: Print the only integer — the number of pairs of integers (*x*,<=*y*) such that 1<=≤<=*x*<=≤<=*n*, 1<=≤<=*y*<=≤<=*m* and (*x*<=+<=*y*) is divisible by 5. Demo Input: ['6 12\n', '11 14\n', '1 5\n', '3 8\n', '5 7\n', '21 21\n'] Demo Output: ['14\n', '31\n', '1\n', '5\n', '7\n', '88\n'] Note: Following pairs are suitable in the first sample case: - for *x* = 1 fits *y* equal to 4 or 9; - for *x* = 2 fits *y* equal to 3 or 8; - for *x* = 3 fits *y* equal to 2, 7 or 12; - for *x* = 4 fits *y* equal to 1, 6 or 11; - for *x* = 5 fits *y* equal to 5 or 10; - for *x* = 6 fits *y* equal to 4 or 9. Only the pair (1, 4) is suitable in the third sample case.
```python def solve(): n, m = map(int, input().split()) x = n+m -((n + m) % 5) div = list(range(0, x+1, 5))[1:] res = set([]) for i in range(1, n+1): for j in div: if (j - i % j) <= max(n, m): res.add((i, (j - i % j))) print(len(res)) solve() ```
0
313
A
Ilya and Bank Account
PROGRAMMING
900
[ "implementation", "number theory" ]
null
null
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account.
In a single line print an integer — the maximum state of the bank account that Ilya can get.
[ "2230\n", "-10\n", "-100003\n" ]
[ "2230\n", "0\n", "-10000\n" ]
In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
500
[ { "input": "2230", "output": "2230" }, { "input": "-10", "output": "0" }, { "input": "-100003", "output": "-10000" }, { "input": "544883178", "output": "544883178" }, { "input": "-847251738", "output": "-84725173" }, { "input": "423654797", "output": "423654797" }, { "input": "-623563697", "output": "-62356367" }, { "input": "645894116", "output": "645894116" }, { "input": "-384381709", "output": "-38438170" }, { "input": "437587210", "output": "437587210" }, { "input": "-297534606", "output": "-29753460" }, { "input": "891773002", "output": "891773002" }, { "input": "-56712976", "output": "-5671296" }, { "input": "963662765", "output": "963662765" }, { "input": "-272656295", "output": "-27265625" }, { "input": "383441522", "output": "383441522" }, { "input": "-477665112", "output": "-47766511" }, { "input": "791725034", "output": "791725034" }, { "input": "-812168727", "output": "-81216872" }, { "input": "528894922", "output": "528894922" }, { "input": "-479977172", "output": "-47997712" }, { "input": "568044564", "output": "568044564" }, { "input": "-392784794", "output": "-39278474" }, { "input": "925596634", "output": "925596634" }, { "input": "-836078769", "output": "-83607876" }, { "input": "71036059", "output": "71036059" }, { "input": "-337396162", "output": "-33739612" }, { "input": "87129297", "output": "87129297" }, { "input": "-648171877", "output": "-64817187" }, { "input": "20218400", "output": "20218400" }, { "input": "10", "output": "10" }, { "input": "1000000000", "output": "1000000000" }, { "input": "-1000000000", "output": "-100000000" }, { "input": "-102", "output": "-10" }, { "input": "-120", "output": "-10" }, { "input": "-20", "output": "0" }, { "input": "-15", "output": "-1" }, { "input": "-5575533", "output": "-557553" }, { "input": "-50", "output": "0" }, { "input": "-31", "output": "-1" }, { "input": "-55", "output": "-5" }, { "input": "-81", "output": "-1" }, { "input": "-99", "output": "-9" }, { "input": "-23", "output": "-2" }, { "input": "-41", "output": "-1" }, { "input": "-24", "output": "-2" }, { "input": "46", "output": "46" } ]
1,696,868,272
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
1
154
0
n = int(input()) strN = str(n) length = len(strN) ans1 = int(strN[0:length-1]) ans2 = int(strN[0:length-2] + strN[length-1]) if ans1>n: print(ans1) elif ans2>n: print(ans2) else: print(n)
Title: Ilya and Bank Account Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift. Input Specification: The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account. Output Specification: In a single line print an integer — the maximum state of the bank account that Ilya can get. Demo Input: ['2230\n', '-10\n', '-100003\n'] Demo Output: ['2230\n', '0\n', '-10000\n'] Note: In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
```python n = int(input()) strN = str(n) length = len(strN) ans1 = int(strN[0:length-1]) ans2 = int(strN[0:length-2] + strN[length-1]) if ans1>n: print(ans1) elif ans2>n: print(ans2) else: print(n) ```
0
315
B
Sereja and Array
PROGRAMMING
1,200
[ "implementation" ]
null
null
Sereja has got an array, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n*. Sereja is an active boy, so he is now going to complete *m* operations. Each operation will have one of the three forms: 1. Make *v**i*-th array element equal to *x**i*. In other words, perform the assignment *a**v**i*<==<=*x**i*. 1. Increase each array element by *y**i*. In other words, perform *n* assignments *a**i*<==<=*a**i*<=+<=*y**i* (1<=≤<=*i*<=≤<=*n*). 1. Take a piece of paper and write out the *q**i*-th array element. That is, the element *a**q**i*. Help Sereja, complete all his operations.
The first line contains integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the original array. Next *m* lines describe operations, the *i*-th line describes the *i*-th operation. The first number in the *i*-th line is integer *t**i* (1<=≤<=*t**i*<=≤<=3) that represents the operation type. If *t**i*<==<=1, then it is followed by two integers *v**i* and *x**i*, (1<=≤<=*v**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=109). If *t**i*<==<=2, then it is followed by integer *y**i* (1<=≤<=*y**i*<=≤<=104). And if *t**i*<==<=3, then it is followed by integer *q**i* (1<=≤<=*q**i*<=≤<=*n*).
For each third type operation print value *a**q**i*. Print the values in the order, in which the corresponding queries follow in the input.
[ "10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9\n" ]
[ "2\n9\n11\n20\n30\n40\n39\n" ]
none
1,000
[ { "input": "10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9", "output": "2\n9\n11\n20\n30\n40\n39" }, { "input": "1 3\n1\n1 1 2\n2 1\n3 1", "output": "3" }, { "input": "1 1\n1\n3 1", "output": "1" }, { "input": "6 6\n202714501 613423725 367325359 862808465 182588146 745008828\n2 492\n2 1943\n1 3 173984392\n1 3 9356383\n3 4\n1 5 472683539", "output": "862810900" }, { "input": "6 5\n545129895 918519812 2334334 565540665 484519712 904102869\n3 3\n1 2 641196860\n2 779\n2 3036\n3 1", "output": "2334334\n545133710" }, { "input": "5 5\n286163265 724763447 761775891 215352371 491215007\n1 4 780579549\n1 2 638546757\n3 4\n1 3 38072627\n2 6119", "output": "780579549" }, { "input": "4 4\n529316834 995684640 949078705 317773978\n3 3\n3 1\n2 6271\n1 1 856879574", "output": "949078705\n529316834" }, { "input": "5 4\n293170637 715384768 756975575 129004053 875201151\n1 3 695181967\n3 3\n2 2288\n1 5 332270946", "output": "695181967" } ]
1,665,756,035
2,147,483,647
Python 3
OK
TESTS
34
919
9,113,600
n, m = map(int, input().split()) arr = [int(x) for x in input().split()] total = 0 for _ in range(m): op = [int(x) for x in input().split()] if op[0] == 1: idx = op[1]-1 arr[idx] = op[2]-total elif op[0] == 2: total += op[1] else: idx = op[1]-1 print(arr[idx]+total)
Title: Sereja and Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja has got an array, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n*. Sereja is an active boy, so he is now going to complete *m* operations. Each operation will have one of the three forms: 1. Make *v**i*-th array element equal to *x**i*. In other words, perform the assignment *a**v**i*<==<=*x**i*. 1. Increase each array element by *y**i*. In other words, perform *n* assignments *a**i*<==<=*a**i*<=+<=*y**i* (1<=≤<=*i*<=≤<=*n*). 1. Take a piece of paper and write out the *q**i*-th array element. That is, the element *a**q**i*. Help Sereja, complete all his operations. Input Specification: The first line contains integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the original array. Next *m* lines describe operations, the *i*-th line describes the *i*-th operation. The first number in the *i*-th line is integer *t**i* (1<=≤<=*t**i*<=≤<=3) that represents the operation type. If *t**i*<==<=1, then it is followed by two integers *v**i* and *x**i*, (1<=≤<=*v**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=109). If *t**i*<==<=2, then it is followed by integer *y**i* (1<=≤<=*y**i*<=≤<=104). And if *t**i*<==<=3, then it is followed by integer *q**i* (1<=≤<=*q**i*<=≤<=*n*). Output Specification: For each third type operation print value *a**q**i*. Print the values in the order, in which the corresponding queries follow in the input. Demo Input: ['10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9\n'] Demo Output: ['2\n9\n11\n20\n30\n40\n39\n'] Note: none
```python n, m = map(int, input().split()) arr = [int(x) for x in input().split()] total = 0 for _ in range(m): op = [int(x) for x in input().split()] if op[0] == 1: idx = op[1]-1 arr[idx] = op[2]-total elif op[0] == 2: total += op[1] else: idx = op[1]-1 print(arr[idx]+total) ```
3
549
E
Sasha Circle
PROGRAMMING
2,700
[ "geometry", "math" ]
null
null
Berlanders like to eat cones after a hard day. Misha Square and Sasha Circle are local authorities of Berland. Each of them controls its points of cone trade. Misha has *n* points, Sasha — *m*. Since their subordinates constantly had conflicts with each other, they decided to build a fence in the form of a circle, so that the points of trade of one businessman are strictly inside a circle, and points of the other one are strictly outside. It doesn't matter which of the two gentlemen will have his trade points inside the circle. Determine whether they can build a fence or not.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=10000), numbers of Misha's and Sasha's trade points respectively. The next *n* lines contains pairs of space-separated integers *M**x*,<=*M**y* (<=-<=104<=≤<=*M**x*,<=*M**y*<=≤<=104), coordinates of Misha's trade points. The next *m* lines contains pairs of space-separated integers *S**x*,<=*S**y* (<=-<=104<=≤<=*S**x*,<=*S**y*<=≤<=104), coordinates of Sasha's trade points. It is guaranteed that all *n*<=+<=*m* points are distinct.
The only output line should contain either word "YES" without quotes in case it is possible to build a such fence or word "NO" in the other case.
[ "2 2\n-1 0\n1 0\n0 -1\n0 1\n", "4 4\n1 0\n0 1\n-1 0\n0 -1\n1 1\n-1 1\n-1 -1\n1 -1\n" ]
[ "NO\n", "YES\n" ]
In the first sample there is no possibility to separate points, because any circle that contains both points ( - 1, 0), (1, 0) also contains at least one point from the set (0,  - 1), (0, 1), and vice-versa: any circle that contains both points (0,  - 1), (0, 1) also contains at least one point from the set ( - 1, 0), (1, 0) In the second sample one of the possible solution is shown below. Misha's points are marked with red colour and Sasha's are marked with blue. <img class="tex-graphics" src="https://espresso.codeforces.com/91e76198f6d74c0a8b0f92c94460d887bfebc9fa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
3,000
[ { "input": "2 2\n-1 0\n1 0\n0 -1\n0 1", "output": "NO" }, { "input": "4 4\n1 0\n0 1\n-1 0\n0 -1\n1 1\n-1 1\n-1 -1\n1 -1", "output": "YES" }, { "input": "2 3\n-1 0\n1 0\n0 -2\n0 0\n0 2", "output": "NO" }, { "input": "3 3\n-3 -4\n3 2\n1 5\n4 0\n5 2\n-2 -1", "output": "NO" }, { "input": "3 4\n-9998 -10000\n-10000 -9998\n-9999 -9999\n-9997 9996\n-9996 9997\n-9998 9995\n-9995 9998", "output": "YES" }, { "input": "1 1\n-1908 8645\n-8559 3388", "output": "YES" }, { "input": "1 2\n8961 -7819\n-3068 -3093\n-742 4108", "output": "YES" }, { "input": "2 1\n-7087 5671\n7159 -5255\n-9508 -2160", "output": "YES" }, { "input": "2 2\n3782 2631\n2352 -5158\n-1702 -700\n-3472 -117", "output": "YES" }, { "input": "2 10\n-1 0\n1 0\n9 9\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8", "output": "YES" }, { "input": "3 3\n-9140 650\n-9126 669\n-9112 688\n-9084 726\n-9098 707\n-9070 745", "output": "YES" }, { "input": "3 3\n8410 -3760\n8419 -3752\n8428 -3744\n8455 -3720\n8446 -3728\n8437 -3736", "output": "YES" }, { "input": "3 3\n9551 -9949\n-48 50\n-24 25\n0 0\n9575 -9974\n-9599 9999", "output": "YES" }, { "input": "3 2\n9599 -9999\n-9599 9999\n0 0\n-9575 9974\n9575 -9974", "output": "NO" }, { "input": "10 10\n971 -2437\n-3336 3332\n-7503 -8713\n-9337 -9607\n-927 -9162\n-4375 -3790\n-913 -257\n-5916 5783\n5131 -7304\n9993 -9999\n-2774 8057\n8670 -7936\n8388 3302\n8718 -4865\n3329 -3334\n5088 -1539\n5050 8130\n4710 -2803\n8124 -4062\n-10000 9997", "output": "YES" }, { "input": "3 3\n-1852 -9408\n-2082 -9212\n-1967 -9310\n-1737 -9506\n-1507 -9702\n-1622 -9604", "output": "YES" }, { "input": "2 10\n-1 0\n0 -1\n-9 -9\n0 0\n-1 -1\n-2 -2\n-3 -3\n-4 -4\n-5 -5\n-6 -6\n-7 -7\n-8 -8", "output": "NO" }, { "input": "2 10\n1 0\n0 1\n9 9\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8", "output": "NO" }, { "input": "2 3\n0 -1\n0 1\n-2 0\n0 0\n2 0", "output": "NO" }, { "input": "2 10\n-1 0\n1 0\n-9 -9\n0 0\n-1 -1\n-2 -2\n-3 -3\n-4 -4\n-5 -5\n-6 -6\n-7 -7\n-8 -8", "output": "YES" } ]
1,434,465,402
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
9
61
307,200
import math def calr(a, b, c): x = ((a[0] ** 2 - b[0] ** 2 + a[1] ** 2 - b[1] ** 2) * (a[1] - c[1]) - (a[0] ** 2 - c[0] ** 2 + a[1] ** 2 - c[1] ** 2) * (a[1] - b[1])) / (2 * (a[1] - c[1]) * (a[0] - b[0]) - 2 * (a[1] - b[1]) * (a[0] - c[0])) y = ((a[0] ** 2 - b[0] ** 2 + a[1] ** 2 - b[1] ** 2) * (a[0] - c[0]) - (a[0] ** 2 - c[0] ** 2 + a[1] ** 2 - c[1] ** 2) * (a[0] - b[0])) / (2 * (a[1] - b[1]) * (a[0] - c[0]) - 2 * (a[1] - c[1]) * (a[0] - b[0])) r2 = (x - a[0]) ** 2 + (y - a[1]) ** 2 return [x, y], r2 class Circle: def __init__(self): self.c = [0, 0] self.r = 0 self.points = list() def insert(self, x, y): self.points.append([x, y]) def calculate(self): l2 = 0 points = [[0, 0], [0, 0]] tpoints = list() for i in range(len(self.points)): for j in range(i): length2 = (self.points[i][0] - self.points[j][0]) ** 2 + (self.points[i][1] - self.points[j][1]) ** 2 if length2 > l2: l2 = length2 points = [self.points[i], self.points[j]] for i in self.points: if i not in points: a = (i[0] - points[0][0]) ** 2 + (i[1] - points[0][1]) ** 2 b = (i[0] - points[1][0]) ** 2 + (i[1] - points[1][1]) ** 2 if a + b > l2: tpoints.append(i) if len(tpoints) == 0: self.r = math.sqrt(l2) / 2 self.c = [(points[0][0] + points[1][0]) / 2, (points[0][1] + points[1][1]) / 2] else: r2 = 0 rpoint = [0, 0] for i in tpoints: pos, pr2 = calr(points[0], points[1], i) if pr2 > r2: r2 = pr2 rpoint = pos self.c = rpoint self.r = math.sqrt(r2) def isin(self, x, y): l = math.sqrt((self.c[0] - x) ** 2 + (self.c[1] - y) ** 2) if l <= self.r: return True else: return False state1 = True state2 = True circle1 = Circle() circle2 = Circle() m, n = input().split(' ') m, n = int(m), int(n) for i in range(m): x, y = input().split(' ') circle1.insert(int(x), int(y)) for i in range(n): x, y = input().split(' ') circle2.insert(int(x), int(y)) if m == 1 or n == 1: print('YES') exit() circle1.calculate() circle2.calculate() for i in circle2.points: if circle1.isin(i[0], i[1]): state1 = False for i in circle1.points: if circle2.isin(i[0], i[1]): state2 = False if state1 or state2: print('YES') else: print('NO')
Title: Sasha Circle Time Limit: None seconds Memory Limit: None megabytes Problem Description: Berlanders like to eat cones after a hard day. Misha Square and Sasha Circle are local authorities of Berland. Each of them controls its points of cone trade. Misha has *n* points, Sasha — *m*. Since their subordinates constantly had conflicts with each other, they decided to build a fence in the form of a circle, so that the points of trade of one businessman are strictly inside a circle, and points of the other one are strictly outside. It doesn't matter which of the two gentlemen will have his trade points inside the circle. Determine whether they can build a fence or not. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=10000), numbers of Misha's and Sasha's trade points respectively. The next *n* lines contains pairs of space-separated integers *M**x*,<=*M**y* (<=-<=104<=≤<=*M**x*,<=*M**y*<=≤<=104), coordinates of Misha's trade points. The next *m* lines contains pairs of space-separated integers *S**x*,<=*S**y* (<=-<=104<=≤<=*S**x*,<=*S**y*<=≤<=104), coordinates of Sasha's trade points. It is guaranteed that all *n*<=+<=*m* points are distinct. Output Specification: The only output line should contain either word "YES" without quotes in case it is possible to build a such fence or word "NO" in the other case. Demo Input: ['2 2\n-1 0\n1 0\n0 -1\n0 1\n', '4 4\n1 0\n0 1\n-1 0\n0 -1\n1 1\n-1 1\n-1 -1\n1 -1\n'] Demo Output: ['NO\n', 'YES\n'] Note: In the first sample there is no possibility to separate points, because any circle that contains both points ( - 1, 0), (1, 0) also contains at least one point from the set (0,  - 1), (0, 1), and vice-versa: any circle that contains both points (0,  - 1), (0, 1) also contains at least one point from the set ( - 1, 0), (1, 0) In the second sample one of the possible solution is shown below. Misha's points are marked with red colour and Sasha's are marked with blue. <img class="tex-graphics" src="https://espresso.codeforces.com/91e76198f6d74c0a8b0f92c94460d887bfebc9fa.png" style="max-width: 100.0%;max-height: 100.0%;"/>
```python import math def calr(a, b, c): x = ((a[0] ** 2 - b[0] ** 2 + a[1] ** 2 - b[1] ** 2) * (a[1] - c[1]) - (a[0] ** 2 - c[0] ** 2 + a[1] ** 2 - c[1] ** 2) * (a[1] - b[1])) / (2 * (a[1] - c[1]) * (a[0] - b[0]) - 2 * (a[1] - b[1]) * (a[0] - c[0])) y = ((a[0] ** 2 - b[0] ** 2 + a[1] ** 2 - b[1] ** 2) * (a[0] - c[0]) - (a[0] ** 2 - c[0] ** 2 + a[1] ** 2 - c[1] ** 2) * (a[0] - b[0])) / (2 * (a[1] - b[1]) * (a[0] - c[0]) - 2 * (a[1] - c[1]) * (a[0] - b[0])) r2 = (x - a[0]) ** 2 + (y - a[1]) ** 2 return [x, y], r2 class Circle: def __init__(self): self.c = [0, 0] self.r = 0 self.points = list() def insert(self, x, y): self.points.append([x, y]) def calculate(self): l2 = 0 points = [[0, 0], [0, 0]] tpoints = list() for i in range(len(self.points)): for j in range(i): length2 = (self.points[i][0] - self.points[j][0]) ** 2 + (self.points[i][1] - self.points[j][1]) ** 2 if length2 > l2: l2 = length2 points = [self.points[i], self.points[j]] for i in self.points: if i not in points: a = (i[0] - points[0][0]) ** 2 + (i[1] - points[0][1]) ** 2 b = (i[0] - points[1][0]) ** 2 + (i[1] - points[1][1]) ** 2 if a + b > l2: tpoints.append(i) if len(tpoints) == 0: self.r = math.sqrt(l2) / 2 self.c = [(points[0][0] + points[1][0]) / 2, (points[0][1] + points[1][1]) / 2] else: r2 = 0 rpoint = [0, 0] for i in tpoints: pos, pr2 = calr(points[0], points[1], i) if pr2 > r2: r2 = pr2 rpoint = pos self.c = rpoint self.r = math.sqrt(r2) def isin(self, x, y): l = math.sqrt((self.c[0] - x) ** 2 + (self.c[1] - y) ** 2) if l <= self.r: return True else: return False state1 = True state2 = True circle1 = Circle() circle2 = Circle() m, n = input().split(' ') m, n = int(m), int(n) for i in range(m): x, y = input().split(' ') circle1.insert(int(x), int(y)) for i in range(n): x, y = input().split(' ') circle2.insert(int(x), int(y)) if m == 1 or n == 1: print('YES') exit() circle1.calculate() circle2.calculate() for i in circle2.points: if circle1.isin(i[0], i[1]): state1 = False for i in circle1.points: if circle2.isin(i[0], i[1]): state2 = False if state1 or state2: print('YES') else: print('NO') ```
0
916
B
Jamie and Binary Sequence (changed after round)
PROGRAMMING
2,000
[ "bitmasks", "greedy", "math" ]
null
null
Jamie is preparing a Codeforces round. He has got an idea for a problem, but does not know how to solve it. Help him write a solution to the following problem: Find *k* integers such that the sum of two to the power of each number equals to the number *n* and the largest integer in the answer is as small as possible. As there may be multiple answers, you are asked to output the lexicographically largest one. To be more clear, consider all integer sequence with length *k* (*a*1,<=*a*2,<=...,<=*a**k*) with . Give a value to each sequence. Among all sequence(s) that have the minimum *y* value, output the one that is the lexicographically largest. For definitions of powers and lexicographical order see notes.
The first line consists of two integers *n* and *k* (1<=≤<=*n*<=≤<=1018,<=1<=≤<=*k*<=≤<=105) — the required sum and the length of the sequence.
Output "No" (without quotes) in a single line if there does not exist such sequence. Otherwise, output "Yes" (without quotes) in the first line, and *k* numbers separated by space in the second line — the required sequence. It is guaranteed that the integers in the answer sequence fit the range [<=-<=1018,<=1018].
[ "23 5\n", "13 2\n", "1 2\n" ]
[ "Yes\n3 3 2 1 0 \n", "No\n", "Yes\n-1 -1 \n" ]
Sample 1: 2<sup class="upper-index">3</sup> + 2<sup class="upper-index">3</sup> + 2<sup class="upper-index">2</sup> + 2<sup class="upper-index">1</sup> + 2<sup class="upper-index">0</sup> = 8 + 8 + 4 + 2 + 1 = 23 Answers like (3, 3, 2, 0, 1) or (0, 1, 2, 3, 3) are not lexicographically largest. Answers like (4, 1, 1, 1, 0) do not have the minimum *y* value. Sample 2: It can be shown there does not exist a sequence with length 2. Sample 3: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a8539b2d27aefc8d2fab6dfd8296d11c36dcaa40.png" style="max-width: 100.0%;max-height: 100.0%;"/> Powers of 2: If *x* &gt; 0, then 2<sup class="upper-index">*x*</sup> = 2·2·2·...·2 (*x* times). If *x* = 0, then 2<sup class="upper-index">*x*</sup> = 1. If *x* &lt; 0, then <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/766628f1c7814795eac1a0afaa1ff062c40ef29e.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Lexicographical order: Given two different sequences of the same length, (*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ... , *a*<sub class="lower-index">*k*</sub>) and (*b*<sub class="lower-index">1</sub>, *b*<sub class="lower-index">2</sub>, ... , *b*<sub class="lower-index">*k*</sub>), the first one is smaller than the second one for the lexicographical order, if and only if *a*<sub class="lower-index">*i*</sub> &lt; *b*<sub class="lower-index">*i*</sub>, for the first *i* where *a*<sub class="lower-index">*i*</sub> and *b*<sub class="lower-index">*i*</sub> differ.
1,000
[ { "input": "23 5", "output": "Yes\n3 3 2 1 0 " }, { "input": "13 2", "output": "No" }, { "input": "1 2", "output": "Yes\n-1 -1 " }, { "input": "1 1", "output": "Yes\n0 " }, { "input": "1000000000000000000 100000", "output": "Yes\n44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44..." }, { "input": "7 2", "output": "No" }, { "input": "7 3", "output": "Yes\n2 1 0 " }, { "input": "7 4", "output": "Yes\n1 1 1 0 " }, { "input": "521325125150442808 10", "output": "No" }, { "input": "498518679725149504 1000", "output": "Yes\n49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49..." }, { "input": "464823731286228582 100000", "output": "Yes\n43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43..." }, { "input": "1 4", "output": "Yes\n-2 -2 -2 -2 " }, { "input": "9 4", "output": "Yes\n2 2 -1 -1 " }, { "input": "3 4", "output": "Yes\n0 0 -1 -1 " }, { "input": "144 4", "output": "Yes\n6 6 3 3 " }, { "input": "59 4", "output": "No" }, { "input": "78 4", "output": "Yes\n6 3 2 1 " }, { "input": "192 4", "output": "Yes\n6 6 5 5 " }, { "input": "107 4", "output": "No" }, { "input": "552 5", "output": "Yes\n8 8 5 2 2 " }, { "input": "680 5", "output": "Yes\n8 8 7 5 3 " }, { "input": "808 5", "output": "Yes\n8 8 8 5 3 " }, { "input": "1528 5", "output": "No" }, { "input": "1656 5", "output": "No" }, { "input": "26972 8", "output": "Yes\n14 13 11 8 6 4 3 2 " }, { "input": "23100 8", "output": "Yes\n14 12 11 9 5 4 3 2 " }, { "input": "19228 8", "output": "Yes\n13 13 11 9 8 4 3 2 " }, { "input": "22652 8", "output": "Yes\n14 12 11 6 5 4 3 2 " }, { "input": "26076 8", "output": "No" }, { "input": "329438 10", "output": "Yes\n18 16 10 9 7 6 4 3 2 1 " }, { "input": "12862 10", "output": "Yes\n12 12 12 9 5 4 3 2 0 0 " }, { "input": "96286 10", "output": "Yes\n15 15 14 13 12 11 4 3 2 1 " }, { "input": "12414 10", "output": "Yes\n12 12 12 6 5 4 3 2 0 0 " }, { "input": "95838 10", "output": "No" }, { "input": "1728568411 16", "output": "No" }, { "input": "611684539 16", "output": "Yes\n28 28 26 22 21 20 18 16 15 12 7 5 4 3 1 0 " }, { "input": "84735259 16", "output": "Yes\n25 25 24 19 18 15 14 13 12 10 8 4 3 1 -1 -1 " }, { "input": "6967851387 16", "output": "No" }, { "input": "2145934811 16", "output": "No" }, { "input": "6795804571172 20", "output": "Yes\n41 41 41 37 35 34 33 30 26 24 23 18 14 13 12 10 9 5 1 1 " }, { "input": "1038982654596 20", "output": "Yes\n38 38 38 37 36 32 31 30 29 27 21 20 16 13 11 9 7 1 0 0 " }, { "input": "11277865770724 20", "output": "No" }, { "input": "5525338821444 20", "output": "No" }, { "input": "15764221937572 20", "output": "No" }, { "input": "922239521698513045 30", "output": "Yes\n58 58 58 55 54 51 50 46 45 44 41 40 39 38 37 36 34 32 30 29 28 23 21 19 17 15 7 4 2 0 " }, { "input": "923065764876596469 30", "output": "No" }, { "input": "923892008054679893 30", "output": "No" }, { "input": "924718251232763317 30", "output": "Yes\n58 58 58 55 54 52 50 48 46 41 38 36 35 32 31 29 25 19 18 15 12 11 10 8 7 5 4 2 -1 -1 " }, { "input": "925544490115879445 30", "output": "Yes\n59 58 55 54 52 51 45 44 40 39 38 35 34 33 32 30 28 27 26 24 21 19 18 16 14 12 9 4 2 0 " }, { "input": "926370733293962869 30", "output": "Yes\n57 57 57 57 57 57 55 54 52 51 49 48 45 40 38 34 33 28 27 22 19 18 17 10 9 6 5 4 2 0 " }, { "input": "927196976472046293 30", "output": "No" }, { "input": "928023215355162421 30", "output": "Yes\n58 58 58 55 54 53 48 37 36 33 31 27 26 25 23 19 18 17 16 14 13 11 10 9 8 5 4 2 -1 -1 " }, { "input": "928849458533245845 30", "output": "No" }, { "input": "855969764271400156 30", "output": "No" }, { "input": "856796007449483580 30", "output": "No" }, { "input": "857622246332599708 30", "output": "Yes\n58 58 57 56 55 54 53 50 49 47 46 45 41 39 38 37 33 32 31 29 21 15 11 10 8 7 4 3 1 1 " }, { "input": "858448489510683132 30", "output": "No" }, { "input": "859274728393799260 30", "output": "Yes\n59 57 56 55 54 53 51 50 47 46 40 39 38 36 28 26 25 22 21 16 15 14 13 12 10 9 6 4 3 2 " }, { "input": "860100975866849980 30", "output": "No" }, { "input": "860927214749966108 30", "output": "No" }, { "input": "861753457928049532 30", "output": "Yes\n58 58 57 56 55 54 53 52 50 48 47 44 37 36 34 30 26 25 24 23 22 18 12 9 8 6 5 4 3 2 " }, { "input": "862579701106132957 30", "output": "No" }, { "input": "863405944284216381 30", "output": "No" }, { "input": "374585535361966567 30", "output": "No" }, { "input": "4 1", "output": "Yes\n2 " }, { "input": "4 9", "output": "Yes\n-1 -1 -1 -1 -1 -1 -1 -2 -2 " }, { "input": "4 3", "output": "Yes\n1 0 0 " }, { "input": "4 144", "output": "Yes\n-5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -6 -7 -8 -9 -10 -11 -12 -13 -14 -15 -16 -17 -18 -19 -20 -21 -21 " }, { "input": "4 59", "output": "Yes\n-3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -3 -4 -5 -6 -7 -8 -9 -10 -11 -12 -13 -14 -15 -16 -17 -18 -19 -20 -21 -22 -23 -24 -25 -26 -27 -28 -29 -30 -30 " }, { "input": "4 78", "output": "Yes\n-4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -5 -6 -7 -8 -9 -10 -11 -12 -13 -14 -15 -16 -17 -18 -18 " }, { "input": "4 192", "output": "Yes\n-5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -6 -7 -8 -9 -10 -11 -12 -13 -14 -15 -16 -17 -18 -19 -20 -21 -22 -23 -24 -25 -26 -27 -28 -29 -30 -31 -32 -33 -34 -35 -36 -37 -..." }, { "input": "4 107", "output": "Yes\n-4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -5 -6 -7 -8 -9 -10 -11 -12 -13 -14 -15 -16 -17 -18 -19 -20 -21 -22 -23 -24 -25 -26 -27 -28 -29 -30 -31 -32 -33 -34 -35 -36 -37 -38 -39 -40 -41 -42 -43 -44 -45 -46 -47 -47 " }, { "input": "5 552", "output": "Yes\n-6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6..." }, { "input": "5 680", "output": "Yes\n-7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7..." }, { "input": "5 808", "output": "Yes\n-7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7 -7..." }, { "input": "5 1528", "output": "Yes\n-8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8..." }, { "input": "5 1656", "output": "Yes\n-8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8 -8..." }, { "input": "8 26972", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "8 23100", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "8 19228", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "8 22652", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "8 26076", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "23 19354", "output": "Yes\n-9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9..." }, { "input": "23 35482", "output": "Yes\n-10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -1..." }, { "input": "23 18906", "output": "Yes\n-9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9 -9..." }, { "input": "23 2330", "output": "Yes\n-6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6..." }, { "input": "23 85754", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "23 1882", "output": "Yes\n-6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6 -6..." }, { "input": "23 85306", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "23 68730", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "23 84859", "output": "Yes\n-11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -11 -1..." }, { "input": "23 45148", "output": "Yes\n-10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -10 -1..." }, { "input": "281474976710656 5", "output": "Yes\n46 46 46 45 45 " }, { "input": "288230376151973890 5", "output": "Yes\n57 57 18 0 0 " }, { "input": "36029346774812736 5", "output": "Yes\n55 39 15 11 6 " }, { "input": "901283150305558530 5", "output": "No" }, { "input": "288318372649779720 50", "output": "Yes\n53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 53 46 44 35 30 27 17 14 9 2 1 0 -1 -2 -3 -4 -5 -6 -6 " }, { "input": "513703875844698663 50", "output": "Yes\n55 55 55 55 55 55 55 55 55 55 55 55 55 55 53 48 43 41 39 38 37 36 34 27 26 25 24 22 21 20 18 17 15 14 13 12 9 5 2 1 -1 -2 -3 -4 -5 -6 -7 -8 -9 -9 " }, { "input": "287632104387196918 50", "output": "Yes\n57 56 55 54 53 52 51 50 48 47 46 44 43 42 41 40 39 38 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 13 12 10 9 8 7 6 5 4 2 1 " }, { "input": "864690028406636543 58", "output": "Yes\n58 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 39 38 37 36 35 34 33 32 31 30 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 " }, { "input": "576460752303423487 60", "output": "Yes\n57 57 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 " }, { "input": "141012366262272 1", "output": "No" }, { "input": "1100585377792 4", "output": "Yes\n39 39 30 13 " }, { "input": "18598239186190594 9", "output": "Yes\n54 49 44 41 40 21 18 8 1 " }, { "input": "18647719372456016 19", "output": "Yes\n51 51 51 51 51 51 51 51 49 46 31 24 20 16 6 3 2 1 1 " }, { "input": "9297478914673158 29", "output": "Yes\n49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 49 48 43 33 18 11 9 2 0 -1 -2 -3 -4 -4 " }, { "input": "668507368948226 39", "output": "Yes\n45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 32 22 16 15 9 0 -1 -2 -3 -4 -5 -6 -7 -8 -9 -10 -11 -12 -13 -13 " }, { "input": "1143595340402690 49", "output": "Yes\n45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 44 36 35 27 25 19 12 0 -1 -2 -3 -4 -5 -6 -7 -8 -8 " }, { "input": "35527987183872 59", "output": "Yes\n40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 40 38 36 24 19 18 17 14 7 6 5 4 3 2 1 0 -1 -2 -3 -4 -5 -6 -7 -8 -9 -10 -11 -11 " }, { "input": "324634416758413825 9", "output": "No" }, { "input": "577030480059438572 19", "output": "Yes\n59 49 42 41 37 35 33 28 26 23 18 12 10 8 7 6 5 3 2 " }, { "input": "185505960265024385 29", "output": "Yes\n54 54 54 54 54 54 54 54 54 54 52 49 48 43 42 39 37 36 29 24 22 20 15 9 8 7 -1 -2 -2 " }, { "input": "57421517433081233 39", "output": "Yes\n52 52 52 52 52 52 52 52 52 52 52 52 51 50 39 36 31 30 28 27 26 24 20 11 10 8 7 4 -1 -2 -3 -4 -5 -6 -7 -8 -9 -10 -10 " }, { "input": "90131572647657641 49", "output": "Yes\n52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 45 44 42 41 37 36 28 25 23 21 20 18 17 7 5 3 -1 -2 -3 -4 -5 -6 -7 -8 -9 -10 -11 -12 -12 " }, { "input": "732268459757413905 59", "output": "Yes\n54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 53 51 48 47 43 41 38 35 31 30 28 20 13 10 9 4 -1 -2 -2 " }, { "input": "226111453445787190 9", "output": "No" }, { "input": "478818723873062027 19", "output": "No" }, { "input": "337790572680259391 29", "output": "Yes\n58 55 53 52 44 41 39 37 36 35 34 30 29 28 26 24 20 18 16 13 10 9 8 5 4 3 2 1 0 " }, { "input": "168057637182978458 39", "output": "Yes\n54 54 54 54 54 54 54 54 54 52 50 48 43 42 41 40 39 34 33 32 31 30 28 26 25 20 18 16 13 12 11 8 7 4 3 0 -1 -2 -2 " }, { "input": "401486559567818547 49", "output": "Yes\n54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 54 52 49 46 44 43 42 40 39 38 37 34 33 28 26 24 21 17 13 11 10 9 8 5 4 1 -1 -1 " }, { "input": "828935109688089201 59", "output": "Yes\n55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 47 46 45 44 43 36 34 33 32 29 25 23 22 19 18 17 15 14 12 11 9 6 5 4 -1 -2 -3 -4 -5 -6 -7 -8 -9 -10 -11 -11 " }, { "input": "954687629161163764 9", "output": "No" }, { "input": "287025268967992526 19", "output": "No" }, { "input": "844118423640988373 29", "output": "No" }, { "input": "128233154575908599 39", "output": "Yes\n56 55 54 50 49 48 47 44 41 40 38 36 35 34 33 32 31 30 29 27 25 23 22 21 19 18 15 13 12 11 10 9 7 6 5 4 2 1 0 " }, { "input": "792058388714085231 49", "output": "Yes\n56 56 56 56 56 56 56 56 56 56 55 54 53 52 51 50 48 47 46 45 44 42 39 38 37 35 30 29 28 26 23 21 19 17 16 15 14 12 11 9 8 6 5 3 2 1 -1 -2 -2 " }, { "input": "827183623566145225 59", "output": "Yes\n55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 55 54 53 52 51 49 47 45 44 43 42 41 40 36 35 34 33 32 30 29 28 27 26 25 23 21 19 18 17 13 12 10 9 7 6 3 -1 -1 " }, { "input": "846113779983498737 9", "output": "No" }, { "input": "780248358343081983 19", "output": "No" }, { "input": "576460580458522095 29", "output": "No" }, { "input": "540145805193625598 39", "output": "No" }, { "input": "576388182371377103 49", "output": "Yes\n58 57 56 55 54 53 52 51 50 49 48 47 45 44 43 42 40 39 38 37 36 35 34 33 32 30 29 28 27 26 25 23 22 21 20 19 17 15 12 11 10 9 8 7 6 3 2 1 0 " }, { "input": "567448991726268409 59", "output": "Yes\n56 56 56 56 56 56 56 55 54 52 51 50 49 48 47 46 45 44 43 41 40 39 38 36 35 32 31 30 29 28 27 25 24 23 22 21 20 19 18 17 16 14 13 11 10 9 8 7 6 5 4 3 -1 -2 -3 -4 -5 -6 -6 " }, { "input": "576460752303423487 9", "output": "No" }, { "input": "576460752303423487 19", "output": "No" }, { "input": "864691128455135231 29", "output": "No" }, { "input": "864691128455135231 39", "output": "No" }, { "input": "576460752303423487 49", "output": "No" }, { "input": "864691128455135231 59", "output": "Yes\n59 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 " }, { "input": "628839188486443015 2412", "output": "Yes\n48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48 48..." }, { "input": "558445254282313727 89558", "output": "Yes\n43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43..." }, { "input": "576460752303423487 100000", "output": "Yes\n43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43..." }, { "input": "1 100000", "output": "Yes\n-16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -16 -1..." }, { "input": "99997 100000", "output": "Yes\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..." }, { "input": "99998 100000", "output": "Yes\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..." }, { "input": "99999 100000", "output": "Yes\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..." }, { "input": "100000 100000", "output": "Yes\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ..." }, { "input": "100001 100000", "output": "Yes\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ..." }, { "input": "100002 100000", "output": "Yes\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ..." }, { "input": "100003 100000", "output": "Yes\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 ..." }, { "input": "12 202", "output": "Yes\n-4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4..." }, { "input": "1 4", "output": "Yes\n-2 -2 -2 -2 " }, { "input": "2 64", "output": "Yes\n-5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 -5 " }, { "input": "2 8", "output": "Yes\n-2 -2 -2 -2 -2 -2 -2 -2 " }, { "input": "1 5", "output": "Yes\n-2 -2 -2 -3 -3 " }, { "input": "1 7", "output": "Yes\n-2 -2 -2 -3 -4 -5 -5 " }, { "input": "19 5", "output": "Yes\n3 3 1 -1 -1 " }, { "input": "1 30", "output": "Yes\n-4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -5 -6 -7 -8 -9 -10 -11 -12 -13 -14 -15 -16 -17 -18 -18 " } ]
1,516,403,043
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
139
12,083,200
from collections import defaultdict def solve(n, k): as_bin = bin(n)[2:] cnt = defaultdict(int) cnt.update({i : int(b) for i, b in enumerate(reversed(as_bin))}) curr_len = sum(cnt.values()) curr_pow = len(as_bin) - 1 if curr_len > k: return None while True: new_len = curr_len + cnt[curr_pow] if new_len > k: break cnt[curr_pow - 1] += 2 * cnt[curr_pow] del cnt[curr_pow] curr_pow -= 1 curr_len = new_len i = min(cnt.keys()) while curr_len < k: cnt[i] -= 1 cnt[i - 1] += 2 curr_len += 1 i -= 1 ans = [] for i in sorted(cnt.keys(), reverse=True): ans.extend([i] * cnt[i]) return ans n, k = [int(v) for v in input().split()] ans = solve(n, k) if ans is None: print('No') else: print('Yes') print(' '.join(str(c) for c in ans))
Title: Jamie and Binary Sequence (changed after round) Time Limit: None seconds Memory Limit: None megabytes Problem Description: Jamie is preparing a Codeforces round. He has got an idea for a problem, but does not know how to solve it. Help him write a solution to the following problem: Find *k* integers such that the sum of two to the power of each number equals to the number *n* and the largest integer in the answer is as small as possible. As there may be multiple answers, you are asked to output the lexicographically largest one. To be more clear, consider all integer sequence with length *k* (*a*1,<=*a*2,<=...,<=*a**k*) with . Give a value to each sequence. Among all sequence(s) that have the minimum *y* value, output the one that is the lexicographically largest. For definitions of powers and lexicographical order see notes. Input Specification: The first line consists of two integers *n* and *k* (1<=≤<=*n*<=≤<=1018,<=1<=≤<=*k*<=≤<=105) — the required sum and the length of the sequence. Output Specification: Output "No" (without quotes) in a single line if there does not exist such sequence. Otherwise, output "Yes" (without quotes) in the first line, and *k* numbers separated by space in the second line — the required sequence. It is guaranteed that the integers in the answer sequence fit the range [<=-<=1018,<=1018]. Demo Input: ['23 5\n', '13 2\n', '1 2\n'] Demo Output: ['Yes\n3 3 2 1 0 \n', 'No\n', 'Yes\n-1 -1 \n'] Note: Sample 1: 2<sup class="upper-index">3</sup> + 2<sup class="upper-index">3</sup> + 2<sup class="upper-index">2</sup> + 2<sup class="upper-index">1</sup> + 2<sup class="upper-index">0</sup> = 8 + 8 + 4 + 2 + 1 = 23 Answers like (3, 3, 2, 0, 1) or (0, 1, 2, 3, 3) are not lexicographically largest. Answers like (4, 1, 1, 1, 0) do not have the minimum *y* value. Sample 2: It can be shown there does not exist a sequence with length 2. Sample 3: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a8539b2d27aefc8d2fab6dfd8296d11c36dcaa40.png" style="max-width: 100.0%;max-height: 100.0%;"/> Powers of 2: If *x* &gt; 0, then 2<sup class="upper-index">*x*</sup> = 2·2·2·...·2 (*x* times). If *x* = 0, then 2<sup class="upper-index">*x*</sup> = 1. If *x* &lt; 0, then <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/766628f1c7814795eac1a0afaa1ff062c40ef29e.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Lexicographical order: Given two different sequences of the same length, (*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ... , *a*<sub class="lower-index">*k*</sub>) and (*b*<sub class="lower-index">1</sub>, *b*<sub class="lower-index">2</sub>, ... , *b*<sub class="lower-index">*k*</sub>), the first one is smaller than the second one for the lexicographical order, if and only if *a*<sub class="lower-index">*i*</sub> &lt; *b*<sub class="lower-index">*i*</sub>, for the first *i* where *a*<sub class="lower-index">*i*</sub> and *b*<sub class="lower-index">*i*</sub> differ.
```python from collections import defaultdict def solve(n, k): as_bin = bin(n)[2:] cnt = defaultdict(int) cnt.update({i : int(b) for i, b in enumerate(reversed(as_bin))}) curr_len = sum(cnt.values()) curr_pow = len(as_bin) - 1 if curr_len > k: return None while True: new_len = curr_len + cnt[curr_pow] if new_len > k: break cnt[curr_pow - 1] += 2 * cnt[curr_pow] del cnt[curr_pow] curr_pow -= 1 curr_len = new_len i = min(cnt.keys()) while curr_len < k: cnt[i] -= 1 cnt[i - 1] += 2 curr_len += 1 i -= 1 ans = [] for i in sorted(cnt.keys(), reverse=True): ans.extend([i] * cnt[i]) return ans n, k = [int(v) for v in input().split()] ans = solve(n, k) if ans is None: print('No') else: print('Yes') print(' '.join(str(c) for c in ans)) ```
0
703
A
Mishka and Game
PROGRAMMING
800
[ "implementation" ]
null
null
Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game. Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner. In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw. Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her!
The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds. The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively.
If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line. If Chris is the winner of the game, print "Chris" (without quotes) in the only line. If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line.
[ "3\n3 5\n2 1\n4 2\n", "2\n6 1\n1 6\n", "3\n1 5\n3 3\n2 2\n" ]
[ "Mishka", "Friendship is magic!^^", "Chris" ]
In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game. In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1. In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.
500
[ { "input": "3\n3 5\n2 1\n4 2", "output": "Mishka" }, { "input": "2\n6 1\n1 6", "output": "Friendship is magic!^^" }, { "input": "3\n1 5\n3 3\n2 2", "output": "Chris" }, { "input": "6\n4 1\n4 2\n5 3\n5 1\n5 3\n4 1", "output": "Mishka" }, { "input": "8\n2 4\n1 4\n1 5\n2 6\n2 5\n2 5\n2 4\n2 5", "output": "Chris" }, { "input": "8\n4 1\n2 6\n4 2\n2 5\n5 2\n3 5\n5 2\n1 5", "output": "Friendship is magic!^^" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3", "output": "Mishka" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "9\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4", "output": "Mishka" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "10\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n2 4\n6 6\n3 2\n1 5\n5 2\n1 5\n1 5\n3 1\n6 5\n4 3\n1 1\n5 1\n3 3\n2 4\n1 5\n3 4\n5 1\n5 5\n2 5\n2 1\n4 3\n6 5\n1 1\n2 1\n1 3\n1 1\n6 4\n4 6\n6 4\n2 1\n2 5\n6 2\n3 4\n5 5\n1 4\n4 6\n3 4\n1 6\n5 1\n4 3\n3 4\n2 2\n1 2\n2 3\n1 3\n4 4\n5 5\n4 5\n4 4\n3 1\n4 5\n2 3\n2 6\n6 5\n6 1\n6 6\n2 3\n6 4\n3 3\n2 5\n4 4\n3 1\n2 4\n6 1\n3 2\n1 3\n5 4\n6 6\n2 5\n5 1\n1 1\n2 5\n6 5\n3 6\n5 6\n4 3\n3 4\n3 4\n6 5\n5 2\n4 2\n1 1\n3 1\n2 6\n1 6\n1 2\n6 1\n3 4\n1 6\n3 1\n5 3\n1 3\n5 6\n2 1\n6 4\n3 1\n1 6\n6 3\n3 3\n4 3", "output": "Chris" }, { "input": "100\n4 1\n3 4\n4 6\n4 5\n6 5\n5 3\n6 2\n6 3\n5 2\n4 5\n1 5\n5 4\n1 4\n4 5\n4 6\n1 6\n4 4\n5 1\n6 4\n6 4\n4 6\n2 3\n6 2\n4 6\n1 4\n2 3\n4 3\n1 3\n6 2\n3 1\n3 4\n2 6\n4 5\n5 4\n2 2\n2 5\n4 1\n2 2\n3 3\n1 4\n5 6\n6 4\n4 2\n6 1\n5 5\n4 1\n2 1\n6 4\n4 4\n4 3\n5 3\n4 5\n5 3\n3 5\n6 3\n1 1\n3 4\n6 3\n6 1\n5 1\n2 4\n4 3\n2 2\n5 5\n1 5\n5 3\n4 6\n1 4\n6 3\n4 3\n2 4\n3 2\n2 4\n3 4\n6 2\n5 6\n1 2\n1 5\n5 5\n2 6\n5 1\n1 6\n5 3\n3 5\n2 6\n4 6\n6 2\n3 1\n5 5\n6 1\n3 6\n4 4\n1 1\n4 6\n5 3\n4 2\n5 1\n3 3\n2 1\n1 4", "output": "Mishka" }, { "input": "100\n6 3\n4 5\n4 3\n5 4\n5 1\n6 3\n4 2\n4 6\n3 1\n2 4\n2 2\n4 6\n5 3\n5 5\n4 2\n6 2\n2 3\n4 4\n6 4\n3 5\n2 4\n2 2\n5 2\n3 5\n2 4\n4 4\n3 5\n6 5\n1 3\n1 6\n2 2\n2 4\n3 2\n5 4\n1 6\n3 4\n4 1\n1 5\n1 4\n5 3\n2 2\n4 5\n6 3\n4 4\n1 1\n4 1\n2 4\n4 1\n4 5\n5 3\n1 1\n1 6\n5 6\n6 6\n4 2\n4 3\n3 4\n3 6\n3 4\n6 5\n3 4\n5 4\n5 1\n5 3\n5 1\n1 2\n2 6\n3 4\n6 5\n4 3\n1 1\n5 5\n5 1\n3 3\n5 2\n1 3\n6 6\n5 6\n1 4\n4 4\n1 4\n3 6\n6 5\n3 3\n3 6\n1 5\n1 2\n3 6\n3 6\n4 1\n5 2\n1 2\n5 2\n3 3\n4 4\n4 2\n6 2\n5 4\n6 1\n6 3", "output": "Mishka" }, { "input": "8\n4 1\n6 2\n4 1\n5 3\n4 1\n5 3\n6 2\n5 3", "output": "Mishka" }, { "input": "5\n3 6\n3 5\n3 5\n1 6\n3 5", "output": "Chris" }, { "input": "4\n4 1\n2 4\n5 3\n3 6", "output": "Friendship is magic!^^" }, { "input": "6\n6 3\n5 1\n6 3\n4 3\n4 3\n5 2", "output": "Mishka" }, { "input": "7\n3 4\n1 4\n2 5\n1 6\n1 6\n1 5\n3 4", "output": "Chris" }, { "input": "6\n6 2\n2 5\n5 2\n3 6\n4 3\n1 6", "output": "Friendship is magic!^^" }, { "input": "8\n6 1\n5 3\n4 3\n4 1\n5 1\n4 2\n4 2\n4 1", "output": "Mishka" }, { "input": "9\n2 5\n2 5\n1 4\n2 6\n2 4\n2 5\n2 6\n1 5\n2 5", "output": "Chris" }, { "input": "4\n6 2\n2 4\n4 2\n3 6", "output": "Friendship is magic!^^" }, { "input": "9\n5 2\n4 1\n4 1\n5 1\n6 2\n6 1\n5 3\n6 1\n6 2", "output": "Mishka" }, { "input": "8\n2 4\n3 6\n1 6\n1 6\n2 4\n3 4\n3 6\n3 4", "output": "Chris" }, { "input": "6\n5 3\n3 6\n6 2\n1 6\n5 1\n3 5", "output": "Friendship is magic!^^" }, { "input": "6\n5 2\n5 1\n6 1\n5 2\n4 2\n5 1", "output": "Mishka" }, { "input": "5\n1 4\n2 5\n3 4\n2 6\n3 4", "output": "Chris" }, { "input": "4\n6 2\n3 4\n5 1\n1 6", "output": "Friendship is magic!^^" }, { "input": "93\n4 3\n4 1\n4 2\n5 2\n5 3\n6 3\n4 3\n6 2\n6 3\n5 1\n4 2\n4 2\n5 1\n6 2\n6 3\n6 1\n4 1\n6 2\n5 3\n4 3\n4 1\n4 2\n5 2\n6 3\n5 2\n5 2\n6 3\n5 1\n6 2\n5 2\n4 1\n5 2\n5 1\n4 1\n6 1\n5 2\n4 3\n5 3\n5 3\n5 1\n4 3\n4 3\n4 2\n4 1\n6 2\n6 1\n4 1\n5 2\n5 2\n6 2\n5 3\n5 1\n6 2\n5 1\n6 3\n5 2\n6 2\n6 2\n4 2\n5 2\n6 1\n6 3\n6 3\n5 1\n5 1\n4 1\n5 1\n4 3\n5 3\n6 3\n4 1\n4 3\n6 1\n6 1\n4 2\n6 2\n4 2\n5 2\n4 1\n5 2\n4 1\n5 1\n5 2\n5 1\n4 1\n6 3\n6 2\n4 3\n4 1\n5 2\n4 3\n5 2\n5 1", "output": "Mishka" }, { "input": "11\n1 6\n1 6\n2 4\n2 5\n3 4\n1 5\n1 6\n1 5\n1 6\n2 6\n3 4", "output": "Chris" }, { "input": "70\n6 1\n3 6\n4 3\n2 5\n5 2\n1 4\n6 2\n1 6\n4 3\n1 4\n5 3\n2 4\n5 3\n1 6\n5 1\n3 5\n4 2\n2 4\n5 1\n3 5\n6 2\n1 5\n4 2\n2 5\n5 3\n1 5\n4 2\n1 4\n5 2\n2 6\n4 3\n1 5\n6 2\n3 4\n4 2\n3 5\n6 3\n3 4\n5 1\n1 4\n4 2\n1 4\n6 3\n2 6\n5 2\n1 6\n6 1\n2 6\n5 3\n1 5\n5 1\n1 6\n4 1\n1 5\n4 2\n2 4\n5 1\n2 5\n6 3\n1 4\n6 3\n3 6\n5 1\n1 4\n5 3\n3 5\n4 2\n3 4\n6 2\n1 4", "output": "Friendship is magic!^^" }, { "input": "59\n4 1\n5 3\n6 1\n4 2\n5 1\n4 3\n6 1\n5 1\n4 3\n4 3\n5 2\n5 3\n4 1\n6 2\n5 1\n6 3\n6 3\n5 2\n5 2\n6 1\n4 1\n6 1\n4 3\n5 3\n5 3\n4 3\n4 2\n4 2\n6 3\n6 3\n6 1\n4 3\n5 1\n6 2\n6 1\n4 1\n6 1\n5 3\n4 2\n5 1\n6 2\n6 2\n4 3\n5 3\n4 3\n6 3\n5 2\n5 2\n4 3\n5 1\n5 3\n6 1\n6 3\n6 3\n4 3\n5 2\n5 2\n5 2\n4 3", "output": "Mishka" }, { "input": "42\n1 5\n1 6\n1 6\n1 4\n2 5\n3 6\n1 6\n3 4\n2 5\n2 5\n2 4\n1 4\n3 4\n2 4\n2 6\n1 5\n3 6\n2 6\n2 6\n3 5\n1 4\n1 5\n2 6\n3 6\n1 4\n3 4\n2 4\n1 6\n3 4\n2 4\n2 6\n1 6\n1 4\n1 6\n1 6\n2 4\n1 5\n1 6\n2 5\n3 6\n3 5\n3 4", "output": "Chris" }, { "input": "78\n4 3\n3 5\n4 3\n1 5\n5 1\n1 5\n4 3\n1 4\n6 3\n1 5\n4 1\n2 4\n4 3\n2 4\n5 1\n3 6\n4 2\n3 6\n6 3\n3 4\n4 3\n3 6\n5 3\n1 5\n4 1\n2 6\n4 2\n2 4\n4 1\n3 5\n5 2\n3 6\n4 3\n2 4\n6 3\n1 6\n4 3\n3 5\n6 3\n2 6\n4 1\n2 4\n6 2\n1 6\n4 2\n1 4\n4 3\n1 4\n4 3\n2 4\n6 2\n3 5\n6 1\n3 6\n5 3\n1 6\n6 1\n2 6\n4 2\n1 5\n6 2\n2 6\n6 3\n2 4\n4 2\n3 5\n6 1\n2 5\n5 3\n2 6\n5 1\n3 6\n4 3\n3 6\n6 3\n2 5\n6 1\n2 6", "output": "Friendship is magic!^^" }, { "input": "76\n4 1\n5 2\n4 3\n5 2\n5 3\n5 2\n6 1\n4 2\n6 2\n5 3\n4 2\n6 2\n4 1\n4 2\n5 1\n5 1\n6 2\n5 2\n5 3\n6 3\n5 2\n4 3\n6 3\n6 1\n4 3\n6 2\n6 1\n4 1\n6 1\n5 3\n4 1\n5 3\n4 2\n5 2\n4 3\n6 1\n6 2\n5 2\n6 1\n5 3\n4 3\n5 1\n5 3\n4 3\n5 1\n5 1\n4 1\n4 1\n4 1\n4 3\n5 3\n6 3\n6 3\n5 2\n6 2\n6 3\n5 1\n6 3\n5 3\n6 1\n5 3\n4 1\n5 3\n6 1\n4 2\n6 2\n4 3\n4 1\n6 2\n4 3\n5 3\n5 2\n5 3\n5 1\n6 3\n5 2", "output": "Mishka" }, { "input": "84\n3 6\n3 4\n2 5\n2 4\n1 6\n3 4\n1 5\n1 6\n3 5\n1 6\n2 4\n2 6\n2 6\n2 4\n3 5\n1 5\n3 6\n3 6\n3 4\n3 4\n2 6\n1 6\n1 6\n3 5\n3 4\n1 6\n3 4\n3 5\n2 4\n2 5\n2 5\n3 5\n1 6\n3 4\n2 6\n2 6\n3 4\n3 4\n2 5\n2 5\n2 4\n3 4\n2 5\n3 4\n3 4\n2 6\n2 6\n1 6\n2 4\n1 5\n3 4\n2 5\n2 5\n3 4\n2 4\n2 6\n2 6\n1 4\n3 5\n3 5\n2 4\n2 5\n3 4\n1 5\n1 5\n2 6\n1 5\n3 5\n2 4\n2 5\n3 4\n2 6\n1 6\n2 5\n3 5\n3 5\n3 4\n2 5\n2 6\n3 4\n1 6\n2 5\n2 6\n1 4", "output": "Chris" }, { "input": "44\n6 1\n1 6\n5 2\n1 4\n6 2\n2 5\n5 3\n3 6\n5 2\n1 6\n4 1\n2 4\n6 1\n3 4\n6 3\n3 6\n4 3\n2 4\n6 1\n3 4\n6 1\n1 6\n4 1\n3 5\n6 1\n3 6\n4 1\n1 4\n4 2\n2 6\n6 1\n2 4\n6 2\n1 4\n6 2\n2 4\n5 2\n3 6\n6 3\n2 6\n5 3\n3 4\n5 3\n2 4", "output": "Friendship is magic!^^" }, { "input": "42\n5 3\n5 1\n5 2\n4 1\n6 3\n6 1\n6 2\n4 1\n4 3\n4 1\n5 1\n5 3\n5 1\n4 1\n4 2\n6 1\n6 3\n5 1\n4 1\n4 1\n6 3\n4 3\n6 3\n5 2\n6 1\n4 1\n5 3\n4 3\n5 2\n6 3\n6 1\n5 1\n4 2\n4 3\n5 2\n5 3\n6 3\n5 2\n5 1\n5 3\n6 2\n6 1", "output": "Mishka" }, { "input": "50\n3 6\n2 6\n1 4\n1 4\n1 4\n2 5\n3 4\n3 5\n2 6\n1 6\n3 5\n1 5\n2 6\n2 4\n2 4\n3 5\n1 6\n1 5\n1 5\n1 4\n3 5\n1 6\n3 5\n1 4\n1 5\n1 4\n3 6\n1 6\n1 4\n1 4\n1 4\n1 5\n3 6\n1 6\n1 6\n2 4\n1 5\n2 6\n2 5\n3 5\n3 6\n3 4\n2 4\n2 6\n3 4\n2 5\n3 6\n3 5\n2 4\n2 4", "output": "Chris" }, { "input": "86\n6 3\n2 4\n6 3\n3 5\n6 3\n1 5\n5 2\n2 4\n4 3\n2 6\n4 1\n2 6\n5 2\n1 4\n5 1\n2 4\n4 1\n1 4\n6 2\n3 5\n4 2\n2 4\n6 2\n1 5\n5 3\n2 5\n5 1\n1 6\n6 1\n1 4\n4 3\n3 4\n5 2\n2 4\n5 3\n2 5\n4 3\n3 4\n4 1\n1 5\n6 3\n3 4\n4 3\n3 4\n4 1\n3 4\n5 1\n1 6\n4 2\n1 6\n5 1\n2 4\n5 1\n3 6\n4 1\n1 5\n5 2\n1 4\n4 3\n2 5\n5 1\n1 5\n6 2\n2 6\n4 2\n2 4\n4 1\n2 5\n5 3\n3 4\n5 1\n3 4\n6 3\n3 4\n4 3\n2 6\n6 2\n2 5\n5 2\n3 5\n4 2\n3 6\n6 2\n3 4\n4 2\n2 4", "output": "Friendship is magic!^^" }, { "input": "84\n6 1\n6 3\n6 3\n4 1\n4 3\n4 2\n6 3\n5 3\n6 1\n6 3\n4 3\n5 2\n5 3\n5 1\n6 2\n6 2\n6 1\n4 1\n6 3\n5 2\n4 1\n5 3\n6 3\n4 2\n6 2\n6 3\n4 3\n4 1\n4 3\n5 1\n5 1\n5 1\n4 1\n6 1\n4 3\n6 2\n5 1\n5 1\n6 2\n5 2\n4 1\n6 1\n6 1\n6 3\n6 2\n4 3\n6 3\n6 2\n5 2\n5 1\n4 3\n6 2\n4 1\n6 2\n6 1\n5 2\n5 1\n6 2\n6 1\n5 3\n5 2\n6 1\n6 3\n5 2\n6 1\n6 3\n4 3\n5 1\n6 3\n6 1\n5 3\n4 3\n5 2\n5 1\n6 2\n5 3\n6 1\n5 1\n4 1\n5 1\n5 1\n5 2\n5 2\n5 1", "output": "Mishka" }, { "input": "92\n1 5\n2 4\n3 5\n1 6\n2 5\n1 6\n3 6\n1 6\n2 4\n3 4\n3 4\n3 6\n1 5\n2 5\n1 5\n1 5\n2 6\n2 4\n3 6\n1 4\n1 6\n2 6\n3 4\n2 6\n2 6\n1 4\n3 5\n2 5\n2 6\n1 5\n1 4\n1 5\n3 6\n3 5\n2 5\n1 5\n3 5\n3 6\n2 6\n2 6\n1 5\n3 4\n2 4\n3 6\n2 5\n1 5\n2 4\n1 4\n2 6\n2 6\n2 6\n1 5\n3 6\n3 6\n2 5\n1 4\n2 4\n3 4\n1 5\n2 5\n2 4\n2 5\n3 5\n3 4\n3 6\n2 6\n3 5\n1 4\n3 4\n1 6\n3 6\n2 6\n1 4\n3 6\n3 6\n2 5\n2 6\n1 6\n2 6\n3 5\n2 5\n3 6\n2 5\n2 6\n1 5\n2 4\n1 4\n2 4\n1 5\n2 5\n2 5\n2 6", "output": "Chris" }, { "input": "20\n5 1\n1 4\n4 3\n1 5\n4 2\n3 6\n6 2\n1 6\n4 1\n1 4\n5 2\n3 4\n5 1\n1 6\n5 1\n2 6\n6 3\n2 5\n6 2\n2 4", "output": "Friendship is magic!^^" }, { "input": "100\n4 3\n4 3\n4 2\n4 3\n4 1\n4 3\n5 2\n5 2\n6 2\n4 2\n5 1\n4 2\n5 2\n6 1\n4 1\n6 3\n5 3\n5 1\n5 1\n5 1\n5 3\n6 1\n6 1\n4 1\n5 2\n5 2\n6 1\n6 3\n4 2\n4 1\n5 3\n4 1\n5 3\n5 1\n6 3\n6 3\n6 1\n5 2\n5 3\n5 3\n6 1\n4 1\n6 2\n6 1\n6 2\n6 3\n4 3\n4 3\n6 3\n4 2\n4 2\n5 3\n5 2\n5 2\n4 3\n5 3\n5 2\n4 2\n5 1\n4 2\n5 1\n5 3\n6 3\n5 3\n5 3\n4 2\n4 1\n4 2\n4 3\n6 3\n4 3\n6 2\n6 1\n5 3\n5 2\n4 1\n6 1\n5 2\n6 2\n4 2\n6 3\n4 3\n5 1\n6 3\n5 2\n4 3\n5 3\n5 3\n4 3\n6 3\n4 3\n4 1\n5 1\n6 2\n6 3\n5 3\n6 1\n6 3\n5 3\n6 1", "output": "Mishka" }, { "input": "100\n1 5\n1 4\n1 5\n2 4\n2 6\n3 6\n3 5\n1 5\n2 5\n3 6\n3 5\n1 6\n1 4\n1 5\n1 6\n2 6\n1 5\n3 5\n3 4\n2 6\n2 6\n2 5\n3 4\n1 6\n1 4\n2 4\n1 5\n1 6\n3 5\n1 6\n2 6\n3 5\n1 6\n3 4\n3 5\n1 6\n3 6\n2 4\n2 4\n3 5\n2 6\n1 5\n3 5\n3 6\n2 4\n2 4\n2 6\n3 4\n3 4\n1 5\n1 4\n2 5\n3 4\n1 4\n2 6\n2 5\n2 4\n2 4\n2 5\n1 5\n1 6\n1 5\n1 5\n1 5\n1 6\n3 4\n2 4\n3 5\n3 5\n1 6\n3 5\n1 5\n1 6\n3 6\n3 4\n1 5\n3 5\n3 6\n1 4\n3 6\n1 5\n3 5\n3 6\n3 5\n1 4\n3 4\n2 4\n2 4\n2 5\n3 6\n3 5\n1 5\n2 4\n1 4\n3 4\n1 5\n3 4\n3 6\n3 5\n3 4", "output": "Chris" }, { "input": "100\n4 3\n3 4\n5 1\n2 5\n5 3\n1 5\n6 3\n2 4\n5 2\n2 6\n5 2\n1 5\n6 3\n1 5\n6 3\n3 4\n5 2\n1 5\n6 1\n1 5\n4 2\n3 5\n6 3\n2 6\n6 3\n1 4\n6 2\n3 4\n4 1\n3 6\n5 1\n2 4\n5 1\n3 4\n6 2\n3 5\n4 1\n2 6\n4 3\n2 6\n5 2\n3 6\n6 2\n3 5\n4 3\n1 5\n5 3\n3 6\n4 2\n3 4\n6 1\n3 4\n5 2\n2 6\n5 2\n2 4\n6 2\n3 6\n4 3\n2 4\n4 3\n2 6\n4 2\n3 4\n6 3\n2 4\n6 3\n3 5\n5 2\n1 5\n6 3\n3 6\n4 3\n1 4\n5 2\n1 6\n4 1\n2 5\n4 1\n2 4\n4 2\n2 5\n6 1\n2 4\n6 3\n1 5\n4 3\n2 6\n6 3\n2 6\n5 3\n1 5\n4 1\n1 5\n6 2\n2 5\n5 1\n3 6\n4 3\n3 4", "output": "Friendship is magic!^^" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3", "output": "Mishka" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "99\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4", "output": "Mishka" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "100\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1", "output": "Chris" }, { "input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6", "output": "Mishka" }, { "input": "84\n6 2\n1 5\n6 2\n2 3\n5 5\n1 2\n3 4\n3 4\n6 5\n6 4\n2 5\n4 1\n1 2\n1 1\n1 4\n2 5\n5 6\n6 3\n2 4\n5 5\n2 6\n3 4\n5 1\n3 3\n5 5\n4 6\n4 6\n2 4\n4 1\n5 2\n2 2\n3 6\n3 3\n4 6\n1 1\n2 4\n6 5\n5 2\n6 5\n5 5\n2 5\n6 4\n1 1\n6 2\n3 6\n6 5\n4 4\n1 5\n5 6\n4 4\n3 5\n6 1\n3 4\n1 5\n4 6\n4 6\n4 1\n3 6\n6 2\n1 1\n4 5\n5 4\n5 3\n3 4\n6 4\n1 1\n5 2\n6 5\n6 1\n2 2\n2 4\n3 3\n4 6\n1 3\n6 6\n5 2\n1 6\n6 2\n6 6\n4 1\n3 6\n6 4\n2 3\n3 4", "output": "Chris" }, { "input": "70\n3 4\n2 3\n2 3\n6 5\n6 6\n4 3\n2 3\n3 1\n3 5\n5 6\n1 6\n2 5\n5 3\n2 5\n4 6\n5 1\n6 1\n3 1\n3 3\n5 3\n2 1\n3 3\n6 4\n6 3\n4 3\n4 5\n3 5\n5 5\n5 2\n1 6\n3 4\n5 2\n2 4\n1 6\n4 3\n4 3\n6 2\n1 3\n1 5\n6 1\n3 1\n1 1\n1 3\n2 2\n3 2\n6 4\n1 1\n4 4\n3 1\n4 5\n4 2\n6 3\n4 4\n3 2\n1 2\n2 6\n3 3\n1 5\n1 1\n6 5\n2 2\n3 1\n5 4\n5 2\n6 4\n6 3\n6 6\n6 3\n3 3\n5 4", "output": "Mishka" }, { "input": "56\n6 4\n3 4\n6 1\n3 3\n1 4\n2 3\n1 5\n2 5\n1 5\n5 5\n2 3\n1 1\n3 2\n3 5\n4 6\n4 4\n5 2\n4 3\n3 1\n3 6\n2 3\n3 4\n5 6\n5 2\n5 6\n1 5\n1 5\n4 1\n6 3\n2 2\n2 1\n5 5\n2 1\n4 1\n5 4\n2 5\n4 1\n6 2\n3 4\n4 2\n6 4\n5 4\n4 2\n4 3\n6 2\n6 2\n3 1\n1 4\n3 6\n5 1\n5 5\n3 6\n6 4\n2 3\n6 5\n3 3", "output": "Mishka" }, { "input": "94\n2 4\n6 4\n1 6\n1 4\n5 1\n3 3\n4 3\n6 1\n6 5\n3 2\n2 3\n5 1\n5 3\n1 2\n4 3\n3 2\n2 3\n4 6\n1 3\n6 3\n1 1\n3 2\n4 3\n1 5\n4 6\n3 2\n6 3\n1 6\n1 1\n1 2\n3 5\n1 3\n3 5\n4 4\n4 2\n1 4\n4 5\n1 3\n1 2\n1 1\n5 4\n5 5\n6 1\n2 1\n2 6\n6 6\n4 2\n3 6\n1 6\n6 6\n1 5\n3 2\n1 2\n4 4\n6 4\n4 1\n1 5\n3 3\n1 3\n3 4\n4 4\n1 1\n2 5\n4 5\n3 1\n3 1\n3 6\n3 2\n1 4\n1 6\n6 3\n2 4\n1 1\n2 2\n2 2\n2 1\n5 4\n1 2\n6 6\n2 2\n3 3\n6 3\n6 3\n1 6\n2 3\n2 4\n2 3\n6 6\n2 6\n6 3\n3 5\n1 4\n1 1\n3 5", "output": "Chris" }, { "input": "81\n4 2\n1 2\n2 3\n4 5\n6 2\n1 6\n3 6\n3 4\n4 6\n4 4\n3 5\n4 6\n3 6\n3 5\n3 1\n1 3\n5 3\n3 4\n1 1\n4 1\n1 2\n6 1\n1 3\n6 5\n4 5\n4 2\n4 5\n6 2\n1 2\n2 6\n5 2\n1 5\n2 4\n4 3\n5 4\n1 2\n5 3\n2 6\n6 4\n1 1\n1 3\n3 1\n3 1\n6 5\n5 5\n6 1\n6 6\n5 2\n1 3\n1 4\n2 3\n5 5\n3 1\n3 1\n4 4\n1 6\n6 4\n2 2\n4 6\n4 4\n2 6\n2 4\n2 4\n4 1\n1 6\n1 4\n1 3\n6 5\n5 1\n1 3\n5 1\n1 4\n3 5\n2 6\n1 3\n5 6\n3 5\n4 4\n5 5\n5 6\n4 3", "output": "Chris" }, { "input": "67\n6 5\n3 6\n1 6\n5 3\n5 4\n5 1\n1 6\n1 1\n3 2\n4 4\n3 1\n4 1\n1 5\n5 3\n3 3\n6 4\n2 4\n2 2\n4 3\n1 4\n1 4\n6 1\n1 2\n2 2\n5 1\n6 2\n3 5\n5 5\n2 2\n6 5\n6 2\n4 4\n3 1\n4 2\n6 6\n6 4\n5 1\n2 2\n4 5\n5 5\n4 6\n1 5\n6 3\n4 4\n1 5\n6 4\n3 6\n3 4\n1 6\n2 4\n2 1\n2 5\n6 5\n6 4\n4 1\n3 2\n1 2\n5 1\n5 6\n1 5\n3 5\n3 1\n5 3\n3 2\n5 1\n4 6\n6 6", "output": "Mishka" }, { "input": "55\n6 6\n6 5\n2 2\n2 2\n6 4\n5 5\n6 5\n5 3\n1 3\n2 2\n5 6\n3 3\n3 3\n6 5\n3 5\n5 5\n1 2\n1 1\n4 6\n1 2\n5 5\n6 2\n6 3\n1 2\n5 1\n1 3\n3 3\n4 4\n2 5\n1 1\n5 3\n4 3\n2 2\n4 5\n5 6\n4 5\n6 3\n1 6\n6 4\n3 6\n1 6\n5 2\n6 3\n2 3\n5 5\n4 3\n3 1\n4 2\n1 1\n2 5\n5 3\n2 2\n6 3\n4 5\n2 2", "output": "Mishka" }, { "input": "92\n2 3\n1 3\n2 6\n5 1\n5 5\n3 2\n5 6\n2 5\n3 1\n3 6\n4 5\n2 5\n1 2\n2 3\n6 5\n3 6\n4 4\n6 2\n4 5\n4 4\n5 1\n6 1\n3 4\n3 5\n6 6\n3 2\n6 4\n2 2\n3 5\n6 4\n6 3\n6 6\n3 4\n3 3\n6 1\n5 4\n6 2\n2 6\n5 6\n1 4\n4 6\n6 3\n3 1\n4 1\n6 6\n3 5\n6 3\n6 1\n1 6\n3 2\n6 6\n4 3\n3 4\n1 3\n3 5\n5 3\n6 5\n4 3\n5 5\n4 1\n1 5\n6 4\n2 3\n2 3\n1 5\n1 2\n5 2\n4 3\n3 6\n5 5\n5 4\n1 4\n3 3\n1 6\n5 6\n5 4\n5 3\n1 1\n6 2\n5 5\n2 5\n4 3\n6 6\n5 1\n1 1\n4 6\n4 6\n3 1\n6 4\n2 4\n2 2\n2 1", "output": "Chris" }, { "input": "79\n5 3\n4 6\n3 6\n2 1\n5 2\n2 3\n4 4\n6 2\n2 5\n1 6\n6 6\n2 6\n3 3\n4 5\n6 2\n2 1\n1 5\n5 1\n2 1\n2 6\n5 3\n6 2\n2 6\n2 3\n1 5\n4 4\n6 3\n5 2\n3 2\n1 3\n1 3\n6 3\n2 6\n3 6\n5 3\n4 5\n6 1\n3 5\n3 5\n6 5\n1 5\n4 2\n6 2\n2 3\n4 6\n3 6\n2 5\n4 4\n1 1\n4 6\n2 6\n6 4\n3 2\n4 1\n1 2\n6 4\n5 6\n1 4\n2 2\n5 4\n3 2\n1 2\n2 4\n2 5\n2 1\n3 6\n3 3\n1 1\n2 2\n4 4\n4 5\n3 3\n5 3\n6 2\n4 5\n6 5\n2 5\n5 6\n2 2", "output": "Chris" }, { "input": "65\n1 1\n5 1\n2 2\n5 4\n4 5\n2 5\n3 2\n5 6\n6 3\n1 1\n6 1\n1 5\n1 1\n5 2\n6 4\n1 6\n1 1\n4 3\n2 3\n5 6\n4 4\n6 2\n1 3\n4 3\n1 3\n6 3\n3 5\n4 2\n4 1\n6 1\n3 2\n2 6\n3 2\n3 5\n6 3\n4 3\n1 5\n2 6\n1 3\n4 1\n4 1\n2 5\n2 5\n6 2\n5 3\n3 1\n3 3\n5 1\n2 4\n5 3\n3 3\n1 1\n6 3\n3 3\n5 1\n1 6\n4 5\n6 6\n5 5\n2 5\n4 1\n2 2\n1 4\n1 6\n6 5", "output": "Mishka" }, { "input": "1\n1 1", "output": "Friendship is magic!^^" } ]
1,689,418,301
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
30
0
for _ in range(int(input())): a, b = map(int, input().split()) cm, cc = 0, 0 if a>b: cm += 1 else: cc += 1 if cm>cc: print("Mishka") elif cc>cm: print("Chris") else: print("Frienship is magic!^^")
Title: Mishka and Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game. Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner. In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw. Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her! Input Specification: The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds. The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively. Output Specification: If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line. If Chris is the winner of the game, print "Chris" (without quotes) in the only line. If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line. Demo Input: ['3\n3 5\n2 1\n4 2\n', '2\n6 1\n1 6\n', '3\n1 5\n3 3\n2 2\n'] Demo Output: ['Mishka', 'Friendship is magic!^^', 'Chris'] Note: In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game. In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1. In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.
```python for _ in range(int(input())): a, b = map(int, input().split()) cm, cc = 0, 0 if a>b: cm += 1 else: cc += 1 if cm>cc: print("Mishka") elif cc>cm: print("Chris") else: print("Frienship is magic!^^") ```
0
862
B
Mahmoud and Ehab and the bipartiteness
PROGRAMMING
1,300
[ "dfs and similar", "graphs", "trees" ]
null
null
Mahmoud and Ehab continue their adventures! As everybody in the evil land knows, Dr. Evil likes bipartite graphs, especially trees. A tree is a connected acyclic graph. A bipartite graph is a graph, whose vertices can be partitioned into 2 sets in such a way, that for each edge (*u*,<=*v*) that belongs to the graph, *u* and *v* belong to different sets. You can find more formal definitions of a tree and a bipartite graph in the notes section below. Dr. Evil gave Mahmoud and Ehab a tree consisting of *n* nodes and asked them to add edges to it in such a way, that the graph is still bipartite. Besides, after adding these edges the graph should be simple (doesn't contain loops or multiple edges). What is the maximum number of edges they can add? A loop is an edge, which connects a node with itself. Graph doesn't contain multiple edges when for each pair of nodes there is no more than one edge between them. A cycle and a loop aren't the same .
The first line of input contains an integer *n* — the number of nodes in the tree (1<=≤<=*n*<=≤<=105). The next *n*<=-<=1 lines contain integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*, *u*<=≠<=*v*) — the description of the edges of the tree. It's guaranteed that the given graph is a tree.
Output one integer — the maximum number of edges that Mahmoud and Ehab can add to the tree while fulfilling the conditions.
[ "3\n1 2\n1 3\n", "5\n1 2\n2 3\n3 4\n4 5\n" ]
[ "0\n", "2\n" ]
Tree definition: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)) Bipartite graph definition: [https://en.wikipedia.org/wiki/Bipartite_graph](https://en.wikipedia.org/wiki/Bipartite_graph) In the first test case the only edge that can be added in such a way, that graph won't contain loops or multiple edges is (2, 3), but adding this edge will make the graph non-bipartite so the answer is 0. In the second test case Mahmoud and Ehab can add edges (1, 4) and (2, 5).
1,000
[ { "input": "3\n1 2\n1 3", "output": "0" }, { "input": "5\n1 2\n2 3\n3 4\n4 5", "output": "2" }, { "input": "10\n3 8\n6 2\n9 7\n10 1\n3 5\n1 3\n6 7\n5 4\n3 6", "output": "16" }, { "input": "10\n7 6\n2 7\n4 1\n8 5\n9 4\n5 3\n8 7\n10 8\n10 4", "output": "16" }, { "input": "10\n2 6\n3 7\n8 4\n4 10\n6 9\n9 7\n3 10\n1 2\n5 8", "output": "16" }, { "input": "10\n6 9\n9 7\n9 4\n10 9\n9 1\n9 8\n9 2\n9 5\n3 9", "output": "0" }, { "input": "2\n1 2", "output": "0" } ]
1,695,242,218
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
62
0
n = int(input()) g = [[] for i in range(n+1)] for _ in range(n-1): u, v = map(int, input().split()) g[u].append(v) g[v].append(u) visited = [False for _ in range(n+1)] def dfs(node, prev): if prev: visited[node] = 1 else: visited[node] = 0 for w in g[node]: if not visited[w]: dfs(w, 1 - prev) dfs(1, 0) c = [0, 0] for visit in visited: if visit == 1: c[1] += 1 else: c[0] += 1 print(c[0]*c[1]-n+1)
Title: Mahmoud and Ehab and the bipartiteness Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mahmoud and Ehab continue their adventures! As everybody in the evil land knows, Dr. Evil likes bipartite graphs, especially trees. A tree is a connected acyclic graph. A bipartite graph is a graph, whose vertices can be partitioned into 2 sets in such a way, that for each edge (*u*,<=*v*) that belongs to the graph, *u* and *v* belong to different sets. You can find more formal definitions of a tree and a bipartite graph in the notes section below. Dr. Evil gave Mahmoud and Ehab a tree consisting of *n* nodes and asked them to add edges to it in such a way, that the graph is still bipartite. Besides, after adding these edges the graph should be simple (doesn't contain loops or multiple edges). What is the maximum number of edges they can add? A loop is an edge, which connects a node with itself. Graph doesn't contain multiple edges when for each pair of nodes there is no more than one edge between them. A cycle and a loop aren't the same . Input Specification: The first line of input contains an integer *n* — the number of nodes in the tree (1<=≤<=*n*<=≤<=105). The next *n*<=-<=1 lines contain integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*, *u*<=≠<=*v*) — the description of the edges of the tree. It's guaranteed that the given graph is a tree. Output Specification: Output one integer — the maximum number of edges that Mahmoud and Ehab can add to the tree while fulfilling the conditions. Demo Input: ['3\n1 2\n1 3\n', '5\n1 2\n2 3\n3 4\n4 5\n'] Demo Output: ['0\n', '2\n'] Note: Tree definition: [https://en.wikipedia.org/wiki/Tree_(graph_theory)](https://en.wikipedia.org/wiki/Tree_(graph_theory)) Bipartite graph definition: [https://en.wikipedia.org/wiki/Bipartite_graph](https://en.wikipedia.org/wiki/Bipartite_graph) In the first test case the only edge that can be added in such a way, that graph won't contain loops or multiple edges is (2, 3), but adding this edge will make the graph non-bipartite so the answer is 0. In the second test case Mahmoud and Ehab can add edges (1, 4) and (2, 5).
```python n = int(input()) g = [[] for i in range(n+1)] for _ in range(n-1): u, v = map(int, input().split()) g[u].append(v) g[v].append(u) visited = [False for _ in range(n+1)] def dfs(node, prev): if prev: visited[node] = 1 else: visited[node] = 0 for w in g[node]: if not visited[w]: dfs(w, 1 - prev) dfs(1, 0) c = [0, 0] for visit in visited: if visit == 1: c[1] += 1 else: c[0] += 1 print(c[0]*c[1]-n+1) ```
0
0
none
none
none
0
[ "none" ]
null
null
The Shuseki Islands are an archipelago of 30001 small islands in the Yutampo Sea. The islands are evenly spaced along a line, numbered from 0 to 30000 from the west to the east. These islands are known to contain many treasures. There are *n* gems in the Shuseki Islands in total, and the *i*-th gem is located on island *p**i*. Mr. Kitayuta has just arrived at island 0. With his great jumping ability, he will repeatedly perform jumps between islands to the east according to the following process: - First, he will jump from island 0 to island *d*. - After that, he will continue jumping according to the following rule. Let *l* be the length of the previous jump, that is, if his previous jump was from island *prev* to island *cur*, let *l*<==<=*cur*<=-<=*prev*. He will perform a jump of length *l*<=-<=1, *l* or *l*<=+<=1 to the east. That is, he will jump to island (*cur*<=+<=*l*<=-<=1), (*cur*<=+<=*l*) or (*cur*<=+<=*l*<=+<=1) (if they exist). The length of a jump must be positive, that is, he cannot perform a jump of length 0 when *l*<==<=1. If there is no valid destination, he will stop jumping. Mr. Kitayuta will collect the gems on the islands visited during the process. Find the maximum number of gems that he can collect.
The first line of the input contains two space-separated integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=30000), denoting the number of the gems in the Shuseki Islands and the length of the Mr. Kitayuta's first jump, respectively. The next *n* lines describe the location of the gems. The *i*-th of them (1<=≤<=*i*<=≤<=*n*) contains a integer *p**i* (*d*<=≤<=*p*1<=≤<=*p*2<=≤<=...<=≤<=*p**n*<=≤<=30000), denoting the number of the island that contains the *i*-th gem.
Print the maximum number of gems that Mr. Kitayuta can collect.
[ "4 10\n10\n21\n27\n27\n", "8 8\n9\n19\n28\n36\n45\n55\n66\n78\n", "13 7\n8\n8\n9\n16\n17\n17\n18\n21\n23\n24\n24\n26\n30\n" ]
[ "3\n", "6\n", "4\n" ]
In the first sample, the optimal route is 0  →  10 (+1 gem)  →  19  →  27 (+2 gems)  → ... In the second sample, the optimal route is 0  →  8  →  15  →  21 →  28 (+1 gem)  →  36 (+1 gem)  →  45 (+1 gem)  →  55 (+1 gem)  →  66 (+1 gem)  →  78 (+1 gem)  → ... In the third sample, the optimal route is 0  →  7  →  13  →  18 (+1 gem)  →  24 (+2 gems)  →  30 (+1 gem)  → ...
0
[]
1,421,592,729
6,729
Python 3
WRONG_ANSWER
PRETESTS
0
46
0
print("too hard :/")
Title: none Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Shuseki Islands are an archipelago of 30001 small islands in the Yutampo Sea. The islands are evenly spaced along a line, numbered from 0 to 30000 from the west to the east. These islands are known to contain many treasures. There are *n* gems in the Shuseki Islands in total, and the *i*-th gem is located on island *p**i*. Mr. Kitayuta has just arrived at island 0. With his great jumping ability, he will repeatedly perform jumps between islands to the east according to the following process: - First, he will jump from island 0 to island *d*. - After that, he will continue jumping according to the following rule. Let *l* be the length of the previous jump, that is, if his previous jump was from island *prev* to island *cur*, let *l*<==<=*cur*<=-<=*prev*. He will perform a jump of length *l*<=-<=1, *l* or *l*<=+<=1 to the east. That is, he will jump to island (*cur*<=+<=*l*<=-<=1), (*cur*<=+<=*l*) or (*cur*<=+<=*l*<=+<=1) (if they exist). The length of a jump must be positive, that is, he cannot perform a jump of length 0 when *l*<==<=1. If there is no valid destination, he will stop jumping. Mr. Kitayuta will collect the gems on the islands visited during the process. Find the maximum number of gems that he can collect. Input Specification: The first line of the input contains two space-separated integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=30000), denoting the number of the gems in the Shuseki Islands and the length of the Mr. Kitayuta's first jump, respectively. The next *n* lines describe the location of the gems. The *i*-th of them (1<=≤<=*i*<=≤<=*n*) contains a integer *p**i* (*d*<=≤<=*p*1<=≤<=*p*2<=≤<=...<=≤<=*p**n*<=≤<=30000), denoting the number of the island that contains the *i*-th gem. Output Specification: Print the maximum number of gems that Mr. Kitayuta can collect. Demo Input: ['4 10\n10\n21\n27\n27\n', '8 8\n9\n19\n28\n36\n45\n55\n66\n78\n', '13 7\n8\n8\n9\n16\n17\n17\n18\n21\n23\n24\n24\n26\n30\n'] Demo Output: ['3\n', '6\n', '4\n'] Note: In the first sample, the optimal route is 0  →  10 (+1 gem)  →  19  →  27 (+2 gems)  → ... In the second sample, the optimal route is 0  →  8  →  15  →  21 →  28 (+1 gem)  →  36 (+1 gem)  →  45 (+1 gem)  →  55 (+1 gem)  →  66 (+1 gem)  →  78 (+1 gem)  → ... In the third sample, the optimal route is 0  →  7  →  13  →  18 (+1 gem)  →  24 (+2 gems)  →  30 (+1 gem)  → ...
```python print("too hard :/") ```
0
295
A
Greg and Array
PROGRAMMING
1,400
[ "data structures", "implementation" ]
null
null
Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*. Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array. Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg.
The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array. Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105). Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). The numbers in the lines are separated by single spaces.
On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
[ "3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n", "1 1 1\n1\n1 1 1\n1 1\n", "4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n" ]
[ "9 18 17\n", "2\n", "5 18 31 20\n" ]
none
500
[ { "input": "3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3", "output": "9 18 17" }, { "input": "1 1 1\n1\n1 1 1\n1 1", "output": "2" }, { "input": "4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3", "output": "5 18 31 20" }, { "input": "1 1 1\n0\n1 1 0\n1 1", "output": "0" } ]
1,430,964,013
2,147,483,647
Python 3
MEMORY_LIMIT_EXCEEDED
TESTS
10
1,247
268,390,400
n, m, k = [int(x) for x in input().split()] init_array = [int(x) for x in input().split()] additions = [] for y in range(m): l, r, d = [int(x) for x in input().split()] operation = [0]*(l-1) + [d] *(r-l+1) + [0]*(len(init_array)-r) # for a in range(1, l): # operation.append(0) # for b in range(l, r+1): # operation.append(d) # for c in range(r+1, len(init_array)+1): # operation.append(0) additions.append(operation) # print(operation) from operator import add num_additions = [0]*len(additions) for z in range(k): x, y = [int(x) - 1 for x in input().split()] for c in range(x, y+1): num_additions[c] += 1 # print(additions) def sum_lists(list1, list2): return [sum(x) for x in zip(list1, list2)] for index in range(len(additions)): multiplier = num_additions[index] for index_b in range(len(init_array)): additions[index][index_b] *= multiplier # print(num_additions) additions = [sum(stuff) for stuff in zip(*additions)] # print(all_additions) # print(additions) # print(init_array) print(" ".join([str(x) for x in sum_lists(init_array, additions)]))
Title: Greg and Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*. Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array. Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg. Input Specification: The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array. Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105). Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). The numbers in the lines are separated by single spaces. Output Specification: On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces. Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier. Demo Input: ['3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n', '1 1 1\n1\n1 1 1\n1 1\n', '4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n'] Demo Output: ['9 18 17\n', '2\n', '5 18 31 20\n'] Note: none
```python n, m, k = [int(x) for x in input().split()] init_array = [int(x) for x in input().split()] additions = [] for y in range(m): l, r, d = [int(x) for x in input().split()] operation = [0]*(l-1) + [d] *(r-l+1) + [0]*(len(init_array)-r) # for a in range(1, l): # operation.append(0) # for b in range(l, r+1): # operation.append(d) # for c in range(r+1, len(init_array)+1): # operation.append(0) additions.append(operation) # print(operation) from operator import add num_additions = [0]*len(additions) for z in range(k): x, y = [int(x) - 1 for x in input().split()] for c in range(x, y+1): num_additions[c] += 1 # print(additions) def sum_lists(list1, list2): return [sum(x) for x in zip(list1, list2)] for index in range(len(additions)): multiplier = num_additions[index] for index_b in range(len(init_array)): additions[index][index_b] *= multiplier # print(num_additions) additions = [sum(stuff) for stuff in zip(*additions)] # print(all_additions) # print(additions) # print(init_array) print(" ".join([str(x) for x in sum_lists(init_array, additions)])) ```
0
732
A
Buy a Shovel
PROGRAMMING
800
[ "brute force", "constructive algorithms", "implementation", "math" ]
null
null
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
[ "117 3\n", "237 7\n", "15 2\n" ]
[ "9\n", "1\n", "2\n" ]
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
500
[ { "input": "117 3", "output": "9" }, { "input": "237 7", "output": "1" }, { "input": "15 2", "output": "2" }, { "input": "1 1", "output": "1" }, { "input": "1 9", "output": "9" }, { "input": "1000 3", "output": "1" }, { "input": "1000 1", "output": "1" }, { "input": "1000 9", "output": "1" }, { "input": "1 2", "output": "2" }, { "input": "999 9", "output": "1" }, { "input": "999 8", "output": "2" }, { "input": "105 6", "output": "2" }, { "input": "403 9", "output": "3" }, { "input": "546 4", "output": "4" }, { "input": "228 9", "output": "5" }, { "input": "57 2", "output": "6" }, { "input": "437 9", "output": "7" }, { "input": "997 6", "output": "8" }, { "input": "109 1", "output": "9" }, { "input": "998 9", "output": "5" }, { "input": "4 2", "output": "3" }, { "input": "9 3", "output": "7" }, { "input": "8 2", "output": "4" }, { "input": "1 3", "output": "3" }, { "input": "1 4", "output": "4" }, { "input": "1 5", "output": "5" }, { "input": "1 6", "output": "6" }, { "input": "1 7", "output": "7" }, { "input": "1 8", "output": "8" }, { "input": "100 3", "output": "1" }, { "input": "1000 2", "output": "1" }, { "input": "1000 4", "output": "1" }, { "input": "1000 5", "output": "1" }, { "input": "1000 6", "output": "1" }, { "input": "1000 7", "output": "1" }, { "input": "1000 8", "output": "1" }, { "input": "23 4", "output": "8" }, { "input": "33 1", "output": "7" }, { "input": "33 2", "output": "4" }, { "input": "666 5", "output": "5" }, { "input": "2 3", "output": "5" }, { "input": "5 5", "output": "1" }, { "input": "3 6", "output": "2" }, { "input": "12 4", "output": "2" }, { "input": "15 5", "output": "1" }, { "input": "2 5", "output": "5" }, { "input": "25 5", "output": "1" }, { "input": "2 9", "output": "5" }, { "input": "6 7", "output": "5" }, { "input": "8 9", "output": "5" }, { "input": "2 7", "output": "5" }, { "input": "4 7", "output": "5" }, { "input": "2 1", "output": "5" }, { "input": "261 1", "output": "1" } ]
1,680,794,685
2,147,483,647
Python 3
OK
TESTS
54
46
0
MYDD = 1103 def main(): k, r = map(int, input().split()) zz = k % 10 ans = -1 for j in range(1, 11): if zz * j % 10 == r or k * j % 10 == 0: ans = j break print(ans) if __name__ == '__main__': main()
Title: Buy a Shovel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop. In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9). What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel. Input Specification: The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins". Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels. Output Specification: Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change. Demo Input: ['117 3\n', '237 7\n', '15 2\n'] Demo Output: ['9\n', '1\n', '2\n'] Note: In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change. In the second example it is enough for Polycarp to buy one shovel. In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
```python MYDD = 1103 def main(): k, r = map(int, input().split()) zz = k % 10 ans = -1 for j in range(1, 11): if zz * j % 10 == r or k * j % 10 == 0: ans = j break print(ans) if __name__ == '__main__': main() ```
3
734
A
Anton and Danik
PROGRAMMING
800
[ "implementation", "strings" ]
null
null
Anton likes to play chess, and so does his friend Danik. Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie. Now Anton wonders, who won more games, he or Danik? Help him determine this.
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played. The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output. If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output. If Anton and Danik won the same number of games, print "Friendship" (without quotes).
[ "6\nADAAAA\n", "7\nDDDAADA\n", "6\nDADADA\n" ]
[ "Anton\n", "Danik\n", "Friendship\n" ]
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton". In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik". In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
500
[ { "input": "6\nADAAAA", "output": "Anton" }, { "input": "7\nDDDAADA", "output": "Danik" }, { "input": "6\nDADADA", "output": "Friendship" }, { "input": "10\nDDDDADDADD", "output": "Danik" }, { "input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA", "output": "Anton" }, { "input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD", "output": "Friendship" }, { "input": "1\nA", "output": "Anton" }, { "input": "1\nD", "output": "Danik" }, { "input": "2\nDA", "output": "Friendship" }, { "input": "4\nDADA", "output": "Friendship" }, { "input": "4\nDAAD", "output": "Friendship" }, { "input": "3\nADD", "output": "Danik" }, { "input": "3\nDAD", "output": "Danik" }, { "input": "2\nDA", "output": "Friendship" }, { "input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA", "output": "Anton" } ]
1,691,262,940
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
31
0
n=int(input()) t=str(input()) A="A" D="D" suma=0 sumd=0 for i in range(n): if t[i] ==A: suma+=1 else: sumd+=1 if suma>sumd: print("Anton") elif suma==sumd: print("friendship") else: print("Danik")
Title: Anton and Danik Time Limit: None seconds Memory Limit: None megabytes Problem Description: Anton likes to play chess, and so does his friend Danik. Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie. Now Anton wonders, who won more games, he or Danik? Help him determine this. Input Specification: The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played. The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game. Output Specification: If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output. If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output. If Anton and Danik won the same number of games, print "Friendship" (without quotes). Demo Input: ['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n'] Demo Output: ['Anton\n', 'Danik\n', 'Friendship\n'] Note: In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton". In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik". In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
```python n=int(input()) t=str(input()) A="A" D="D" suma=0 sumd=0 for i in range(n): if t[i] ==A: suma+=1 else: sumd+=1 if suma>sumd: print("Anton") elif suma==sumd: print("friendship") else: print("Danik") ```
0
765
C
Table Tennis Game 2
PROGRAMMING
1,200
[ "math" ]
null
null
Misha and Vanya have played several table tennis sets. Each set consists of several serves, each serve is won by one of the players, he receives one point and the loser receives nothing. Once one of the players scores exactly *k* points, the score is reset and a new set begins. Across all the sets Misha scored *a* points in total, and Vanya scored *b* points. Given this information, determine the maximum number of sets they could have played, or that the situation is impossible. Note that the game consisted of several complete sets.
The first line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=109, 0<=≤<=*a*,<=*b*<=≤<=109, *a*<=+<=*b*<=&gt;<=0).
If the situation is impossible, print a single number -1. Otherwise, print the maximum possible number of sets.
[ "11 11 5\n", "11 2 3\n" ]
[ "1\n", "-1\n" ]
Note that the rules of the game in this problem differ from the real table tennis game, for example, the rule of "balance" (the winning player has to be at least two points ahead to win a set) has no power within the present problem.
1,250
[ { "input": "11 11 5", "output": "1" }, { "input": "11 2 3", "output": "-1" }, { "input": "1 5 9", "output": "14" }, { "input": "2 3 3", "output": "2" }, { "input": "1 1000000000 1000000000", "output": "2000000000" }, { "input": "2 3 5", "output": "3" }, { "input": "1000000000 1000000000 1000000000", "output": "2" }, { "input": "1 0 1", "output": "1" }, { "input": "101 99 97", "output": "-1" }, { "input": "1000000000 0 1", "output": "-1" }, { "input": "137 137 136", "output": "1" }, { "input": "255 255 255", "output": "2" }, { "input": "1 0 1000000000", "output": "1000000000" }, { "input": "123 456 789", "output": "9" }, { "input": "666666 6666666 666665", "output": "-1" }, { "input": "1000000000 999999999 999999999", "output": "-1" }, { "input": "100000000 100000001 99999999", "output": "-1" }, { "input": "3 2 1000000000", "output": "-1" }, { "input": "999999999 1000000000 999999998", "output": "-1" }, { "input": "12938621 192872393 102739134", "output": "21" }, { "input": "666666666 1230983 666666666", "output": "1" }, { "input": "123456789 123456789 123456787", "output": "1" }, { "input": "5 6 0", "output": "-1" }, { "input": "11 0 12", "output": "-1" }, { "input": "2 11 0", "output": "-1" }, { "input": "2 1 0", "output": "-1" }, { "input": "10 11 12", "output": "2" }, { "input": "11 12 5", "output": "-1" }, { "input": "11 12 3", "output": "-1" }, { "input": "11 15 4", "output": "-1" }, { "input": "2 3 1", "output": "-1" }, { "input": "11 12 0", "output": "-1" }, { "input": "11 13 2", "output": "-1" }, { "input": "11 23 22", "output": "4" }, { "input": "10 21 0", "output": "-1" }, { "input": "11 23 1", "output": "-1" }, { "input": "11 10 12", "output": "-1" }, { "input": "11 1 12", "output": "-1" }, { "input": "11 5 12", "output": "-1" }, { "input": "11 8 12", "output": "-1" }, { "input": "11 12 1", "output": "-1" }, { "input": "5 4 6", "output": "-1" }, { "input": "10 1 22", "output": "-1" }, { "input": "2 3 0", "output": "-1" }, { "input": "11 23 2", "output": "-1" }, { "input": "2 1000000000 1000000000", "output": "1000000000" }, { "input": "11 0 15", "output": "-1" }, { "input": "11 5 0", "output": "-1" }, { "input": "11 5 15", "output": "-1" }, { "input": "10 0 13", "output": "-1" }, { "input": "4 7 0", "output": "-1" }, { "input": "10 2 8", "output": "-1" }, { "input": "11 5 22", "output": "2" }, { "input": "11 13 0", "output": "-1" }, { "input": "2 0 3", "output": "-1" }, { "input": "10 10 0", "output": "1" }, { "input": "10 11 10", "output": "2" }, { "input": "3 5 4", "output": "2" }, { "input": "11 22 3", "output": "2" }, { "input": "11 12 10", "output": "-1" }, { "input": "10 2 13", "output": "-1" }, { "input": "5 6 1", "output": "-1" }, { "input": "10 21 5", "output": "-1" }, { "input": "10 11 9", "output": "-1" }, { "input": "10 17 7", "output": "-1" }, { "input": "3 4 1", "output": "-1" }, { "input": "4 5 3", "output": "-1" }, { "input": "11 3 23", "output": "-1" }, { "input": "11 3 12", "output": "-1" }, { "input": "2 5 0", "output": "-1" }, { "input": "10 21 2", "output": "-1" }, { "input": "5 1 6", "output": "-1" }, { "input": "10 11 0", "output": "-1" }, { "input": "10 9 11", "output": "-1" }, { "input": "7 10 5", "output": "-1" }, { "input": "5 7 2", "output": "-1" }, { "input": "6 5 7", "output": "-1" }, { "input": "11 16 2", "output": "-1" }, { "input": "11 1000000000 10", "output": "-1" }, { "input": "10 2 21", "output": "-1" }, { "input": "10 15 1", "output": "-1" }, { "input": "5 2 8", "output": "-1" }, { "input": "11 10000000 10", "output": "-1" }, { "input": "10 1 101", "output": "-1" }, { "input": "20 24 2", "output": "-1" }, { "input": "11 24 0", "output": "-1" }, { "input": "11 17 4", "output": "-1" }, { "input": "11 13 1", "output": "-1" }, { "input": "10 11 2", "output": "-1" }, { "input": "11 23 3", "output": "-1" }, { "input": "10 99 0", "output": "-1" }, { "input": "6 7 4", "output": "-1" }, { "input": "11 1 22", "output": "2" }, { "input": "11 2 13", "output": "-1" }, { "input": "2 1 3", "output": "-1" }, { "input": "11 6 18", "output": "-1" }, { "input": "11 122 4", "output": "-1" }, { "input": "11 21 10", "output": "-1" }, { "input": "3 2 4", "output": "-1" }, { "input": "9 11 2", "output": "-1" }, { "input": "11 0 7", "output": "-1" }, { "input": "5 9 4", "output": "-1" }, { "input": "100 105 5", "output": "-1" }, { "input": "11 15 0", "output": "-1" }, { "input": "5 6 4", "output": "-1" }, { "input": "3 4 2", "output": "-1" }, { "input": "2 9 0", "output": "-1" }, { "input": "11 13 11", "output": "2" }, { "input": "11 15 5", "output": "-1" }, { "input": "11 4 15", "output": "-1" }, { "input": "10 1 0", "output": "-1" }, { "input": "11 16 8", "output": "-1" }, { "input": "10 43 0", "output": "-1" }, { "input": "11 13 5", "output": "-1" }, { "input": "11 22 0", "output": "2" }, { "input": "5 6 3", "output": "-1" }, { "input": "2 1 11", "output": "-1" }, { "input": "4 5 1", "output": "-1" }, { "input": "11 23 0", "output": "-1" }, { "input": "11 4 12", "output": "-1" }, { "input": "12 13 1", "output": "-1" }, { "input": "10 19 9", "output": "-1" }, { "input": "3 7 2", "output": "-1" }, { "input": "12 18 0", "output": "-1" }, { "input": "11 25 3", "output": "-1" }, { "input": "11 23 5", "output": "-1" }, { "input": "2 1 5", "output": "-1" }, { "input": "2 0 5", "output": "-1" }, { "input": "11 24 1", "output": "-1" }, { "input": "10 11 4", "output": "-1" }, { "input": "2 0 1", "output": "-1" }, { "input": "10 0 21", "output": "-1" }, { "input": "3 0 7", "output": "-1" }, { "input": "18 11 21", "output": "-1" }, { "input": "3 7 0", "output": "-1" }, { "input": "5 11 0", "output": "-1" }, { "input": "11 5 13", "output": "-1" }, { "input": "11 9 34", "output": "-1" }, { "input": "11 13 9", "output": "-1" }, { "input": "10 0 22", "output": "-1" }, { "input": "5 1 12", "output": "-1" }, { "input": "11 2 12", "output": "-1" }, { "input": "11 9 12", "output": "-1" }, { "input": "11 24 2", "output": "-1" }, { "input": "11 23 6", "output": "-1" }, { "input": "11 20 4", "output": "-1" }, { "input": "2 5 1", "output": "-1" }, { "input": "120 132 133", "output": "2" }, { "input": "11 111 4", "output": "-1" }, { "input": "10 7 11", "output": "-1" }, { "input": "6 13 0", "output": "-1" }, { "input": "5 11 1", "output": "-1" }, { "input": "11 5 27", "output": "-1" }, { "input": "11 15 3", "output": "-1" }, { "input": "11 0 13", "output": "-1" }, { "input": "11 13 10", "output": "-1" }, { "input": "11 25 5", "output": "-1" }, { "input": "4 3 5", "output": "-1" }, { "input": "100 199 100", "output": "2" }, { "input": "11 2 22", "output": "2" }, { "input": "10 20 2", "output": "2" }, { "input": "5 5 0", "output": "1" }, { "input": "10 11 1", "output": "-1" }, { "input": "11 12 2", "output": "-1" }, { "input": "5 16 3", "output": "-1" }, { "input": "12 14 1", "output": "-1" }, { "input": "10 22 2", "output": "-1" }, { "input": "2 4 0", "output": "2" }, { "input": "11 34 7", "output": "-1" }, { "input": "6 13 1", "output": "-1" }, { "input": "11 0 23", "output": "-1" }, { "input": "20 21 19", "output": "-1" }, { "input": "11 33 22", "output": "5" }, { "input": "10 4 41", "output": "-1" }, { "input": "3 4 0", "output": "-1" }, { "input": "11 15 7", "output": "-1" }, { "input": "5 0 6", "output": "-1" }, { "input": "11 3 22", "output": "2" }, { "input": "2 6 0", "output": "3" }, { "input": "10 11 11", "output": "2" }, { "input": "11 33 0", "output": "3" }, { "input": "4 6 2", "output": "-1" }, { "input": "11 76 2", "output": "-1" }, { "input": "7 9 4", "output": "-1" }, { "input": "10 43 1", "output": "-1" }, { "input": "22 25 5", "output": "-1" }, { "input": "3 5 2", "output": "-1" }, { "input": "11 1 24", "output": "-1" }, { "input": "12 25 3", "output": "-1" }, { "input": "11 0 22", "output": "2" }, { "input": "4 2 5", "output": "-1" }, { "input": "11 13 3", "output": "-1" }, { "input": "11 12 9", "output": "-1" }, { "input": "11 35 1", "output": "-1" }, { "input": "5 3 6", "output": "-1" }, { "input": "5 11 4", "output": "-1" }, { "input": "12 8 14", "output": "-1" }, { "input": "10 12 9", "output": "-1" }, { "input": "11 12 13", "output": "2" }, { "input": "11 15 2", "output": "-1" }, { "input": "11 23 4", "output": "-1" }, { "input": "5 3 11", "output": "-1" }, { "input": "6 13 2", "output": "-1" }, { "input": "4 1 0", "output": "-1" }, { "input": "11 32 10", "output": "-1" }, { "input": "2 11 1", "output": "-1" }, { "input": "10 11 7", "output": "-1" }, { "input": "11 26 0", "output": "-1" }, { "input": "100 205 5", "output": "-1" }, { "input": "4 0 2", "output": "-1" }, { "input": "10 11 8", "output": "-1" }, { "input": "11 22 5", "output": "2" }, { "input": "4 0 5", "output": "-1" }, { "input": "11 87 22", "output": "9" }, { "input": "4 8 0", "output": "2" }, { "input": "9 8 17", "output": "-1" }, { "input": "10 20 0", "output": "2" }, { "input": "10 9 19", "output": "-1" }, { "input": "12 2 13", "output": "-1" }, { "input": "11 24 5", "output": "-1" }, { "input": "10 1 11", "output": "-1" }, { "input": "4 0 9", "output": "-1" }, { "input": "3 0 1", "output": "-1" }, { "input": "11 12 4", "output": "-1" }, { "input": "3 8 2", "output": "-1" }, { "input": "11 17 10", "output": "-1" }, { "input": "6 1 13", "output": "-1" }, { "input": "11 25 0", "output": "-1" }, { "input": "12 0 13", "output": "-1" }, { "input": "10 5 20", "output": "2" }, { "input": "11 89 2", "output": "-1" }, { "input": "2 4 1", "output": "2" }, { "input": "10 31 0", "output": "-1" }, { "input": "11 34 1", "output": "-1" }, { "input": "999 6693 8331", "output": "14" }, { "input": "10 55 1", "output": "-1" }, { "input": "11 12 8", "output": "-1" }, { "input": "1 9 22", "output": "31" }, { "input": "7572 9186 895", "output": "-1" }, { "input": "3 2 11", "output": "-1" }, { "input": "2 1 4", "output": "2" }, { "input": "11 10 19", "output": "-1" }, { "input": "100 199 99", "output": "-1" }, { "input": "2537 8926 1523", "output": "-1" }, { "input": "11 0 5", "output": "-1" }, { "input": "5 1 11", "output": "-1" }, { "input": "12 13 5", "output": "-1" }, { "input": "10 12 0", "output": "-1" }, { "input": "5 4 7", "output": "-1" }, { "input": "12 25 1", "output": "-1" }, { "input": "7 9 0", "output": "-1" }, { "input": "4 15 0", "output": "-1" }, { "input": "5 11 2", "output": "-1" }, { "input": "11 58 3", "output": "-1" }, { "input": "10 11 5", "output": "-1" }, { "input": "10 3 1003", "output": "-1" }, { "input": "11 14 0", "output": "-1" }, { "input": "11 8 23", "output": "-1" }, { "input": "11 22 4", "output": "2" }, { "input": "5 2 0", "output": "-1" }, { "input": "11 1 35", "output": "-1" }, { "input": "12 25 5", "output": "-1" }, { "input": "11 37 4", "output": "-1" }, { "input": "20 42 3", "output": "-1" }, { "input": "10 12 2", "output": "-1" }, { "input": "4 1 5", "output": "-1" }, { "input": "5 16 0", "output": "-1" }, { "input": "11 13 7", "output": "-1" }, { "input": "5 0 3", "output": "-1" }, { "input": "11 2 11", "output": "1" }, { "input": "3 2 2000", "output": "-1" }, { "input": "3 0 4241", "output": "-1" }, { "input": "2 12 11", "output": "11" }, { "input": "10 2 82", "output": "-1" }, { "input": "11 0 11", "output": "1" }, { "input": "11 20 20", "output": "2" }, { "input": "5 0 10", "output": "2" }, { "input": "11 1 0", "output": "-1" }, { "input": "11 13 13", "output": "2" } ]
1,487,149,530
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
14
62
4,710,400
k, a, b = map(int, input().split()) s = a // k + b // k if s == 0: s = -1 print(s)
Title: Table Tennis Game 2 Time Limit: None seconds Memory Limit: None megabytes Problem Description: Misha and Vanya have played several table tennis sets. Each set consists of several serves, each serve is won by one of the players, he receives one point and the loser receives nothing. Once one of the players scores exactly *k* points, the score is reset and a new set begins. Across all the sets Misha scored *a* points in total, and Vanya scored *b* points. Given this information, determine the maximum number of sets they could have played, or that the situation is impossible. Note that the game consisted of several complete sets. Input Specification: The first line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=109, 0<=≤<=*a*,<=*b*<=≤<=109, *a*<=+<=*b*<=&gt;<=0). Output Specification: If the situation is impossible, print a single number -1. Otherwise, print the maximum possible number of sets. Demo Input: ['11 11 5\n', '11 2 3\n'] Demo Output: ['1\n', '-1\n'] Note: Note that the rules of the game in this problem differ from the real table tennis game, for example, the rule of "balance" (the winning player has to be at least two points ahead to win a set) has no power within the present problem.
```python k, a, b = map(int, input().split()) s = a // k + b // k if s == 0: s = -1 print(s) ```
0
586
A
Alena's Schedule
PROGRAMMING
900
[ "implementation" ]
null
null
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
Print a single number — the number of pairs during which Alena stays at the university.
[ "5\n0 1 0 1 1\n", "7\n1 0 1 0 0 1 0\n", "1\n0\n" ]
[ "4\n", "4\n", "0\n" ]
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
500
[ { "input": "5\n0 1 0 1 1", "output": "4" }, { "input": "7\n1 0 1 0 0 1 0", "output": "4" }, { "input": "1\n0", "output": "0" }, { "input": "1\n1", "output": "1" }, { "input": "2\n0 0", "output": "0" }, { "input": "2\n0 1", "output": "1" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n1 1", "output": "2" }, { "input": "10\n0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "9\n1 1 1 1 1 1 1 1 1", "output": "9" }, { "input": "11\n0 0 0 0 0 0 0 0 0 0 1", "output": "1" }, { "input": "12\n1 0 0 0 0 0 0 0 0 0 0 0", "output": "1" }, { "input": "20\n1 1 0 1 1 1 1 1 1 1 1 0 1 1 1 0 0 1 0 0", "output": "16" }, { "input": "41\n1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 0 1 0 1 1", "output": "28" }, { "input": "63\n1 1 0 1 1 0 0 0 1 1 0 0 1 1 1 1 0 1 1 0 1 0 1 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 0 0 1 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 0", "output": "39" }, { "input": "80\n0 1 1 1 0 1 1 1 1 1 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 1 0 1 1 0 0 0 0 1 1 1 0 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 1 1 1 0 0 0 1 1 0 0 1 1", "output": "52" }, { "input": "99\n1 1 0 0 0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 1 1 1 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 0 0 1 0 1 0 1 0 1 1 0 1 0 1", "output": "72" }, { "input": "100\n0 1 1 0 1 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 1 0 0 1 0 0 1 0 0 0 0 1 1 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 1 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 0 1 1 1 1 0 1 1 1 0", "output": "65" }, { "input": "11\n0 1 1 0 0 0 0 0 0 0 0", "output": "2" }, { "input": "11\n0 1 0 1 0 0 1 1 0 1 1", "output": "8" }, { "input": "11\n1 0 1 0 1 1 0 1 1 1 0", "output": "10" }, { "input": "11\n1 0 0 0 0 0 1 0 1 1 1", "output": "6" }, { "input": "22\n0 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0 0 1 0", "output": "7" }, { "input": "22\n0 1 0 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 0 0 0 1", "output": "16" }, { "input": "22\n1 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 1 1 0", "output": "11" }, { "input": "22\n1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 1", "output": "14" }, { "input": "33\n0 1 1 0 1 1 0 1 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 1 1 0 1 1 0 0", "output": "26" }, { "input": "33\n0 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 1 1 1 0 1 1 1 0 1", "output": "27" }, { "input": "33\n1 0 1 0 1 0 0 0 1 0 1 1 1 0 0 0 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1 1 0", "output": "25" }, { "input": "33\n1 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 0 1 0 1 0 1 0 0 0 0 1 1", "output": "24" }, { "input": "44\n0 1 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 1 1 0 0", "output": "19" }, { "input": "44\n0 1 1 1 1 0 1 0 0 1 0 1 0 0 1 1 0 1 1 0 0 1 0 1 0 1 1 0 1 0 1 0 1 0 1 0 0 0 0 0 1 0 1 1", "output": "32" }, { "input": "44\n1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0", "output": "23" }, { "input": "44\n1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1", "output": "32" }, { "input": "55\n0 1 1 0 1 0 0 0 1 0 0 0 1 0 1 0 0 1 0 0 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0", "output": "23" }, { "input": "55\n0 1 1 0 1 0 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 0 1 0 0 1 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 0 1 1 0 0 0 1", "output": "39" }, { "input": "55\n1 0 1 0 0 1 0 0 1 1 0 1 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 0 1 0 1 0 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 0", "output": "32" }, { "input": "55\n1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 1", "output": "36" }, { "input": "66\n0 1 1 0 0 1 0 1 0 1 0 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 0 0 0 1 0 0 0 1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 1 1 0 1 1 1 0 0 0 0 0 1 0", "output": "41" }, { "input": "66\n0 1 1 0 1 1 1 0 0 0 1 1 0 1 1 0 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 1 0 1", "output": "42" }, { "input": "66\n1 0 1 0 0 0 1 0 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 1 1 0 1 1 0 1 1 0 0", "output": "46" }, { "input": "66\n1 0 1 0 0 0 1 1 1 1 1 0 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 0 1 0 1 1 0 0 0 1", "output": "46" }, { "input": "77\n0 0 1 0 0 1 0 0 1 1 1 1 0 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 0 1 0", "output": "47" }, { "input": "77\n0 0 1 0 0 0 1 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 1 1", "output": "44" }, { "input": "77\n1 0 0 0 1 0 1 1 0 0 1 0 0 0 1 1 1 1 0 1 0 0 0 0 0 0 1 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 0 0 1 1 0 1 1 1 0 1 1 0 0 1 0 0 1 1 1 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0", "output": "45" }, { "input": "77\n1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 1 1 1 0 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 1 1 1 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 1 1 1 1 1 0 0 1 0 1 1", "output": "51" }, { "input": "88\n0 0 1 0 0 0 0 0 0 0 0 1 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 0 0 0 0 1 0 0 0 1 0 1 1 0 1 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0", "output": "44" }, { "input": "88\n0 0 1 0 0 0 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 1 0 1 0 0 0 0 0 0 0 1", "output": "59" }, { "input": "88\n1 0 0 0 1 1 1 0 1 1 0 0 0 0 0 0 1 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 1 1 0 0 1 0 1 1 1 0 1 0 1 1 1 1 0 1 0 1 1 1 0 0 0", "output": "53" }, { "input": "88\n1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 0 0 1 0 1 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 1 0 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 0 1", "output": "63" }, { "input": "99\n0 0 0 0 1 0 0 1 0 0 0 1 1 1 1 1 1 0 1 1 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 0 1 1 0 0 0 0", "output": "56" }, { "input": "99\n0 0 1 0 0 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 1 1 0 0 0 1 1 0 0 0 1 0 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 0 0 0 1 1 1", "output": "58" }, { "input": "99\n1 1 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 0 0 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 0 1 0 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 1 0 1 1 0 1 0 1 1 1 1 0 0 1 0", "output": "65" }, { "input": "99\n1 1 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 0 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 0 1 0 1 0 0 0 1 1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 1 1 1", "output": "77" }, { "input": "90\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "90" }, { "input": "95\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "95\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "95" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "100" } ]
1,518,525,871
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
5,632,000
# =================================== # (c) MidAndFeed aka ASilentVoice # =================================== # import math, fractions, collections # =================================== n = int(input()) q = [int(x) for x in input().split()] go = 0 np = 0 ans = 0 for i in range(n): if not(go): if q[i] == 1: go = 1 t = q[i] if t == 0: if (i+1 < n and t == q[i+1]) or (i-1 >= 0 and t == q[i-1]) or (i == n-1): go = 0 continue ans += 1 print(ans)
Title: Alena's Schedule Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alena has successfully passed the entrance exams to the university and is now looking forward to start studying. One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes). The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks). The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not. Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university. Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home. Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair. Input Specification: The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university. The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces. Output Specification: Print a single number — the number of pairs during which Alena stays at the university. Demo Input: ['5\n0 1 0 1 1\n', '7\n1 0 1 0 0 1 0\n', '1\n0\n'] Demo Output: ['4\n', '4\n', '0\n'] Note: In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair. In the last sample Alena doesn't have a single pair, so she spends all the time at home.
```python # =================================== # (c) MidAndFeed aka ASilentVoice # =================================== # import math, fractions, collections # =================================== n = int(input()) q = [int(x) for x in input().split()] go = 0 np = 0 ans = 0 for i in range(n): if not(go): if q[i] == 1: go = 1 t = q[i] if t == 0: if (i+1 < n and t == q[i+1]) or (i-1 >= 0 and t == q[i-1]) or (i == n-1): go = 0 continue ans += 1 print(ans) ```
0
769
B
News About Credit
PROGRAMMING
1,200
[ "*special", "greedy", "two pointers" ]
null
null
Polycarp studies at the university in the group which consists of *n* students (including himself). All they are registrated in the social net "TheContacnt!". Not all students are equally sociable. About each student you know the value *a**i* — the maximum number of messages which the *i*-th student is agree to send per day. The student can't send messages to himself. In early morning Polycarp knew important news that the programming credit will be tomorrow. For this reason it is necessary to urgently inform all groupmates about this news using private messages. Your task is to make a plan of using private messages, so that: - the student *i* sends no more than *a**i* messages (for all *i* from 1 to *n*); - all students knew the news about the credit (initially only Polycarp knew it); - the student can inform the other student only if he knows it himself. Let's consider that all students are numerated by distinct numbers from 1 to *n*, and Polycarp always has the number 1. In that task you shouldn't minimize the number of messages, the moment of time, when all knew about credit or some other parameters. Find any way how to use private messages which satisfies requirements above.
The first line contains the positive integer *n* (2<=≤<=*n*<=≤<=100) — the number of students. The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100), where *a**i* equals to the maximum number of messages which can the *i*-th student agree to send. Consider that Polycarp always has the number 1.
Print -1 to the first line if it is impossible to inform all students about credit. Otherwise, in the first line print the integer *k* — the number of messages which will be sent. In each of the next *k* lines print two distinct integers *f* and *t*, meaning that the student number *f* sent the message with news to the student number *t*. All messages should be printed in chronological order. It means that the student, who is sending the message, must already know this news. It is assumed that students can receive repeated messages with news of the credit. If there are several answers, it is acceptable to print any of them.
[ "4\n1 2 1 0\n", "6\n2 0 1 3 2 0\n", "3\n0 2 2\n" ]
[ "3\n1 2\n2 4\n2 3\n", "6\n1 3\n3 4\n1 2\n4 5\n5 6\n4 6\n", "-1\n" ]
In the first test Polycarp (the student number 1) can send the message to the student number 2, who after that can send the message to students number 3 and 4. Thus, all students knew about the credit.
1,000
[ { "input": "4\n1 2 1 0", "output": "3\n1 2\n2 3\n2 4" }, { "input": "6\n2 0 1 3 2 0", "output": "5\n1 4\n1 5\n4 3\n4 2\n4 6" }, { "input": "3\n0 2 2", "output": "-1" }, { "input": "2\n0 0", "output": "-1" }, { "input": "2\n1 0", "output": "1\n1 2" }, { "input": "2\n0 1", "output": "-1" }, { "input": "2\n1 1", "output": "1\n1 2" }, { "input": "3\n1 1 0", "output": "2\n1 2\n2 3" }, { "input": "3\n0 1 1", "output": "-1" }, { "input": "3\n1 0 0", "output": "-1" }, { "input": "3\n2 0 0", "output": "2\n1 2\n1 3" }, { "input": "3\n1 0 1", "output": "2\n1 3\n3 2" }, { "input": "3\n1 1 1", "output": "2\n1 2\n2 3" }, { "input": "40\n3 3 2 1 0 0 0 4 5 4 0 0 0 1 0 0 0 0 0 0 0 0 0 1 0 0 0 2 3 2 0 1 0 0 2 0 3 0 1 0", "output": "-1" }, { "input": "100\n1 0 0 2 0 2 0 0 2 0 0 2 0 0 2 2 2 1 1 2 1 2 2 2 1 2 0 1 0 1 0 2 2 2 0 1 2 0 0 2 0 2 0 1 1 0 1 0 2 0 0 2 1 2 1 2 2 2 2 1 0 2 0 0 1 0 2 0 0 2 0 1 0 2 1 1 2 2 2 2 0 0 2 0 2 1 0 0 0 1 0 2 2 2 0 1 0 1 1 0", "output": "99\n1 4\n4 6\n4 9\n6 12\n6 15\n9 16\n9 17\n12 20\n12 22\n15 23\n15 24\n16 26\n16 32\n17 33\n17 34\n20 37\n20 40\n22 42\n22 49\n23 52\n23 54\n24 56\n24 57\n26 58\n26 59\n32 62\n32 67\n33 70\n33 74\n34 77\n34 78\n37 79\n37 80\n40 83\n40 85\n42 92\n42 93\n49 94\n49 18\n52 19\n52 21\n54 25\n54 28\n56 30\n56 36\n57 44\n57 45\n58 47\n58 53\n59 55\n59 60\n62 65\n62 72\n67 75\n67 76\n70 86\n70 90\n74 96\n74 98\n77 99\n77 2\n78 3\n78 5\n79 7\n79 8\n80 10\n80 11\n83 13\n83 14\n85 27\n85 29\n92 31\n92 35\n93 38\n93 3..." }, { "input": "4\n2 0 0 0", "output": "-1" }, { "input": "4\n2 0 0 1", "output": "3\n1 4\n1 2\n4 3" }, { "input": "4\n2 0 1 0", "output": "3\n1 3\n1 2\n3 4" }, { "input": "4\n2 1 0 0", "output": "3\n1 2\n1 3\n2 4" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "-1" }, { "input": "100\n99 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87\n..." }, { "input": "100\n98 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "-1" }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "99\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n..." }, { "input": "100\n1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "99\n1 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 7..." }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0", "output": "99\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n..." }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "99\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87\n..." }, { "input": "100\n1 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "99\n1 2\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31\n2 32\n2 33\n2 34\n2 35\n2 36\n2 37\n2 38\n2 39\n2 40\n2 41\n2 42\n2 43\n2 44\n2 45\n2 46\n2 47\n2 48\n2 49\n2 50\n2 51\n2 52\n2 53\n2 54\n2 55\n2 56\n2 57\n2 58\n2 59\n2 60\n2 61\n2 62\n2 63\n2 64\n2 65\n2 66\n2 67\n2 68\n2 69\n2 70\n2 71\n2 72\n2 73\n2 74\n2 75\n2 76\n2 77\n2 78\n2 79\n2 80\n2 81\n2 82\n2 83\n2 84\n2 85\n2 86\n2 87\n..." }, { "input": "100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 98 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99\n1 55\n55 2\n55 3\n55 4\n55 5\n55 6\n55 7\n55 8\n55 9\n55 10\n55 11\n55 12\n55 13\n55 14\n55 15\n55 16\n55 17\n55 18\n55 19\n55 20\n55 21\n55 22\n55 23\n55 24\n55 25\n55 26\n55 27\n55 28\n55 29\n55 30\n55 31\n55 32\n55 33\n55 34\n55 35\n55 36\n55 37\n55 38\n55 39\n55 40\n55 41\n55 42\n55 43\n55 44\n55 45\n55 46\n55 47\n55 48\n55 49\n55 50\n55 51\n55 52\n55 53\n55 54\n55 56\n55 57\n55 58\n55 59\n55 60\n55 61\n55 62\n55 63\n55 64\n55 65\n55 66\n55 67\n55 68\n55 69\n55 70\n55 71\n55 72\n55 73\n55 74\n55 75..." }, { "input": "2\n0 1", "output": "-1" }, { "input": "5\n0 0 1 1 2", "output": "-1" }, { "input": "7\n2 0 0 0 1 0 3", "output": "6\n1 7\n1 5\n7 2\n7 3\n7 4\n5 6" }, { "input": "10\n3 0 0 0 0 2 0 1 0 3", "output": "9\n1 10\n1 6\n1 8\n10 2\n10 3\n10 4\n6 5\n6 7\n8 9" }, { "input": "20\n0 2 0 0 2 0 0 2 2 0 0 2 0 2 1 0 1 3 1 1", "output": "-1" }, { "input": "30\n2 0 2 2 0 2 2 0 0 0 3 0 1 1 2 0 0 2 2 0 1 0 3 0 1 0 2 0 0 1", "output": "29\n1 11\n1 23\n11 3\n11 4\n11 6\n23 7\n23 15\n23 18\n3 19\n3 27\n4 13\n4 14\n6 21\n6 25\n7 30\n7 2\n15 5\n15 8\n18 9\n18 10\n19 12\n19 16\n27 17\n27 20\n13 22\n14 24\n21 26\n25 28\n30 29" }, { "input": "31\n2 0 0 4 0 0 0 0 0 0 0 0 0 3 2 0 0 0 0 0 3 0 4 3 0 2 0 0 0 3 4", "output": "30\n1 4\n1 23\n4 31\n4 14\n4 21\n4 24\n23 30\n23 15\n23 26\n23 2\n31 3\n31 5\n31 6\n31 7\n14 8\n14 9\n14 10\n21 11\n21 12\n21 13\n24 16\n24 17\n24 18\n30 19\n30 20\n30 22\n15 25\n15 27\n26 28\n26 29" }, { "input": "39\n2 0 3 0 0 2 0 0 2 1 1 0 0 3 3 0 2 0 2 3 0 0 3 0 3 2 0 0 3 0 0 0 3 0 0 0 0 0 0", "output": "38\n1 3\n1 14\n3 15\n3 20\n3 23\n14 25\n14 29\n14 33\n15 6\n15 9\n15 17\n20 19\n20 26\n20 10\n23 11\n23 2\n23 4\n25 5\n25 7\n25 8\n29 12\n29 13\n29 16\n33 18\n33 21\n33 22\n6 24\n6 27\n9 28\n9 30\n17 31\n17 32\n19 34\n19 35\n26 36\n26 37\n10 38\n11 39" }, { "input": "58\n4 2 1 3 5 3 0 0 1 0 3 0 2 1 0 0 0 4 0 0 0 0 0 1 2 3 4 0 1 1 0 0 1 0 0 0 2 0 0 0 0 2 2 0 2 0 0 4 0 2 0 0 0 0 0 1 0 0", "output": "57\n1 5\n1 18\n1 27\n1 48\n5 4\n5 6\n5 11\n5 26\n5 2\n18 13\n18 25\n18 37\n18 42\n27 43\n27 45\n27 50\n27 3\n48 9\n48 14\n48 24\n48 29\n4 30\n4 33\n4 56\n6 7\n6 8\n6 10\n11 12\n11 15\n11 16\n26 17\n26 19\n26 20\n2 21\n2 22\n13 23\n13 28\n25 31\n25 32\n37 34\n37 35\n42 36\n42 38\n43 39\n43 40\n45 41\n45 44\n50 46\n50 47\n3 49\n9 51\n14 52\n24 53\n29 54\n30 55\n33 57\n56 58" }, { "input": "65\n3 0 0 0 0 3 0 0 0 0 0 4 2 0 0 0 0 0 0 0 0 8 0 0 0 0 0 6 7 0 3 0 0 0 0 4 0 3 0 0 0 0 1 0 0 5 0 0 0 0 3 0 0 4 0 0 0 0 0 1 0 0 0 0 7", "output": "64\n1 22\n1 29\n1 65\n22 28\n22 46\n22 12\n22 36\n22 54\n22 6\n22 31\n22 38\n29 51\n29 13\n29 43\n29 60\n29 2\n29 3\n29 4\n65 5\n65 7\n65 8\n65 9\n65 10\n65 11\n65 14\n28 15\n28 16\n28 17\n28 18\n28 19\n28 20\n46 21\n46 23\n46 24\n46 25\n46 26\n12 27\n12 30\n12 32\n12 33\n36 34\n36 35\n36 37\n36 39\n54 40\n54 41\n54 42\n54 44\n6 45\n6 47\n6 48\n31 49\n31 50\n31 52\n38 53\n38 55\n38 56\n51 57\n51 58\n51 59\n13 61\n13 62\n43 63\n60 64" }, { "input": "77\n7 0 0 0 0 0 0 0 0 8 0 0 0 0 3 0 0 0 0 9 0 0 0 7 0 0 0 0 0 0 0 0 0 0 0 0 8 0 0 0 0 0 2 6 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 7 0 0 9 0 0 0 0 0 0 0 0 0 0 0 0 0 8", "output": "76\n1 20\n1 63\n1 10\n1 37\n1 77\n1 24\n1 60\n20 44\n20 15\n20 43\n20 55\n20 2\n20 3\n20 4\n20 5\n20 6\n63 7\n63 8\n63 9\n63 11\n63 12\n63 13\n63 14\n63 16\n63 17\n10 18\n10 19\n10 21\n10 22\n10 23\n10 25\n10 26\n10 27\n37 28\n37 29\n37 30\n37 31\n37 32\n37 33\n37 34\n37 35\n77 36\n77 38\n77 39\n77 40\n77 41\n77 42\n77 45\n77 46\n24 47\n24 48\n24 49\n24 50\n24 51\n24 52\n24 53\n60 54\n60 56\n60 57\n60 58\n60 59\n60 61\n60 62\n44 64\n44 65\n44 66\n44 67\n44 68\n44 69\n15 70\n15 71\n15 72\n43 73\n43 74\n55 7..." }, { "input": "80\n2 3 0 2 2 1 3 3 3 0 0 0 1 0 1 0 3 1 0 2 0 2 3 0 2 3 0 3 0 0 0 3 0 0 0 2 3 0 0 2 0 0 0 0 0 3 2 0 0 3 0 3 0 3 0 3 1 2 0 0 0 0 0 0 0 1 0 3 0 0 0 1 0 2 0 2 0 0 0 0", "output": "79\n1 2\n1 7\n2 8\n2 9\n2 17\n7 23\n7 26\n7 28\n8 32\n8 37\n8 46\n9 50\n9 52\n9 54\n17 56\n17 68\n17 4\n23 5\n23 20\n23 22\n26 25\n26 36\n26 40\n28 47\n28 58\n28 74\n32 76\n32 6\n32 13\n37 15\n37 18\n37 57\n46 66\n46 72\n46 3\n50 10\n50 11\n50 12\n52 14\n52 16\n52 19\n54 21\n54 24\n54 27\n56 29\n56 30\n56 31\n68 33\n68 34\n68 35\n4 38\n4 39\n5 41\n5 42\n20 43\n20 44\n22 45\n22 48\n25 49\n25 51\n36 53\n36 55\n40 59\n40 60\n47 61\n47 62\n58 63\n58 64\n74 65\n74 67\n76 69\n76 70\n6 71\n13 73\n15 75\n18 77\n57..." }, { "input": "90\n2 0 0 0 0 1 2 0 1 1 0 1 0 4 0 1 1 0 1 0 1 0 1 1 2 0 0 1 2 3 0 1 1 0 0 1 1 0 0 2 0 2 2 1 0 1 0 0 2 0 1 4 2 0 1 2 2 0 1 0 0 5 0 0 3 0 1 2 0 0 0 0 2 3 0 0 3 3 0 3 3 0 0 0 1 0 1 2 2 2", "output": "89\n1 62\n1 14\n62 52\n62 30\n62 65\n62 74\n62 77\n14 78\n14 80\n14 81\n14 7\n52 25\n52 29\n52 40\n52 42\n30 43\n30 49\n30 53\n65 56\n65 57\n65 68\n74 73\n74 88\n74 89\n77 90\n77 6\n77 9\n78 10\n78 12\n78 16\n80 17\n80 19\n80 21\n81 23\n81 24\n81 28\n7 32\n7 33\n25 36\n25 37\n29 44\n29 46\n40 51\n40 55\n42 59\n42 67\n43 85\n43 87\n49 2\n49 3\n53 4\n53 5\n56 8\n56 11\n57 13\n57 15\n68 18\n68 20\n73 22\n73 26\n88 27\n88 31\n89 34\n89 35\n90 38\n90 39\n6 41\n9 45\n10 47\n12 48\n16 50\n17 54\n19 58\n21 60\n23 ..." }, { "input": "99\n1 2 1 0 2 1 2 0 1 2 1 1 2 1 0 2 0 0 1 2 0 1 1 1 0 0 1 1 2 3 1 0 0 0 1 1 0 0 1 2 1 0 2 0 0 2 0 1 0 2 1 1 0 0 3 1 0 2 2 2 2 1 0 2 0 1 1 0 3 2 0 0 1 1 2 0 0 2 0 0 1 2 3 0 3 0 0 3 0 3 0 1 2 1 0 1 0 1 1", "output": "98\n1 30\n30 55\n30 69\n30 83\n55 85\n55 88\n55 90\n69 2\n69 5\n69 7\n83 10\n83 13\n83 16\n85 20\n85 29\n85 40\n88 43\n88 46\n88 50\n90 58\n90 59\n90 60\n2 61\n2 64\n5 70\n5 75\n7 78\n7 82\n10 93\n10 3\n13 6\n13 9\n16 11\n16 12\n20 14\n20 19\n29 22\n29 23\n40 24\n40 27\n43 28\n43 31\n46 35\n46 36\n50 39\n50 41\n58 48\n58 51\n59 52\n59 56\n60 62\n60 66\n61 67\n61 73\n64 74\n64 81\n70 92\n70 94\n75 96\n75 98\n78 99\n78 4\n82 8\n82 15\n93 17\n93 18\n3 21\n6 25\n9 26\n11 32\n12 33\n14 34\n19 37\n22 38\n23 42\n..." }, { "input": "100\n18 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16 0 0 0 0 0 13 0 0 0 0 0 15 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 15 0 0 0 0 0 0 0 0 6 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16 0", "output": "99\n1 26\n1 99\n1 38\n1 62\n1 32\n1 71\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n26 14\n26 15\n26 16\n26 17\n26 18\n26 19\n26 20\n26 21\n26 22\n26 23\n26 24\n26 25\n26 27\n26 28\n26 29\n26 30\n99 31\n99 33\n99 34\n99 35\n99 36\n99 37\n99 39\n99 40\n99 41\n99 42\n99 43\n99 44\n99 45\n99 46\n99 47\n99 48\n38 49\n38 50\n38 51\n38 52\n38 53\n38 54\n38 55\n38 56\n38 57\n38 58\n38 59\n38 60\n38 61\n38 63\n38 64\n62 65\n62 66\n62 67\n62 68\n62 69\n62 70\n62 72\n62 73\n62 74\n62 75\n62 76\n6..." }, { "input": "100\n3 2 1 0 1 0 0 0 2 3 2 1 0 0 0 3 1 1 3 0 1 1 1 3 0 2 2 2 0 1 1 1 0 0 1 0 2 1 1 2 1 0 0 0 1 1 0 3 0 0 0 4 1 2 0 0 0 1 0 3 2 0 0 2 0 3 0 1 4 2 1 0 0 1 1 0 1 0 0 4 0 1 0 1 0 1 1 0 0 0 0 1 2 0 0 0 3 3 0 2", "output": "99\n1 52\n1 69\n1 80\n52 10\n52 16\n52 19\n52 24\n69 48\n69 60\n69 66\n69 97\n80 98\n80 2\n80 9\n80 11\n10 26\n10 27\n10 28\n16 37\n16 40\n16 54\n19 61\n19 64\n19 70\n24 93\n24 100\n24 3\n48 5\n48 12\n48 17\n60 18\n60 21\n60 22\n66 23\n66 30\n66 31\n97 32\n97 35\n97 38\n98 39\n98 41\n98 45\n2 46\n2 53\n9 58\n9 68\n11 71\n11 74\n26 75\n26 77\n27 82\n27 84\n28 86\n28 87\n37 92\n37 4\n40 6\n40 7\n54 8\n54 13\n61 14\n61 15\n64 20\n64 25\n70 29\n70 33\n93 34\n93 36\n100 42\n100 43\n3 44\n5 47\n12 49\n17 50\n18 ..." }, { "input": "100\n66 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 33 0 0 0", "output": "99\n1 97\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n97 67\n97 68\n97 69\n97 70\n97 71\n97 72\n97 73\n97 74\n97 75\n97 76\n97 77\n97 78\n97 79\n97 80\n97 81\n97 82\n97 83\n..." }, { "input": "20\n0 0 3 0 0 0 3 4 2 0 2 0 0 0 0 1 0 1 0 1", "output": "-1" }, { "input": "60\n3 0 0 1 0 0 0 0 3 1 3 4 0 0 0 3 0 0 0 2 0 3 4 1 3 3 0 2 0 4 1 5 3 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 1 1 0 1 0 3 0 0", "output": "-1" }, { "input": "80\n4 0 0 0 0 0 0 3 0 3 0 0 0 4 3 0 1 0 2 0 0 0 5 0 5 0 0 0 0 4 0 3 0 0 0 1 0 0 2 0 5 2 0 0 4 4 0 3 0 0 0 0 0 0 0 2 5 0 2 0 0 0 0 0 0 0 0 0 0 3 0 0 3 5 0 0 0 0 0 0", "output": "-1" }, { "input": "100\n2 0 0 2 0 0 0 0 0 2 0 0 0 5 0 0 0 0 0 0 0 1 0 7 0 0 0 0 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 0 0 0 0 0 0 6 0 7 4 0 0 0 0 5 0 0 0 0 0 0 7 4 0 0 0 0 0 0 7 7 0 0 0 0 0 2 0 0 0 0 0 0 0 0 4 7 7 0 0 0", "output": "-1" }, { "input": "100\n1 0 0 0 1 2 3 2 1 0 1 2 3 1 3 1 0 0 1 1 0 0 2 1 2 1 3 3 1 0 0 1 0 2 2 0 3 0 1 1 1 2 0 2 0 1 0 2 0 1 2 2 0 0 0 0 1 0 0 0 1 1 4 0 2 0 1 0 2 0 2 2 2 1 1 0 0 2 0 3 1 0 0 1 1 0 1 0 2 3 2 0 1 2 0 0 0 0 0 1", "output": "99\n1 63\n63 7\n63 13\n63 15\n63 27\n7 28\n7 37\n7 80\n13 90\n13 6\n13 8\n15 12\n15 23\n15 25\n27 34\n27 35\n27 42\n28 44\n28 48\n28 51\n37 52\n37 65\n37 69\n80 71\n80 72\n80 73\n90 78\n90 89\n90 91\n6 94\n6 5\n8 9\n8 11\n12 14\n12 16\n23 19\n23 20\n25 24\n25 26\n34 29\n34 32\n35 39\n35 40\n42 41\n42 46\n44 50\n44 57\n48 61\n48 62\n51 67\n51 74\n52 75\n52 81\n65 84\n65 85\n69 87\n69 93\n71 100\n71 2\n72 3\n72 4\n73 10\n73 17\n78 18\n78 21\n89 22\n89 30\n91 31\n91 33\n94 36\n94 38\n5 43\n9 45\n11 47\n14 49\n..." }, { "input": "100\n5 0 0 1 1 0 0 0 1 0 0 0 0 0 5 0 2 1 0 1 0 6 0 0 0 3 0 0 0 0 0 0 0 0 1 0 3 0 0 0 0 0 0 4 0 0 3 1 1 0 0 4 0 0 0 0 0 0 3 2 3 3 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 1 0 5 1 0 8 0 1 0 0 10 4 0 0 0 6 4 0 0 0 0 1", "output": "99\n1 89\n1 84\n1 22\n1 94\n1 15\n89 81\n89 44\n89 52\n89 90\n89 95\n89 26\n89 37\n89 47\n89 59\n89 61\n84 62\n84 17\n84 60\n84 75\n84 78\n84 4\n84 5\n84 9\n22 18\n22 20\n22 35\n22 48\n22 49\n22 79\n94 82\n94 86\n94 100\n94 2\n94 3\n94 6\n15 7\n15 8\n15 10\n15 11\n15 12\n81 13\n81 14\n81 16\n81 19\n81 21\n44 23\n44 24\n44 25\n44 27\n52 28\n52 29\n52 30\n52 31\n90 32\n90 33\n90 34\n90 36\n95 38\n95 39\n95 40\n95 41\n26 42\n26 43\n26 45\n37 46\n37 50\n37 51\n47 53\n47 54\n47 55\n59 56\n59 57\n59 58\n61 63\n6..." }, { "input": "100\n47 0 0 0 0 0 0 0 0 0 0 9 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 4 0 1 0 2 0 0 1 0 0 0 0 0 1 18 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 9 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0", "output": "99\n1 47\n1 12\n1 66\n1 33\n1 93\n1 37\n1 81\n1 25\n1 35\n1 40\n1 46\n1 61\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 34\n1 36\n1 38\n1 39\n1 41\n1 42\n47 43\n47 44\n47 45\n47 48\n47 49\n47 50\n47 51\n47 52\n47 53\n47 54\n47 55\n47 56\n47 57\n47 58\n47 59\n47 60\n47 62\n47 63\n12 64\n12 65\n12 67\n12 68\n12 69\n12 70\n12 71\n12 72\n12 73\n66 74\n66 75\n66 76\n66 77\n66 78\n66 79\n66..." }, { "input": "100\n1 0 2 1 1 1 0 0 0 3 2 1 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 2 1 0 2 1 1 1 0 0 1 2 1 3 1 1 0 0 2 1 0 1 1 1 2 1 2 0 3 1 2 0 1 1 2 2 1 1 1 1 1 2 0 0 2 1 1 0 1 2 1 1 1 1 1 0 1 1 1 0 3 0 0 2 2 0 0 0 2 1 2 0", "output": "99\n1 10\n10 42\n10 57\n10 89\n42 3\n42 11\n42 30\n57 33\n57 40\n57 47\n89 53\n89 55\n89 59\n3 63\n3 64\n11 70\n11 73\n30 78\n30 92\n33 93\n33 97\n40 99\n40 4\n47 5\n47 6\n53 12\n53 13\n55 14\n55 16\n59 18\n59 19\n63 20\n63 22\n64 23\n64 24\n70 26\n70 27\n73 28\n73 29\n78 31\n78 34\n92 35\n92 36\n93 39\n93 41\n97 43\n97 44\n99 48\n99 50\n4 51\n5 52\n6 54\n12 58\n13 61\n14 62\n16 65\n18 66\n19 67\n20 68\n22 69\n23 74\n24 75\n26 77\n27 79\n28 80\n29 81\n31 82\n34 83\n35 85\n36 86\n39 87\n41 98\n43 2\n44 7\n4..." }, { "input": "100\n83 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 0", "output": "99\n1 99\n1 83\n1 22\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n99 84\n99 85\n99 ..." }, { "input": "100\n1 1 0 1 0 1 1 1 2 1 0 1 1 0 1 2 1 1 1 1 2 1 1 0 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 0 2 2 2 2 1 1 0 1 2 1 1 0 1 1 0 1 0 1 1 0 0 1 1 1 1 1 1 2 0 2 1 2 1 1 0 0 1 1 1 1 0 2 4 2 1 1 1 0 1 2 1 1 1 0 2 1 2", "output": "99\n1 86\n86 9\n86 16\n86 21\n86 44\n9 45\n9 46\n16 47\n16 52\n21 71\n21 73\n44 75\n44 85\n45 87\n45 93\n46 98\n46 100\n47 2\n47 4\n52 6\n52 7\n71 8\n71 10\n73 12\n73 13\n75 15\n75 17\n85 18\n85 19\n87 20\n87 22\n93 23\n93 25\n98 27\n98 28\n100 29\n100 30\n2 31\n4 32\n6 33\n7 34\n8 35\n10 36\n12 37\n13 38\n15 39\n17 41\n18 42\n19 48\n20 49\n22 51\n23 53\n25 54\n27 56\n28 57\n29 59\n30 61\n31 62\n32 65\n33 66\n34 67\n35 68\n36 69\n37 70\n38 74\n39 76\n41 77\n42 80\n48 81\n49 82\n51 83\n53 88\n54 89\n56 90\n..." }, { "input": "100\n99 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "99\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87\n..." }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "99\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 52\n52 53\n53 54\n54 55\n55 56\n56 57\n57 58\n58 59\n59 60\n60 61\n61 62\n62 63\n63 64\n64 65\n65 66\n66 67\n67 68\n68 69\n69 70\n70 71\n71 72\n72 73\n73 74\n74 75\n75 76\n76 77\n..." }, { "input": "2\n0 100", "output": "-1" }, { "input": "2\n100 0", "output": "1\n1 2" }, { "input": "2\n100 100", "output": "1\n1 2" } ]
1,488,644,613
15,813
Python 3
WRONG_ANSWER
PRETESTS
4
46
4,608,000
def dfs(v): vis[v] = True for i in range(arr[v]): if False not in vis: print(len(ans)) for i in ans: print(*i) exit() for j in range(n): if not vis[j]: ans.append((v + 1, j + 1)) dfs(j) n = int(input()) arr = list(map(int, input().split())) '''if sum(arr) < n - 1 or arr[0] == 0: print(-1) exit() for i in range(n): arr[i] = (arr[i], i + 1) arr[1:].sort(reverse=True) ans = [] i = 0 j = 1 while j < n and i < n: for k in range(j, min(n, j + arr[i][0])): ans.append((arr[i][1], arr[k][1])) j = min(n, j + arr[i][0]) i += 1 if j >= n: print(len(ans)) for i in ans: print(*i) else: print(-1)''' vis = [False for i in range(n)] ans = [] dfs(0) print(-1)
Title: News About Credit Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp studies at the university in the group which consists of *n* students (including himself). All they are registrated in the social net "TheContacnt!". Not all students are equally sociable. About each student you know the value *a**i* — the maximum number of messages which the *i*-th student is agree to send per day. The student can't send messages to himself. In early morning Polycarp knew important news that the programming credit will be tomorrow. For this reason it is necessary to urgently inform all groupmates about this news using private messages. Your task is to make a plan of using private messages, so that: - the student *i* sends no more than *a**i* messages (for all *i* from 1 to *n*); - all students knew the news about the credit (initially only Polycarp knew it); - the student can inform the other student only if he knows it himself. Let's consider that all students are numerated by distinct numbers from 1 to *n*, and Polycarp always has the number 1. In that task you shouldn't minimize the number of messages, the moment of time, when all knew about credit or some other parameters. Find any way how to use private messages which satisfies requirements above. Input Specification: The first line contains the positive integer *n* (2<=≤<=*n*<=≤<=100) — the number of students. The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100), where *a**i* equals to the maximum number of messages which can the *i*-th student agree to send. Consider that Polycarp always has the number 1. Output Specification: Print -1 to the first line if it is impossible to inform all students about credit. Otherwise, in the first line print the integer *k* — the number of messages which will be sent. In each of the next *k* lines print two distinct integers *f* and *t*, meaning that the student number *f* sent the message with news to the student number *t*. All messages should be printed in chronological order. It means that the student, who is sending the message, must already know this news. It is assumed that students can receive repeated messages with news of the credit. If there are several answers, it is acceptable to print any of them. Demo Input: ['4\n1 2 1 0\n', '6\n2 0 1 3 2 0\n', '3\n0 2 2\n'] Demo Output: ['3\n1 2\n2 4\n2 3\n', '6\n1 3\n3 4\n1 2\n4 5\n5 6\n4 6\n', '-1\n'] Note: In the first test Polycarp (the student number 1) can send the message to the student number 2, who after that can send the message to students number 3 and 4. Thus, all students knew about the credit.
```python def dfs(v): vis[v] = True for i in range(arr[v]): if False not in vis: print(len(ans)) for i in ans: print(*i) exit() for j in range(n): if not vis[j]: ans.append((v + 1, j + 1)) dfs(j) n = int(input()) arr = list(map(int, input().split())) '''if sum(arr) < n - 1 or arr[0] == 0: print(-1) exit() for i in range(n): arr[i] = (arr[i], i + 1) arr[1:].sort(reverse=True) ans = [] i = 0 j = 1 while j < n and i < n: for k in range(j, min(n, j + arr[i][0])): ans.append((arr[i][1], arr[k][1])) j = min(n, j + arr[i][0]) i += 1 if j >= n: print(len(ans)) for i in ans: print(*i) else: print(-1)''' vis = [False for i in range(n)] ans = [] dfs(0) print(-1) ```
0
59
A
Word
PROGRAMMING
800
[ "implementation", "strings" ]
A. Word
2
256
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
[ "HoUse\n", "ViP\n", "maTRIx\n" ]
[ "house\n", "VIP\n", "matrix\n" ]
none
500
[ { "input": "HoUse", "output": "house" }, { "input": "ViP", "output": "VIP" }, { "input": "maTRIx", "output": "matrix" }, { "input": "BNHWpnpawg", "output": "bnhwpnpawg" }, { "input": "VTYGP", "output": "VTYGP" }, { "input": "CHNenu", "output": "chnenu" }, { "input": "ERPZGrodyu", "output": "erpzgrodyu" }, { "input": "KSXBXWpebh", "output": "KSXBXWPEBH" }, { "input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv", "output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv" }, { "input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd", "output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd" }, { "input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv", "output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv" }, { "input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg", "output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg" }, { "input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak", "output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK" }, { "input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw", "output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW" }, { "input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB", "output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB" }, { "input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge", "output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge" }, { "input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw", "output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw" }, { "input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks", "output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks" }, { "input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz", "output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ" }, { "input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg", "output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG" }, { "input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO", "output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO" }, { "input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd", "output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD" }, { "input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas", "output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas" }, { "input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm", "output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM" }, { "input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn", "output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn" }, { "input": "t", "output": "t" }, { "input": "N", "output": "N" }, { "input": "kv", "output": "kv" }, { "input": "Ur", "output": "ur" }, { "input": "CN", "output": "CN" } ]
1,664,633,833
2,147,483,647
Python 3
OK
TESTS
30
92
0
word=list(input()) sumupper=0 sumlower=0 for i in range(len(word)): if ord(word[i])>=65 and ord(word[i])<=90: sumupper+=1 else: sumlower+=1 if sumupper>sumlower: print(''.join(word).upper()) else: print(''.join(word).lower())
Title: Word Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. Input Specification: The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. Output Specification: Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. Demo Input: ['HoUse\n', 'ViP\n', 'maTRIx\n'] Demo Output: ['house\n', 'VIP\n', 'matrix\n'] Note: none
```python word=list(input()) sumupper=0 sumlower=0 for i in range(len(word)): if ord(word[i])>=65 and ord(word[i])<=90: sumupper+=1 else: sumlower+=1 if sumupper>sumlower: print(''.join(word).upper()) else: print(''.join(word).lower()) ```
3.977
387
B
George and Round
PROGRAMMING
1,200
[ "brute force", "greedy", "two pointers" ]
null
null
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Print a single integer — the answer to the problem.
[ "3 5\n1 2 3\n1 2 2 3 3\n", "3 5\n1 2 3\n1 1 1 1 1\n", "3 1\n2 3 4\n1\n" ]
[ "0\n", "2\n", "3\n" ]
In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
1,000
[ { "input": "3 5\n1 2 3\n1 2 2 3 3", "output": "0" }, { "input": "3 5\n1 2 3\n1 1 1 1 1", "output": "2" }, { "input": "3 1\n2 3 4\n1", "output": "3" }, { "input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98", "output": "24" } ]
1,533,835,183
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
6
108
102,400
A = input().split() B = input().split() C = input().split() Barray = [int(x) for x in list(B)] Carray = [int(x) for x in list(C)] dem = 0; tam = 0; while tam == 0: if Barray[-1] > Carray[-1]: dem += 1; Barray.pop(-1); Carray.pop(-1); else: dem += 0; Barray.pop(-1); Carray.pop(-1); if len(Barray) == 0: tam = 1 elif len(Carray) == 0: tam = 1 if int(A[0]) > int(A[1]): print(len(Barray) + dem) else: print(dem)
Title: George and Round Time Limit: None seconds Memory Limit: None megabytes Problem Description: George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*. To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities. George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data. However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity. Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=&lt;<=*a*2<=&lt;<=...<=&lt;<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George. Output Specification: Print a single integer — the answer to the problem. Demo Input: ['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n'] Demo Output: ['0\n', '2\n', '3\n'] Note: In the first sample the set of the prepared problems meets the requirements for a good round. In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round. In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4.
```python A = input().split() B = input().split() C = input().split() Barray = [int(x) for x in list(B)] Carray = [int(x) for x in list(C)] dem = 0; tam = 0; while tam == 0: if Barray[-1] > Carray[-1]: dem += 1; Barray.pop(-1); Carray.pop(-1); else: dem += 0; Barray.pop(-1); Carray.pop(-1); if len(Barray) == 0: tam = 1 elif len(Carray) == 0: tam = 1 if int(A[0]) > int(A[1]): print(len(Barray) + dem) else: print(dem) ```
0
992
A
Nastya and an Array
PROGRAMMING
800
[ "implementation", "sortings" ]
null
null
Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties: - In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes. Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded.
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array.
Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero.
[ "5\n1 1 1 1 1\n", "3\n2 0 -1\n", "4\n5 -6 -5 1\n" ]
[ "1\n", "2\n", "4\n" ]
In the first example you can add  - 1 to all non-zero elements in one second and make them equal to zero. In the second example you can add  - 2 on the first second, then the array becomes equal to [0, 0,  - 3]. On the second second you can add 3 to the third (the only non-zero) element.
500
[ { "input": "5\n1 1 1 1 1", "output": "1" }, { "input": "3\n2 0 -1", "output": "2" }, { "input": "4\n5 -6 -5 1", "output": "4" }, { "input": "1\n0", "output": "0" }, { "input": "2\n21794 -79194", "output": "2" }, { "input": "3\n-63526 95085 -5239", "output": "3" }, { "input": "3\n0 53372 -20572", "output": "2" }, { "input": "13\n-2075 -32242 27034 -37618 -96962 82203 64846 48249 -71761 28908 -21222 -61370 46899", "output": "13" }, { "input": "5\n806 0 1308 1954 683", "output": "4" }, { "input": "8\n-26 0 -249 -289 -126 -206 288 -11", "output": "7" }, { "input": "10\n2 2 2 1 2 -1 0 2 -1 1", "output": "3" }, { "input": "1\n8", "output": "1" }, { "input": "3\n0 0 0", "output": "0" }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "10" }, { "input": "5\n2 0 -1 0 0", "output": "2" }, { "input": "2\n0 0", "output": "0" }, { "input": "5\n0 0 0 0 0", "output": "0" }, { "input": "2\n1 0", "output": "1" }, { "input": "2\n-1 0", "output": "1" }, { "input": "4\n0 0 0 0", "output": "0" }, { "input": "8\n10 9 -1 0 0 3 2 3", "output": "5" }, { "input": "5\n5 0 1 2 3", "output": "4" }, { "input": "3\n1 1 0", "output": "1" }, { "input": "1\n-1", "output": "1" }, { "input": "5\n1 2 0 0 0", "output": "2" }, { "input": "5\n1 0 0 0 0", "output": "1" }, { "input": "5\n4 5 6 0 0", "output": "3" }, { "input": "4\n-1 0 0 1", "output": "2" }, { "input": "5\n3 0 0 4 5", "output": "3" }, { "input": "3\n0 0 2", "output": "1" }, { "input": "3\n1 0 0", "output": "1" }, { "input": "4\n0 0 0 4", "output": "1" }, { "input": "5\n-1 0 0 0 0", "output": "1" }, { "input": "2\n0 1", "output": "1" }, { "input": "3\n1 2 3", "output": "3" }, { "input": "1\n5", "output": "1" }, { "input": "10\n0 0 0 0 0 1 2 3 0 0", "output": "3" }, { "input": "4\n0 1 2 3", "output": "3" }, { "input": "3\n0 1 2", "output": "2" }, { "input": "4\n2 0 0 -1", "output": "2" } ]
1,665,766,010
2,147,483,647
Python 3
OK
TESTS
79
93
7,270,400
test=int(input()) ind=list(map(int,input().split())) ind2=set(ind) c=0 for i in ind2: if i!=0: c=c+1 print(c)
Title: Nastya and an Array Time Limit: None seconds Memory Limit: None megabytes Problem Description: Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties: - In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes. Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded. Input Specification: The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array. Output Specification: Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero. Demo Input: ['5\n1 1 1 1 1\n', '3\n2 0 -1\n', '4\n5 -6 -5 1\n'] Demo Output: ['1\n', '2\n', '4\n'] Note: In the first example you can add  - 1 to all non-zero elements in one second and make them equal to zero. In the second example you can add  - 2 on the first second, then the array becomes equal to [0, 0,  - 3]. On the second second you can add 3 to the third (the only non-zero) element.
```python test=int(input()) ind=list(map(int,input().split())) ind2=set(ind) c=0 for i in ind2: if i!=0: c=c+1 print(c) ```
3
976
B
Lara Croft and the New Game
PROGRAMMING
1,300
[ "implementation", "math" ]
null
null
You might have heard about the next game in Lara Croft series coming out this year. You also might have watched its trailer. Though you definitely missed the main idea about its plot, so let me lift the veil of secrecy. Lara is going to explore yet another dangerous dungeon. Game designers decided to use good old 2D environment. The dungeon can be represented as a rectangle matrix of *n* rows and *m* columns. Cell (*x*,<=*y*) is the cell in the *x*-th row in the *y*-th column. Lara can move between the neighbouring by side cells in all four directions. Moreover, she has even chosen the path for herself to avoid all the traps. She enters the dungeon in cell (1,<=1), that is top left corner of the matrix. Then she goes down all the way to cell (*n*,<=1) — the bottom left corner. Then she starts moving in the snake fashion — all the way to the right, one cell up, then to the left to the cell in 2-nd column, one cell up. She moves until she runs out of non-visited cells. *n* and *m* given are such that she always end up in cell (1,<=2). Lara has already moved to a neighbouring cell *k* times. Can you determine her current position?
The only line contains three integers *n*, *m* and *k* (2<=≤<=*n*,<=*m*<=≤<=109, *n* is always even, 0<=≤<=*k*<=&lt;<=*n*·*m*). Note that *k* doesn't fit into 32-bit integer type!
Print the cell (the row and the column where the cell is situated) where Lara ends up after she moves *k* times.
[ "4 3 0\n", "4 3 11\n", "4 3 7\n" ]
[ "1 1\n", "1 2\n", "3 2\n" ]
Here is her path on matrix 4 by 3:
0
[ { "input": "4 3 0", "output": "1 1" }, { "input": "4 3 11", "output": "1 2" }, { "input": "4 3 7", "output": "3 2" }, { "input": "1000000000 2 1999999999", "output": "1 2" }, { "input": "1000000000 1000000000 999999999999999999", "output": "1 2" }, { "input": "1000000000 1000000000 999999999", "output": "1000000000 1" }, { "input": "1000000000 1000000000 2000000500", "output": "999999999 999999499" }, { "input": "2 2 2", "output": "2 2" }, { "input": "28 3 1", "output": "2 1" }, { "input": "2 3 3", "output": "2 3" }, { "input": "4 6 8", "output": "4 6" }, { "input": "6 6 18", "output": "4 4" }, { "input": "4 3 8", "output": "2 2" }, { "input": "4 3 4", "output": "4 2" }, { "input": "4 4 10", "output": "2 2" }, { "input": "4 5 4", "output": "4 2" }, { "input": "4 3 9", "output": "2 3" }, { "input": "4 3 6", "output": "3 3" }, { "input": "4 5 5", "output": "4 3" }, { "input": "6 4 8", "output": "6 4" }, { "input": "4 4 12", "output": "2 4" }, { "input": "10 6 15", "output": "9 6" }, { "input": "6666 969696 6667", "output": "6666 3" }, { "input": "4 5 13", "output": "2 3" }, { "input": "84 68 4248", "output": "22 12" }, { "input": "6 6 9", "output": "6 5" }, { "input": "4 5 17", "output": "1 4" }, { "input": "2 3 4", "output": "1 3" }, { "input": "4 3 5", "output": "4 3" }, { "input": "2 3 2", "output": "2 2" }, { "input": "4 5 12", "output": "2 2" }, { "input": "6 6 16", "output": "4 2" }, { "input": "4 4 6", "output": "4 4" }, { "input": "10 3 18", "output": "6 2" }, { "input": "2 4 5", "output": "1 4" }, { "input": "6 9 43", "output": "2 7" }, { "input": "4 7 8", "output": "4 6" }, { "input": "500 100 800", "output": "497 97" }, { "input": "2 5 5", "output": "2 5" }, { "input": "4 6 15", "output": "2 3" }, { "input": "9213788 21936127 8761236", "output": "8761237 1" }, { "input": "2 5 6", "output": "1 5" }, { "input": "43534 432423 53443", "output": "43534 9911" }, { "input": "999999998 999999998 999999995000000005", "output": "2 999999997" }, { "input": "999999924 999999983 999999906999879972", "output": "1 121321" }, { "input": "6 5 18", "output": "3 5" }, { "input": "4 4 5", "output": "4 3" }, { "input": "6 6 6", "output": "6 2" }, { "input": "99999998 8888888 77777777777", "output": "99991260 6683175" }, { "input": "6 5 6", "output": "6 2" }, { "input": "6 5 17", "output": "4 5" }, { "input": "6 4 12", "output": "4 2" }, { "input": "999995712 999993076 999988788028978212", "output": "1 711901" }, { "input": "999994900 999993699 999988599028973300", "output": "1 3161801" }, { "input": "978642410 789244500 12348616164", "output": "978642396 320550770" }, { "input": "999993774 999998283 999992057010529542", "output": "1 160501" }, { "input": "4 7 10", "output": "3 7" }, { "input": "6 4 9", "output": "5 4" }, { "input": "1000000000 789 788999999000", "output": "2 578" }, { "input": "978642410 789244500 1234861616400", "output": "978640847 495422447" }, { "input": "999999596 999999631 999999226999090676", "output": "1 1058401" }, { "input": "4 7 16", "output": "2 2" }, { "input": "2 2 3", "output": "1 2" }, { "input": "21726 5447 14771", "output": "14772 1" }, { "input": "4 2 6", "output": "2 2" }, { "input": "621282132 311996010 98597740967720109", "output": "305259691 311996002" }, { "input": "803521870 958373820 689637244594465863", "output": "83930798 27" }, { "input": "887584278 701990442 578292377747447929", "output": "63794746 41" }, { "input": "656369902 872526042 566305269065863364", "output": "7328794 36" }, { "input": "839664176 535164910 441498526835463771", "output": "14687578 15" }, { "input": "636553724 546535019 115079316355948443", "output": "425992073 546535018" }, { "input": "2182 23967 52288026", "output": "1 7969" }, { "input": "548492800 434105920 179638683192075937", "output": "134679777 434105920" }, { "input": "4 4 4", "output": "4 2" }, { "input": "6 8 15", "output": "5 6" }, { "input": "6 3 7", "output": "6 3" }, { "input": "949547590 305226065 138144146668766087", "output": "496951426 3" }, { "input": "1000000000 1000000000 3000000000", "output": "999999998 4" }, { "input": "999999998 1000000000 1000000998999999", "output": "998999998 3" }, { "input": "999381438 840037557 128928432510450944", "output": "845902072 12" }, { "input": "742860584 671970249 260211607929646490", "output": "355623786 4" }, { "input": "1000000000 1000000000 1999999998", "output": "1000000000 1000000000" }, { "input": "993142186 628701115 555947810764442157", "output": "108862204 25" }, { "input": "595261150 794915864 332353903994901365", "output": "177161677 794915848" } ]
1,580,968,699
2,147,483,647
Python 3
OK
TESTS
84
124
512,000
from bisect import bisect_left, bisect_right def _input(): return map(int, input().strip().split()) def _print(s): print(''.join(map(str, s))) n, m, k = _input() if k < n: print(k + 1, 1) exit(0) k -= n x, y = n, 2 d = k // (2 * (m - 1)) r = k % (2 * (m - 1)) x -= 2 * d if r < (m - 1): y += r elif r == (m - 1): x -= 1 y = m else: x -= 1 y = m - (r - m + 1) print(x, y)
Title: Lara Croft and the New Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: You might have heard about the next game in Lara Croft series coming out this year. You also might have watched its trailer. Though you definitely missed the main idea about its plot, so let me lift the veil of secrecy. Lara is going to explore yet another dangerous dungeon. Game designers decided to use good old 2D environment. The dungeon can be represented as a rectangle matrix of *n* rows and *m* columns. Cell (*x*,<=*y*) is the cell in the *x*-th row in the *y*-th column. Lara can move between the neighbouring by side cells in all four directions. Moreover, she has even chosen the path for herself to avoid all the traps. She enters the dungeon in cell (1,<=1), that is top left corner of the matrix. Then she goes down all the way to cell (*n*,<=1) — the bottom left corner. Then she starts moving in the snake fashion — all the way to the right, one cell up, then to the left to the cell in 2-nd column, one cell up. She moves until she runs out of non-visited cells. *n* and *m* given are such that she always end up in cell (1,<=2). Lara has already moved to a neighbouring cell *k* times. Can you determine her current position? Input Specification: The only line contains three integers *n*, *m* and *k* (2<=≤<=*n*,<=*m*<=≤<=109, *n* is always even, 0<=≤<=*k*<=&lt;<=*n*·*m*). Note that *k* doesn't fit into 32-bit integer type! Output Specification: Print the cell (the row and the column where the cell is situated) where Lara ends up after she moves *k* times. Demo Input: ['4 3 0\n', '4 3 11\n', '4 3 7\n'] Demo Output: ['1 1\n', '1 2\n', '3 2\n'] Note: Here is her path on matrix 4 by 3:
```python from bisect import bisect_left, bisect_right def _input(): return map(int, input().strip().split()) def _print(s): print(''.join(map(str, s))) n, m, k = _input() if k < n: print(k + 1, 1) exit(0) k -= n x, y = n, 2 d = k // (2 * (m - 1)) r = k % (2 * (m - 1)) x -= 2 * d if r < (m - 1): y += r elif r == (m - 1): x -= 1 y = m else: x -= 1 y = m - (r - m + 1) print(x, y) ```
3
239
A
Two Bags of Potatoes
PROGRAMMING
1,200
[ "greedy", "implementation", "math" ]
null
null
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*. Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once. If there are no such values of *x* print a single integer -1.
[ "10 1 10\n", "10 6 40\n" ]
[ "-1\n", "2 8 14 20 26 \n" ]
none
500
[ { "input": "10 1 10", "output": "-1" }, { "input": "10 6 40", "output": "2 8 14 20 26 " }, { "input": "10 1 20", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "1 10000 1000000000", "output": "9999 19999 29999 39999 49999 59999 69999 79999 89999 99999 109999 119999 129999 139999 149999 159999 169999 179999 189999 199999 209999 219999 229999 239999 249999 259999 269999 279999 289999 299999 309999 319999 329999 339999 349999 359999 369999 379999 389999 399999 409999 419999 429999 439999 449999 459999 469999 479999 489999 499999 509999 519999 529999 539999 549999 559999 569999 579999 589999 599999 609999 619999 629999 639999 649999 659999 669999 679999 689999 699999 709999 719999 729999 739999 7499..." }, { "input": "84817 1 33457", "output": "-1" }, { "input": "21 37 99", "output": "16 53 " }, { "input": "78 7 15", "output": "-1" }, { "input": "74 17 27", "output": "-1" }, { "input": "79 23 43", "output": "-1" }, { "input": "32 33 3", "output": "-1" }, { "input": "55 49 44", "output": "-1" }, { "input": "64 59 404", "output": "54 113 172 231 290 " }, { "input": "61 69 820", "output": "8 77 146 215 284 353 422 491 560 629 698 " }, { "input": "17 28 532", "output": "11 39 67 95 123 151 179 207 235 263 291 319 347 375 403 431 459 487 515 " }, { "input": "46592 52 232", "output": "-1" }, { "input": "1541 58 648", "output": "-1" }, { "input": "15946 76 360", "output": "-1" }, { "input": "30351 86 424", "output": "-1" }, { "input": "1 2 37493", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..." }, { "input": "1 3 27764", "output": "2 5 8 11 14 17 20 23 26 29 32 35 38 41 44 47 50 53 56 59 62 65 68 71 74 77 80 83 86 89 92 95 98 101 104 107 110 113 116 119 122 125 128 131 134 137 140 143 146 149 152 155 158 161 164 167 170 173 176 179 182 185 188 191 194 197 200 203 206 209 212 215 218 221 224 227 230 233 236 239 242 245 248 251 254 257 260 263 266 269 272 275 278 281 284 287 290 293 296 299 302 305 308 311 314 317 320 323 326 329 332 335 338 341 344 347 350 353 356 359 362 365 368 371 374 377 380 383 386 389 392 395 398 401 404 407 410..." }, { "input": "10 4 9174", "output": "2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 102 106 110 114 118 122 126 130 134 138 142 146 150 154 158 162 166 170 174 178 182 186 190 194 198 202 206 210 214 218 222 226 230 234 238 242 246 250 254 258 262 266 270 274 278 282 286 290 294 298 302 306 310 314 318 322 326 330 334 338 342 346 350 354 358 362 366 370 374 378 382 386 390 394 398 402 406 410 414 418 422 426 430 434 438 442 446 450 454 458 462 466 470 474 478 482 486 490 494 498 502 506 510 514 518 522 526 530 534 53..." }, { "input": "33 7 4971", "output": "2 9 16 23 30 37 44 51 58 65 72 79 86 93 100 107 114 121 128 135 142 149 156 163 170 177 184 191 198 205 212 219 226 233 240 247 254 261 268 275 282 289 296 303 310 317 324 331 338 345 352 359 366 373 380 387 394 401 408 415 422 429 436 443 450 457 464 471 478 485 492 499 506 513 520 527 534 541 548 555 562 569 576 583 590 597 604 611 618 625 632 639 646 653 660 667 674 681 688 695 702 709 716 723 730 737 744 751 758 765 772 779 786 793 800 807 814 821 828 835 842 849 856 863 870 877 884 891 898 905 912 919..." }, { "input": "981 1 3387", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "386 1 2747", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "123 2 50000", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..." }, { "input": "3123 100 10000000", "output": "77 177 277 377 477 577 677 777 877 977 1077 1177 1277 1377 1477 1577 1677 1777 1877 1977 2077 2177 2277 2377 2477 2577 2677 2777 2877 2977 3077 3177 3277 3377 3477 3577 3677 3777 3877 3977 4077 4177 4277 4377 4477 4577 4677 4777 4877 4977 5077 5177 5277 5377 5477 5577 5677 5777 5877 5977 6077 6177 6277 6377 6477 6577 6677 6777 6877 6977 7077 7177 7277 7377 7477 7577 7677 7777 7877 7977 8077 8177 8277 8377 8477 8577 8677 8777 8877 8977 9077 9177 9277 9377 9477 9577 9677 9777 9877 9977 10077 10177 10277 1037..." }, { "input": "2 10000 1000000000", "output": "9998 19998 29998 39998 49998 59998 69998 79998 89998 99998 109998 119998 129998 139998 149998 159998 169998 179998 189998 199998 209998 219998 229998 239998 249998 259998 269998 279998 289998 299998 309998 319998 329998 339998 349998 359998 369998 379998 389998 399998 409998 419998 429998 439998 449998 459998 469998 479998 489998 499998 509998 519998 529998 539998 549998 559998 569998 579998 589998 599998 609998 619998 629998 639998 649998 659998 669998 679998 689998 699998 709998 719998 729998 739998 7499..." }, { "input": "3 10000 1000000000", "output": "9997 19997 29997 39997 49997 59997 69997 79997 89997 99997 109997 119997 129997 139997 149997 159997 169997 179997 189997 199997 209997 219997 229997 239997 249997 259997 269997 279997 289997 299997 309997 319997 329997 339997 349997 359997 369997 379997 389997 399997 409997 419997 429997 439997 449997 459997 469997 479997 489997 499997 509997 519997 529997 539997 549997 559997 569997 579997 589997 599997 609997 619997 629997 639997 649997 659997 669997 679997 689997 699997 709997 719997 729997 739997 7499..." }, { "input": "12312223 10000 1000000000", "output": "7777 17777 27777 37777 47777 57777 67777 77777 87777 97777 107777 117777 127777 137777 147777 157777 167777 177777 187777 197777 207777 217777 227777 237777 247777 257777 267777 277777 287777 297777 307777 317777 327777 337777 347777 357777 367777 377777 387777 397777 407777 417777 427777 437777 447777 457777 467777 477777 487777 497777 507777 517777 527777 537777 547777 557777 567777 577777 587777 597777 607777 617777 627777 637777 647777 657777 667777 677777 687777 697777 707777 717777 727777 737777 7477..." }, { "input": "500000000 1000000000 1000000000", "output": "500000000 " }, { "input": "1 1000000000 1000000000", "output": "999999999 " }, { "input": "10 6 11", "output": "-1" }, { "input": "2 100 10", "output": "-1" }, { "input": "1 100000007 1000000000", "output": "100000006 200000013 300000020 400000027 500000034 600000041 700000048 800000055 900000062 " }, { "input": "1 999999999 1000000000", "output": "999999998 " }, { "input": "100000000 1000000000 1000000000", "output": "900000000 " }, { "input": "11 2 12", "output": "1 " }, { "input": "31 10 39", "output": "-1" }, { "input": "48 6 50", "output": "-1" }, { "input": "500000000 500000000 1000000000", "output": "500000000 " }, { "input": "1 1000000000 999999999", "output": "-1" }, { "input": "4 2 10", "output": "2 4 6 " }, { "input": "1000000000 1 1", "output": "-1" }, { "input": "1000000000 1 100000", "output": "-1" }, { "input": "1000000000 1 10", "output": "-1" }, { "input": "10 5 14", "output": "-1" }, { "input": "500000000 499999999 1000000000", "output": "499999998 " }, { "input": "1 999999997 1000000000", "output": "999999996 " } ]
1,492,274,328
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
3
1,000
5,529,600
(y, k, n) = map(int, input().split(' ')) lst = [] for i in range(1 + y, n + 1): if i % k == 0: lst.append(i - y) if len(lst) == 0: print(-1) else: print(' '.join(list(map(str,lst))))
Title: Two Bags of Potatoes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*. Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order. Input Specification: The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105). Output Specification: Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once. If there are no such values of *x* print a single integer -1. Demo Input: ['10 1 10\n', '10 6 40\n'] Demo Output: ['-1\n', '2 8 14 20 26 \n'] Note: none
```python (y, k, n) = map(int, input().split(' ')) lst = [] for i in range(1 + y, n + 1): if i % k == 0: lst.append(i - y) if len(lst) == 0: print(-1) else: print(' '.join(list(map(str,lst)))) ```
0
152
A
Marks
PROGRAMMING
900
[ "implementation" ]
null
null
Vasya, or Mr. Vasily Petrov is a dean of a department in a local university. After the winter exams he got his hands on a group's gradebook. Overall the group has *n* students. They received marks for *m* subjects. Each student got a mark from 1 to 9 (inclusive) for each subject. Let's consider a student the best at some subject, if there is no student who got a higher mark for this subject. Let's consider a student successful, if there exists a subject he is the best at. Your task is to find the number of successful students in the group.
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of students and the number of subjects, correspondingly. Next *n* lines each containing *m* characters describe the gradebook. Each character in the gradebook is a number from 1 to 9. Note that the marks in a rows are not sepatated by spaces.
Print the single number — the number of successful students in the given group.
[ "3 3\n223\n232\n112\n", "3 5\n91728\n11828\n11111\n" ]
[ "2\n", "3\n" ]
In the first sample test the student number 1 is the best at subjects 1 and 3, student 2 is the best at subjects 1 and 2, but student 3 isn't the best at any subject. In the second sample test each student is the best at at least one subject.
500
[ { "input": "3 3\n223\n232\n112", "output": "2" }, { "input": "3 5\n91728\n11828\n11111", "output": "3" }, { "input": "2 2\n48\n27", "output": "1" }, { "input": "2 1\n4\n6", "output": "1" }, { "input": "1 2\n57", "output": "1" }, { "input": "1 1\n5", "output": "1" }, { "input": "3 4\n2553\n6856\n5133", "output": "2" }, { "input": "8 7\n6264676\n7854895\n3244128\n2465944\n8958761\n1378945\n3859353\n6615285", "output": "6" }, { "input": "9 8\n61531121\n43529859\n18841327\n88683622\n98995641\n62741632\n57441743\n49396792\n63381994", "output": "4" }, { "input": "10 20\n26855662887514171367\n48525577498621511535\n47683778377545341138\n47331616748732562762\n44876938191354974293\n24577238399664382695\n42724955594463126746\n79187344479926159359\n48349683283914388185\n82157191115518781898", "output": "9" }, { "input": "20 15\n471187383859588\n652657222494199\n245695867594992\n726154672861295\n614617827782772\n862889444974692\n373977167653235\n645434268565473\n785993468314573\n722176861496755\n518276853323939\n723712762593348\n728935312568886\n373898548522463\n769777587165681\n247592995114377\n182375946483965\n497496542536127\n988239919677856\n859844339819143", "output": "18" }, { "input": "13 9\n514562255\n322655246\n135162979\n733845982\n473117129\n513967187\n965649829\n799122777\n661249521\n298618978\n659352422\n747778378\n723261619", "output": "11" }, { "input": "75 1\n2\n3\n8\n3\n2\n1\n3\n1\n5\n1\n5\n4\n8\n8\n4\n2\n5\n1\n7\n6\n3\n2\n2\n3\n5\n5\n2\n4\n7\n7\n9\n2\n9\n5\n1\n4\n9\n5\n2\n4\n6\n6\n3\n3\n9\n3\n3\n2\n3\n4\n2\n6\n9\n1\n1\n1\n1\n7\n2\n3\n2\n9\n7\n4\n9\n1\n7\n5\n6\n8\n3\n4\n3\n4\n6", "output": "7" }, { "input": "92 3\n418\n665\n861\n766\n529\n416\n476\n676\n561\n995\n415\n185\n291\n176\n776\n631\n556\n488\n118\n188\n437\n496\n466\n131\n914\n118\n766\n365\n113\n897\n386\n639\n276\n946\n759\n169\n494\n837\n338\n351\n783\n311\n261\n862\n598\n132\n246\n982\n575\n364\n615\n347\n374\n368\n523\n132\n774\n161\n552\n492\n598\n474\n639\n681\n635\n342\n516\n483\n141\n197\n571\n336\n175\n596\n481\n327\n841\n133\n142\n146\n246\n396\n287\n582\n556\n996\n479\n814\n497\n363\n963\n162", "output": "23" }, { "input": "100 1\n1\n6\n9\n1\n1\n5\n5\n4\n6\n9\n6\n1\n7\n8\n7\n3\n8\n8\n7\n6\n2\n1\n5\n8\n7\n3\n5\n4\n9\n7\n1\n2\n4\n1\n6\n5\n1\n3\n9\n4\n5\n8\n1\n2\n1\n9\n7\n3\n7\n1\n2\n2\n2\n2\n3\n9\n7\n2\n4\n7\n1\n6\n8\n1\n5\n6\n1\n1\n2\n9\n7\n4\n9\n1\n9\n4\n1\n3\n5\n2\n4\n4\n6\n5\n1\n4\n5\n8\n4\n7\n6\n5\n6\n9\n5\n8\n1\n5\n1\n6", "output": "10" }, { "input": "100 2\n71\n87\n99\n47\n22\n87\n49\n73\n21\n12\n77\n43\n18\n41\n78\n62\n61\n16\n64\n89\n81\n54\n53\n92\n93\n94\n68\n93\n15\n68\n42\n93\n28\n19\n86\n16\n97\n17\n11\n43\n72\n76\n54\n95\n58\n53\n48\n45\n85\n85\n74\n21\n44\n51\n89\n75\n76\n17\n38\n62\n81\n22\n66\n59\n89\n85\n91\n87\n12\n97\n52\n87\n43\n89\n51\n58\n57\n98\n78\n68\n82\n41\n87\n29\n75\n72\n48\n14\n35\n71\n74\n91\n66\n67\n42\n98\n52\n54\n22\n41", "output": "21" }, { "input": "5 20\n11111111111111111111\n11111111111111111111\n11111111111111111111\n99999999999999999999\n11111111111111111119", "output": "2" }, { "input": "3 3\n111\n111\n999", "output": "1" }, { "input": "3 3\n119\n181\n711", "output": "3" }, { "input": "15 5\n91728\n11828\n11111\n91728\n11828\n11111\n91728\n11828\n11111\n91728\n11828\n11111\n91728\n11828\n11111", "output": "15" }, { "input": "2 20\n22222222222222222222\n11111111111111111111", "output": "1" }, { "input": "3 3\n233\n222\n111", "output": "2" }, { "input": "4 15\n222222222222222\n111111111111119\n111111111111119\n111111111111111", "output": "3" }, { "input": "4 1\n1\n9\n9\n9", "output": "3" }, { "input": "3 3\n123\n321\n132", "output": "3" }, { "input": "3 3\n113\n332\n322", "output": "3" }, { "input": "2 100\n2222222222222222222222222222222222222222222222222222222222222222222222221222222222222222222222222222\n1111111111111111111111111111111111111111111111111111111111111111111111119111111111111111111111111111", "output": "2" }, { "input": "3 3\n321\n231\n123", "output": "3" }, { "input": "2 100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111\n2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222", "output": "1" }, { "input": "3 3\n221\n111\n111", "output": "3" } ]
1,483,361,558
2,147,483,647
Python 3
OK
TESTS
44
62
4,710,400
import sys n, m = map(int, sys.stdin.readline().split()) a = [] for _ in range(n): a.append([int(i) for i in input().strip()]) amax = [] for i in range(m): amax.append(max([a[_][i] for _ in range(n)])) def match(a,b): for ai,bi in zip(a,b): if ai == bi: return True return False ans = 0 for i in range(n): if match(a[i],amax): ans += 1 print(ans)
Title: Marks Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya, or Mr. Vasily Petrov is a dean of a department in a local university. After the winter exams he got his hands on a group's gradebook. Overall the group has *n* students. They received marks for *m* subjects. Each student got a mark from 1 to 9 (inclusive) for each subject. Let's consider a student the best at some subject, if there is no student who got a higher mark for this subject. Let's consider a student successful, if there exists a subject he is the best at. Your task is to find the number of successful students in the group. Input Specification: The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of students and the number of subjects, correspondingly. Next *n* lines each containing *m* characters describe the gradebook. Each character in the gradebook is a number from 1 to 9. Note that the marks in a rows are not sepatated by spaces. Output Specification: Print the single number — the number of successful students in the given group. Demo Input: ['3 3\n223\n232\n112\n', '3 5\n91728\n11828\n11111\n'] Demo Output: ['2\n', '3\n'] Note: In the first sample test the student number 1 is the best at subjects 1 and 3, student 2 is the best at subjects 1 and 2, but student 3 isn't the best at any subject. In the second sample test each student is the best at at least one subject.
```python import sys n, m = map(int, sys.stdin.readline().split()) a = [] for _ in range(n): a.append([int(i) for i in input().strip()]) amax = [] for i in range(m): amax.append(max([a[_][i] for _ in range(n)])) def match(a,b): for ai,bi in zip(a,b): if ai == bi: return True return False ans = 0 for i in range(n): if match(a[i],amax): ans += 1 print(ans) ```
3
58
A
Chat room
PROGRAMMING
1,000
[ "greedy", "strings" ]
A. Chat room
1
256
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
If Vasya managed to say hello, print "YES", otherwise print "NO".
[ "ahhellllloou\n", "hlelo\n" ]
[ "YES\n", "NO\n" ]
none
500
[ { "input": "ahhellllloou", "output": "YES" }, { "input": "hlelo", "output": "NO" }, { "input": "helhcludoo", "output": "YES" }, { "input": "hehwelloho", "output": "YES" }, { "input": "pnnepelqomhhheollvlo", "output": "YES" }, { "input": "tymbzjyqhymedasloqbq", "output": "NO" }, { "input": "yehluhlkwo", "output": "NO" }, { "input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello", "output": "YES" }, { "input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq", "output": "YES" }, { "input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi", "output": "YES" }, { "input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo", "output": "YES" }, { "input": "lqllcolohwflhfhlnaow", "output": "NO" }, { "input": "heheeellollvoo", "output": "YES" }, { "input": "hellooo", "output": "YES" }, { "input": "o", "output": "NO" }, { "input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv", "output": "YES" }, { "input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk", "output": "YES" }, { "input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry", "output": "NO" }, { "input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq", "output": "NO" }, { "input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi", "output": "YES" }, { "input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm", "output": "YES" }, { "input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac", "output": "NO" }, { "input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok", "output": "YES" }, { "input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz", "output": "YES" }, { "input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb", "output": "YES" }, { "input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla", "output": "YES" }, { "input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz", "output": "YES" }, { "input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti", "output": "YES" }, { "input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli", "output": "YES" }, { "input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo", "output": "YES" }, { "input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk", "output": "NO" }, { "input": "loee", "output": "NO" }, { "input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo", "output": "NO" }, { "input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi", "output": "YES" }, { "input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv", "output": "NO" }, { "input": "hello", "output": "YES" }, { "input": "oohell", "output": "NO" }, { "input": "hell", "output": "NO" }, { "input": "eloellohoelo", "output": "NO" }, { "input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo", "output": "YES" } ]
1,647,749,750
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
31
0
cadena = input() opciones = {"ee":"e", "lll":"ll"} for p in opciones: while cadena.__contains__(p): cadena = cadena.replace(p, opciones[p]); print("YES" if cadena.lower().__contains__("hello") else "NO")
Title: Chat room Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*. Input Specification: The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters. Output Specification: If Vasya managed to say hello, print "YES", otherwise print "NO". Demo Input: ['ahhellllloou\n', 'hlelo\n'] Demo Output: ['YES\n', 'NO\n'] Note: none
```python cadena = input() opciones = {"ee":"e", "lll":"ll"} for p in opciones: while cadena.__contains__(p): cadena = cadena.replace(p, opciones[p]); print("YES" if cadena.lower().__contains__("hello") else "NO") ```
0
677
A
Vanya and Fence
PROGRAMMING
800
[ "implementation" ]
null
null
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*. Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Print a single integer — the minimum possible valid width of the road.
[ "3 7\n4 5 14\n", "6 1\n1 1 1 1 1 1\n", "6 5\n7 6 8 9 10 5\n" ]
[ "4\n", "6\n", "11\n" ]
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4. In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough. In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
500
[ { "input": "3 7\n4 5 14", "output": "4" }, { "input": "6 1\n1 1 1 1 1 1", "output": "6" }, { "input": "6 5\n7 6 8 9 10 5", "output": "11" }, { "input": "10 420\n214 614 297 675 82 740 174 23 255 15", "output": "13" }, { "input": "10 561\n657 23 1096 487 785 66 481 554 1000 821", "output": "15" }, { "input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396", "output": "144" }, { "input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366", "output": "145" }, { "input": "1 1\n1", "output": "1" }, { "input": "1 1\n2", "output": "2" }, { "input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19", "output": "63" }, { "input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386", "output": "31" }, { "input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518", "output": "75" }, { "input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397", "output": "41" }, { "input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118", "output": "116" } ]
1,694,779,611
2,147,483,647
PyPy 3-64
OK
TESTS
29
92
0
n, h = map(int, input("").split()) lista = list(map(int, input("").split())) l=0 for i in range(len(lista)): if lista[i]<=h: l = l + 1 else: l = l + 2 print(l)
Title: Vanya and Fence Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*. Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard? Input Specification: The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person. Output Specification: Print a single integer — the minimum possible valid width of the road. Demo Input: ['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n'] Demo Output: ['4\n', '6\n', '11\n'] Note: In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4. In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough. In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11.
```python n, h = map(int, input("").split()) lista = list(map(int, input("").split())) l=0 for i in range(len(lista)): if lista[i]<=h: l = l + 1 else: l = l + 2 print(l) ```
3
808
A
Lucky Year
PROGRAMMING
900
[ "implementation" ]
null
null
Apart from having lots of holidays throughout the year, residents of Berland also have whole lucky years. Year is considered lucky if it has no more than 1 non-zero digit in its number. So years 100, 40000, 5 are lucky and 12, 3001 and 12345 are not. You are given current year in Berland. Your task is to find how long will residents of Berland wait till the next lucky year.
The first line contains integer number *n* (1<=≤<=*n*<=≤<=109) — current year in Berland.
Output amount of years from the current year to the next lucky one.
[ "4\n", "201\n", "4000\n" ]
[ "1\n", "99\n", "1000\n" ]
In the first example next lucky year is 5. In the second one — 300. In the third — 5000.
0
[ { "input": "4", "output": "1" }, { "input": "201", "output": "99" }, { "input": "4000", "output": "1000" }, { "input": "9", "output": "1" }, { "input": "10", "output": "10" }, { "input": "1", "output": "1" }, { "input": "100000000", "output": "100000000" }, { "input": "900000000", "output": "100000000" }, { "input": "999999999", "output": "1" }, { "input": "1000000000", "output": "1000000000" }, { "input": "9999999", "output": "1" }, { "input": "100000001", "output": "99999999" }, { "input": "3660", "output": "340" }, { "input": "21", "output": "9" }, { "input": "900000001", "output": "99999999" }, { "input": "62911", "output": "7089" }, { "input": "11", "output": "9" }, { "input": "940302010", "output": "59697990" }, { "input": "91", "output": "9" }, { "input": "101", "output": "99" }, { "input": "1090", "output": "910" }, { "input": "987654321", "output": "12345679" }, { "input": "703450474", "output": "96549526" }, { "input": "1091", "output": "909" }, { "input": "89", "output": "1" }, { "input": "109", "output": "91" }, { "input": "190", "output": "10" }, { "input": "19", "output": "1" }, { "input": "8", "output": "1" }, { "input": "482", "output": "18" }, { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "1" }, { "input": "4", "output": "1" }, { "input": "5", "output": "1" }, { "input": "6", "output": "1" }, { "input": "7", "output": "1" }, { "input": "8", "output": "1" }, { "input": "9", "output": "1" }, { "input": "10", "output": "10" }, { "input": "11", "output": "9" }, { "input": "12", "output": "8" }, { "input": "13", "output": "7" }, { "input": "14", "output": "6" }, { "input": "15", "output": "5" }, { "input": "16", "output": "4" }, { "input": "17", "output": "3" }, { "input": "18", "output": "2" }, { "input": "19", "output": "1" }, { "input": "20", "output": "10" }, { "input": "21", "output": "9" }, { "input": "22", "output": "8" }, { "input": "23", "output": "7" }, { "input": "24", "output": "6" }, { "input": "25", "output": "5" }, { "input": "26", "output": "4" }, { "input": "27", "output": "3" }, { "input": "28", "output": "2" }, { "input": "29", "output": "1" }, { "input": "30", "output": "10" }, { "input": "31", "output": "9" }, { "input": "32", "output": "8" }, { "input": "33", "output": "7" }, { "input": "34", "output": "6" }, { "input": "35", "output": "5" }, { "input": "36", "output": "4" }, { "input": "37", "output": "3" }, { "input": "38", "output": "2" }, { "input": "39", "output": "1" }, { "input": "40", "output": "10" }, { "input": "41", "output": "9" }, { "input": "42", "output": "8" }, { "input": "43", "output": "7" }, { "input": "44", "output": "6" }, { "input": "45", "output": "5" }, { "input": "46", "output": "4" }, { "input": "47", "output": "3" }, { "input": "48", "output": "2" }, { "input": "49", "output": "1" }, { "input": "50", "output": "10" }, { "input": "51", "output": "9" }, { "input": "52", "output": "8" }, { "input": "53", "output": "7" }, { "input": "54", "output": "6" }, { "input": "55", "output": "5" }, { "input": "56", "output": "4" }, { "input": "57", "output": "3" }, { "input": "58", "output": "2" }, { "input": "59", "output": "1" }, { "input": "60", "output": "10" }, { "input": "61", "output": "9" }, { "input": "62", "output": "8" }, { "input": "63", "output": "7" }, { "input": "64", "output": "6" }, { "input": "65", "output": "5" }, { "input": "66", "output": "4" }, { "input": "67", "output": "3" }, { "input": "68", "output": "2" }, { "input": "69", "output": "1" }, { "input": "70", "output": "10" }, { "input": "71", "output": "9" }, { "input": "72", "output": "8" }, { "input": "73", "output": "7" }, { "input": "74", "output": "6" }, { "input": "75", "output": "5" }, { "input": "76", "output": "4" }, { "input": "77", "output": "3" }, { "input": "78", "output": "2" }, { "input": "79", "output": "1" }, { "input": "80", "output": "10" }, { "input": "81", "output": "9" }, { "input": "82", "output": "8" }, { "input": "83", "output": "7" }, { "input": "84", "output": "6" }, { "input": "85", "output": "5" }, { "input": "86", "output": "4" }, { "input": "87", "output": "3" }, { "input": "88", "output": "2" }, { "input": "89", "output": "1" }, { "input": "90", "output": "10" }, { "input": "91", "output": "9" }, { "input": "92", "output": "8" }, { "input": "93", "output": "7" }, { "input": "94", "output": "6" }, { "input": "95", "output": "5" }, { "input": "96", "output": "4" }, { "input": "97", "output": "3" }, { "input": "98", "output": "2" }, { "input": "99", "output": "1" }, { "input": "100", "output": "100" }, { "input": "100", "output": "100" }, { "input": "100", "output": "100" }, { "input": "1000", "output": "1000" }, { "input": "1000", "output": "1000" }, { "input": "1000", "output": "1000" }, { "input": "10000", "output": "10000" }, { "input": "10000", "output": "10000" }, { "input": "101", "output": "99" }, { "input": "110", "output": "90" }, { "input": "1001", "output": "999" }, { "input": "1100", "output": "900" }, { "input": "1010", "output": "990" }, { "input": "10010", "output": "9990" }, { "input": "10100", "output": "9900" }, { "input": "102", "output": "98" }, { "input": "120", "output": "80" }, { "input": "1002", "output": "998" }, { "input": "1200", "output": "800" }, { "input": "1020", "output": "980" }, { "input": "10020", "output": "9980" }, { "input": "10200", "output": "9800" }, { "input": "108", "output": "92" }, { "input": "180", "output": "20" }, { "input": "1008", "output": "992" }, { "input": "1800", "output": "200" }, { "input": "1080", "output": "920" }, { "input": "10080", "output": "9920" }, { "input": "10800", "output": "9200" }, { "input": "109", "output": "91" }, { "input": "190", "output": "10" }, { "input": "1009", "output": "991" }, { "input": "1900", "output": "100" }, { "input": "1090", "output": "910" }, { "input": "10090", "output": "9910" }, { "input": "10900", "output": "9100" }, { "input": "200", "output": "100" }, { "input": "200", "output": "100" }, { "input": "2000", "output": "1000" }, { "input": "2000", "output": "1000" }, { "input": "2000", "output": "1000" }, { "input": "20000", "output": "10000" }, { "input": "20000", "output": "10000" }, { "input": "201", "output": "99" }, { "input": "210", "output": "90" }, { "input": "2001", "output": "999" }, { "input": "2100", "output": "900" }, { "input": "2010", "output": "990" }, { "input": "20010", "output": "9990" }, { "input": "20100", "output": "9900" }, { "input": "202", "output": "98" }, { "input": "220", "output": "80" }, { "input": "2002", "output": "998" }, { "input": "2200", "output": "800" }, { "input": "2020", "output": "980" }, { "input": "20020", "output": "9980" }, { "input": "20200", "output": "9800" }, { "input": "208", "output": "92" }, { "input": "280", "output": "20" }, { "input": "2008", "output": "992" }, { "input": "2800", "output": "200" }, { "input": "2080", "output": "920" }, { "input": "20080", "output": "9920" }, { "input": "20800", "output": "9200" }, { "input": "209", "output": "91" }, { "input": "290", "output": "10" }, { "input": "2009", "output": "991" }, { "input": "2900", "output": "100" }, { "input": "2090", "output": "910" }, { "input": "20090", "output": "9910" }, { "input": "20900", "output": "9100" }, { "input": "800", "output": "100" }, { "input": "800", "output": "100" }, { "input": "8000", "output": "1000" }, { "input": "8000", "output": "1000" }, { "input": "8000", "output": "1000" }, { "input": "80000", "output": "10000" }, { "input": "80000", "output": "10000" }, { "input": "801", "output": "99" }, { "input": "810", "output": "90" }, { "input": "8001", "output": "999" }, { "input": "8100", "output": "900" }, { "input": "8010", "output": "990" }, { "input": "80010", "output": "9990" }, { "input": "80100", "output": "9900" }, { "input": "802", "output": "98" }, { "input": "820", "output": "80" }, { "input": "8002", "output": "998" }, { "input": "8200", "output": "800" }, { "input": "8020", "output": "980" }, { "input": "80020", "output": "9980" }, { "input": "80200", "output": "9800" }, { "input": "808", "output": "92" }, { "input": "880", "output": "20" }, { "input": "8008", "output": "992" }, { "input": "8800", "output": "200" }, { "input": "8080", "output": "920" }, { "input": "80080", "output": "9920" }, { "input": "80800", "output": "9200" }, { "input": "809", "output": "91" }, { "input": "890", "output": "10" }, { "input": "8009", "output": "991" }, { "input": "8900", "output": "100" }, { "input": "8090", "output": "910" }, { "input": "80090", "output": "9910" }, { "input": "80900", "output": "9100" }, { "input": "900", "output": "100" }, { "input": "900", "output": "100" }, { "input": "9000", "output": "1000" }, { "input": "9000", "output": "1000" }, { "input": "9000", "output": "1000" }, { "input": "90000", "output": "10000" }, { "input": "90000", "output": "10000" }, { "input": "901", "output": "99" }, { "input": "910", "output": "90" }, { "input": "9001", "output": "999" }, { "input": "9100", "output": "900" }, { "input": "9010", "output": "990" }, { "input": "90010", "output": "9990" }, { "input": "90100", "output": "9900" }, { "input": "902", "output": "98" }, { "input": "920", "output": "80" }, { "input": "9002", "output": "998" }, { "input": "9200", "output": "800" }, { "input": "9020", "output": "980" }, { "input": "90020", "output": "9980" }, { "input": "90200", "output": "9800" }, { "input": "908", "output": "92" }, { "input": "980", "output": "20" }, { "input": "9008", "output": "992" }, { "input": "9800", "output": "200" }, { "input": "9080", "output": "920" }, { "input": "90080", "output": "9920" }, { "input": "90800", "output": "9200" }, { "input": "909", "output": "91" }, { "input": "990", "output": "10" }, { "input": "9009", "output": "991" }, { "input": "9900", "output": "100" }, { "input": "9090", "output": "910" }, { "input": "90090", "output": "9910" }, { "input": "90900", "output": "9100" }, { "input": "92651241", "output": "7348759" } ]
1,696,697,952
2,147,483,647
Python 3
OK
TESTS
271
46
0
n = int(input()) print(((1 + int(str(n)[0])) * 10**(len(str(n)) - 1)) - n) # Sat Oct 07 2023 19:59:11 GMT+0300 (Moscow Standard Time)
Title: Lucky Year Time Limit: None seconds Memory Limit: None megabytes Problem Description: Apart from having lots of holidays throughout the year, residents of Berland also have whole lucky years. Year is considered lucky if it has no more than 1 non-zero digit in its number. So years 100, 40000, 5 are lucky and 12, 3001 and 12345 are not. You are given current year in Berland. Your task is to find how long will residents of Berland wait till the next lucky year. Input Specification: The first line contains integer number *n* (1<=≤<=*n*<=≤<=109) — current year in Berland. Output Specification: Output amount of years from the current year to the next lucky one. Demo Input: ['4\n', '201\n', '4000\n'] Demo Output: ['1\n', '99\n', '1000\n'] Note: In the first example next lucky year is 5. In the second one — 300. In the third — 5000.
```python n = int(input()) print(((1 + int(str(n)[0])) * 10**(len(str(n)) - 1)) - n) # Sat Oct 07 2023 19:59:11 GMT+0300 (Moscow Standard Time) ```
3
50
A
Domino piling
PROGRAMMING
800
[ "greedy", "math" ]
A. Domino piling
2
256
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions.
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output one number — the maximal number of dominoes, which can be placed.
[ "2 4\n", "3 3\n" ]
[ "4\n", "4\n" ]
none
500
[ { "input": "2 4", "output": "4" }, { "input": "3 3", "output": "4" }, { "input": "1 5", "output": "2" }, { "input": "1 6", "output": "3" }, { "input": "1 15", "output": "7" }, { "input": "1 16", "output": "8" }, { "input": "2 5", "output": "5" }, { "input": "2 6", "output": "6" }, { "input": "2 7", "output": "7" }, { "input": "2 14", "output": "14" }, { "input": "2 15", "output": "15" }, { "input": "1 4", "output": "2" }, { "input": "2 16", "output": "16" }, { "input": "3 5", "output": "7" }, { "input": "3 6", "output": "9" }, { "input": "3 10", "output": "15" }, { "input": "3 14", "output": "21" }, { "input": "3 15", "output": "22" }, { "input": "3 16", "output": "24" }, { "input": "5 7", "output": "17" }, { "input": "16 16", "output": "128" }, { "input": "15 16", "output": "120" }, { "input": "2 3", "output": "3" }, { "input": "15 15", "output": "112" }, { "input": "14 16", "output": "112" }, { "input": "11 13", "output": "71" }, { "input": "5 16", "output": "40" }, { "input": "8 15", "output": "60" }, { "input": "2 2", "output": "2" }, { "input": "3 4", "output": "6" }, { "input": "4 4", "output": "8" }, { "input": "1 1", "output": "0" }, { "input": "1 2", "output": "1" }, { "input": "1 3", "output": "1" }, { "input": "14 15", "output": "105" } ]
1,637,338,185
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
30
0
m,n=int(input()) print(m*2//2)
Title: Domino piling Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions: 1. Each domino completely covers two squares. 2. No two dominoes overlap. 3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board. Find the maximum number of dominoes, which can be placed under these restrictions. Input Specification: In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). Output Specification: Output one number — the maximal number of dominoes, which can be placed. Demo Input: ['2 4\n', '3 3\n'] Demo Output: ['4\n', '4\n'] Note: none
```python m,n=int(input()) print(m*2//2) ```
-1
893
A
Chess For Three
PROGRAMMING
900
[ "implementation" ]
null
null
Alex, Bob and Carl will soon participate in a team chess tournament. Since they are all in the same team, they have decided to practise really hard before the tournament. But it's a bit difficult for them because chess is a game for two players, not three. So they play with each other according to following rules: - Alex and Bob play the first game, and Carl is spectating; - When the game ends, the one who lost the game becomes the spectator in the next game, and the one who was spectating plays against the winner. Alex, Bob and Carl play in such a way that there are no draws. Today they have played *n* games, and for each of these games they remember who was the winner. They decided to make up a log of games describing who won each game. But now they doubt if the information in the log is correct, and they want to know if the situation described in the log they made up was possible (that is, no game is won by someone who is spectating if Alex, Bob and Carl play according to the rules). Help them to check it!
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of games Alex, Bob and Carl played. Then *n* lines follow, describing the game log. *i*-th line contains one integer *a**i* (1<=≤<=*a**i*<=≤<=3) which is equal to 1 if Alex won *i*-th game, to 2 if Bob won *i*-th game and 3 if Carl won *i*-th game.
Print YES if the situation described in the log was possible. Otherwise print NO.
[ "3\n1\n1\n2\n", "2\n1\n2\n" ]
[ "YES\n", "NO\n" ]
In the first example the possible situation is: 1. Alex wins, Carl starts playing instead of Bob; 1. Alex wins, Bob replaces Carl; 1. Bob wins. The situation in the second example is impossible because Bob loses the first game, so he cannot win the second one.
0
[ { "input": "3\n1\n1\n2", "output": "YES" }, { "input": "2\n1\n2", "output": "NO" }, { "input": "100\n2\n3\n1\n2\n3\n3\n3\n1\n1\n1\n1\n3\n3\n3\n3\n1\n2\n3\n3\n3\n3\n3\n3\n3\n1\n2\n2\n2\n3\n1\n1\n3\n3\n3\n3\n3\n3\n3\n3\n1\n2\n3\n3\n3\n1\n1\n1\n1\n3\n3\n3\n3\n1\n2\n3\n1\n2\n2\n2\n3\n3\n2\n1\n3\n3\n1\n2\n3\n1\n1\n1\n2\n2\n2\n3\n1\n1\n1\n1\n1\n1\n3\n2\n2\n2\n2\n2\n2\n3\n1\n2\n2\n2\n2\n2\n3\n3\n2\n1\n1", "output": "YES" }, { "input": "99\n1\n3\n2\n2\n3\n1\n1\n3\n3\n3\n3\n3\n3\n1\n1\n3\n3\n3\n3\n1\n1\n3\n2\n1\n1\n1\n1\n1\n1\n1\n3\n2\n2\n2\n1\n3\n3\n1\n1\n3\n2\n1\n3\n3\n1\n2\n3\n3\n3\n1\n2\n2\n2\n3\n3\n3\n3\n3\n3\n2\n2\n2\n2\n3\n3\n3\n1\n1\n3\n2\n1\n1\n2\n2\n2\n3\n3\n2\n1\n1\n2\n2\n1\n3\n2\n1\n1\n2\n3\n3\n3\n3\n2\n2\n2\n2\n2\n1\n3", "output": "YES" }, { "input": "100\n2\n2\n1\n3\n1\n3\n3\n1\n1\n3\n1\n1\n3\n2\n1\n3\n1\n1\n3\n3\n2\n2\n3\n1\n1\n2\n3\n2\n2\n3\n1\n1\n2\n3\n2\n1\n2\n2\n3\n3\n1\n1\n3\n1\n2\n1\n3\n1\n1\n3\n2\n2\n2\n1\n1\n1\n3\n1\n3\n2\n1\n2\n2\n2\n3\n3\n2\n1\n1\n3\n3\n2\n1\n2\n1\n1\n3\n1\n2\n3\n2\n3\n3\n3\n2\n2\n1\n3\n1\n2\n3\n1\n2\n3\n3\n1\n2\n1\n3\n1", "output": "NO" }, { "input": "10\n2\n3\n3\n3\n3\n2\n2\n2\n3\n2", "output": "NO" }, { "input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "YES" }, { "input": "1\n3", "output": "NO" }, { "input": "1\n2", "output": "YES" }, { "input": "42\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "YES" }, { "input": "4\n2\n3\n3\n3", "output": "YES" }, { "input": "3\n1\n2\n3", "output": "NO" }, { "input": "5\n1\n1\n1\n1\n3", "output": "NO" }, { "input": "5\n2\n3\n3\n3\n3", "output": "YES" }, { "input": "2\n3\n3", "output": "NO" }, { "input": "4\n1\n2\n2\n1", "output": "NO" }, { "input": "3\n2\n2\n3", "output": "NO" }, { "input": "5\n2\n3\n3\n1\n1", "output": "NO" }, { "input": "3\n3\n1\n3", "output": "NO" }, { "input": "3\n3\n3\n1", "output": "NO" }, { "input": "2\n2\n1", "output": "NO" }, { "input": "3\n1\n1\n3", "output": "NO" }, { "input": "6\n2\n2\n2\n3\n1\n3", "output": "NO" }, { "input": "2\n3\n1", "output": "NO" }, { "input": "2\n3\n2", "output": "NO" }, { "input": "2\n1\n3", "output": "YES" }, { "input": "3\n1\n3\n1", "output": "NO" }, { "input": "5\n1\n1\n2\n2\n3", "output": "NO" }, { "input": "3\n2\n1\n1", "output": "NO" }, { "input": "2\n2\n2", "output": "YES" }, { "input": "3\n2\n2\n1", "output": "YES" }, { "input": "5\n2\n2\n2\n2\n2", "output": "YES" }, { "input": "8\n1\n1\n1\n1\n1\n1\n1\n1", "output": "YES" }, { "input": "3\n3\n2\n2", "output": "NO" }, { "input": "3\n3\n2\n3", "output": "NO" }, { "input": "7\n2\n2\n2\n2\n2\n2\n2", "output": "YES" }, { "input": "3\n2\n2\n2", "output": "YES" } ]
1,633,619,135
635
PyPy 3
WRONG_ANSWER
TESTS
0
77
20,172,800
def make_divisors(n): divisors = [] for i in range(1, int(n**0.5)+1): if n % i == 0: divisors.append(i) if i != n // i: divisors.append(n//i) return divisors n = int(input()) d1 = make_divisors(n) ans = -1 for c in d1: d2 = make_divisors(c) for a in d2: b = c//a x = a+1 k = 0 while x%2 == 0: x //= 2 k += 1 if x != 1: continue if pow(2, k-1) == b: ans = max(ans, c) break print(ans)
Title: Chess For Three Time Limit: None seconds Memory Limit: None megabytes Problem Description: Alex, Bob and Carl will soon participate in a team chess tournament. Since they are all in the same team, they have decided to practise really hard before the tournament. But it's a bit difficult for them because chess is a game for two players, not three. So they play with each other according to following rules: - Alex and Bob play the first game, and Carl is spectating; - When the game ends, the one who lost the game becomes the spectator in the next game, and the one who was spectating plays against the winner. Alex, Bob and Carl play in such a way that there are no draws. Today they have played *n* games, and for each of these games they remember who was the winner. They decided to make up a log of games describing who won each game. But now they doubt if the information in the log is correct, and they want to know if the situation described in the log they made up was possible (that is, no game is won by someone who is spectating if Alex, Bob and Carl play according to the rules). Help them to check it! Input Specification: The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of games Alex, Bob and Carl played. Then *n* lines follow, describing the game log. *i*-th line contains one integer *a**i* (1<=≤<=*a**i*<=≤<=3) which is equal to 1 if Alex won *i*-th game, to 2 if Bob won *i*-th game and 3 if Carl won *i*-th game. Output Specification: Print YES if the situation described in the log was possible. Otherwise print NO. Demo Input: ['3\n1\n1\n2\n', '2\n1\n2\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first example the possible situation is: 1. Alex wins, Carl starts playing instead of Bob; 1. Alex wins, Bob replaces Carl; 1. Bob wins. The situation in the second example is impossible because Bob loses the first game, so he cannot win the second one.
```python def make_divisors(n): divisors = [] for i in range(1, int(n**0.5)+1): if n % i == 0: divisors.append(i) if i != n // i: divisors.append(n//i) return divisors n = int(input()) d1 = make_divisors(n) ans = -1 for c in d1: d2 = make_divisors(c) for a in d2: b = c//a x = a+1 k = 0 while x%2 == 0: x //= 2 k += 1 if x != 1: continue if pow(2, k-1) == b: ans = max(ans, c) break print(ans) ```
0
228
A
Is your horseshoe on the other hoof?
PROGRAMMING
800
[ "implementation" ]
null
null
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers.
Print a single integer — the minimum number of horseshoes Valera needs to buy.
[ "1 7 3 3\n", "7 7 7 7\n" ]
[ "1\n", "3\n" ]
none
500
[ { "input": "1 7 3 3", "output": "1" }, { "input": "7 7 7 7", "output": "3" }, { "input": "81170865 673572653 756938629 995577259", "output": "0" }, { "input": "3491663 217797045 522540872 715355328", "output": "0" }, { "input": "251590420 586975278 916631563 586975278", "output": "1" }, { "input": "259504825 377489979 588153796 377489979", "output": "1" }, { "input": "652588203 931100304 931100304 652588203", "output": "2" }, { "input": "391958720 651507265 391958720 651507265", "output": "2" }, { "input": "90793237 90793237 90793237 90793237", "output": "3" }, { "input": "551651653 551651653 551651653 551651653", "output": "3" }, { "input": "156630260 609654355 668943582 973622757", "output": "0" }, { "input": "17061017 110313588 434481173 796661222", "output": "0" }, { "input": "24975422 256716298 337790533 690960249", "output": "0" }, { "input": "255635360 732742923 798648949 883146723", "output": "0" }, { "input": "133315691 265159773 734556507 265159773", "output": "1" }, { "input": "28442865 741657755 978106882 978106882", "output": "1" }, { "input": "131245479 174845575 497483467 131245479", "output": "1" }, { "input": "139159884 616215581 958341883 616215581", "output": "1" }, { "input": "147784432 947653080 947653080 947653080", "output": "2" }, { "input": "94055790 756126496 756126496 94055790", "output": "2" }, { "input": "240458500 511952208 240458500 511952208", "output": "2" }, { "input": "681828506 972810624 972810624 681828506", "output": "2" }, { "input": "454961014 454961014 454961014 454961014", "output": "3" }, { "input": "915819430 915819430 915819430 915819430", "output": "3" }, { "input": "671645142 671645142 671645142 671645142", "output": "3" }, { "input": "132503558 132503558 132503558 132503558", "output": "3" }, { "input": "5 5 999999 6", "output": "1" }, { "input": "1 1 2 5", "output": "1" }, { "input": "2 1 2 3", "output": "1" }, { "input": "1 1 3 5", "output": "1" }, { "input": "1 1 3 3", "output": "2" }, { "input": "2 2 2 1", "output": "2" }, { "input": "3 1 1 1", "output": "2" }, { "input": "1 2 2 2", "output": "2" } ]
1,697,958,530
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
30
0
enter = input() s1 = int(enter[0]) s2 = int(enter[2]) s3 = int(enter[4]) s4 = int(enter[6]) if s1 != s2 != s3 != s4: print(0) if s1 == s2 or s2 == s3 or s3 == s4 or s4 == s1: print(1) if s1 == s2 == s3 or s2 == s3 == s4 or s3 == s4 == s1 or s4 == s1 == s2: print(2) if s1 == s2 == s3 == s4: print(3)
Title: Is your horseshoe on the other hoof? Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades. Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party. Input Specification: The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has. Consider all possible colors indexed with integers. Output Specification: Print a single integer — the minimum number of horseshoes Valera needs to buy. Demo Input: ['1 7 3 3\n', '7 7 7 7\n'] Demo Output: ['1\n', '3\n'] Note: none
```python enter = input() s1 = int(enter[0]) s2 = int(enter[2]) s3 = int(enter[4]) s4 = int(enter[6]) if s1 != s2 != s3 != s4: print(0) if s1 == s2 or s2 == s3 or s3 == s4 or s4 == s1: print(1) if s1 == s2 == s3 or s2 == s3 == s4 or s3 == s4 == s1 or s4 == s1 == s2: print(2) if s1 == s2 == s3 == s4: print(3) ```
0
705
A
Hulk
PROGRAMMING
800
[ "implementation" ]
null
null
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner.
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Print Dr.Banner's feeling in one line.
[ "1\n", "2\n", "3\n" ]
[ "I hate it\n", "I hate that I love it\n", "I hate that I love that I hate it\n" ]
none
500
[ { "input": "1", "output": "I hate it" }, { "input": "2", "output": "I hate that I love it" }, { "input": "3", "output": "I hate that I love that I hate it" }, { "input": "4", "output": "I hate that I love that I hate that I love it" }, { "input": "5", "output": "I hate that I love that I hate that I love that I hate it" }, { "input": "10", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "18", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "19", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "76", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "77", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "81", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "82", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "85", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "86", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "99", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "98", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "33", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it" }, { "input": "34", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it" }, { "input": "57", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." }, { "input": "100", "output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..." } ]
1,691,895,122
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
15
0
n = int(input()) lst = [] if n % 2 ==0: lst += ['I hate it'] else: lst += ['I hate it that I love it'] print(lst)
Title: Hulk Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings. Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on... For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on. Please help Dr. Banner. Input Specification: The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate. Output Specification: Print Dr.Banner's feeling in one line. Demo Input: ['1\n', '2\n', '3\n'] Demo Output: ['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n'] Note: none
```python n = int(input()) lst = [] if n % 2 ==0: lst += ['I hate it'] else: lst += ['I hate it that I love it'] print(lst) ```
0
189
A
Cut Ribbon
PROGRAMMING
1,300
[ "brute force", "dp" ]
null
null
Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting.
The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide.
Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists.
[ "5 5 3 2\n", "7 5 5 2\n" ]
[ "2\n", "2\n" ]
In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
500
[ { "input": "5 5 3 2", "output": "2" }, { "input": "7 5 5 2", "output": "2" }, { "input": "4 4 4 4", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "4000 1 2 3", "output": "4000" }, { "input": "4000 3 4 5", "output": "1333" }, { "input": "10 3 4 5", "output": "3" }, { "input": "100 23 15 50", "output": "2" }, { "input": "3119 3515 1021 7", "output": "11" }, { "input": "918 102 1327 1733", "output": "9" }, { "input": "3164 42 430 1309", "output": "15" }, { "input": "3043 317 1141 2438", "output": "7" }, { "input": "26 1 772 2683", "output": "26" }, { "input": "370 2 1 15", "output": "370" }, { "input": "734 12 6 2", "output": "367" }, { "input": "418 18 14 17", "output": "29" }, { "input": "18 16 28 9", "output": "2" }, { "input": "14 6 2 17", "output": "7" }, { "input": "29 27 18 2", "output": "2" }, { "input": "29 12 7 10", "output": "3" }, { "input": "27 23 4 3", "output": "9" }, { "input": "5 14 5 2", "output": "1" }, { "input": "5 17 26 5", "output": "1" }, { "input": "9 1 10 3", "output": "9" }, { "input": "2 19 15 1", "output": "2" }, { "input": "4 6 4 9", "output": "1" }, { "input": "10 6 2 9", "output": "5" }, { "input": "2 2 9 6", "output": "1" }, { "input": "6 2 4 1", "output": "6" }, { "input": "27 24 5 27", "output": "1" }, { "input": "2683 83 26 2709", "output": "101" }, { "input": "728 412 789 158", "output": "3" }, { "input": "3964 4 2916 176", "output": "991" }, { "input": "3399 2035 2 3334", "output": "683" }, { "input": "3455 244 3301 3", "output": "991" }, { "input": "595 2263 3625 1", "output": "595" }, { "input": "4000 1 1 1", "output": "4000" }, { "input": "3999 2 2 3999", "output": "1" }, { "input": "25 6 8 11", "output": "3" }, { "input": "4000 500 1000 2000", "output": "8" }, { "input": "53 10 11 23", "output": "5" }, { "input": "100 100 1 1", "output": "100" }, { "input": "17 3 4 10", "output": "5" }, { "input": "413 101 102 105", "output": "4" }, { "input": "490 4 49 50", "output": "111" }, { "input": "3999 2 3 3", "output": "1999" }, { "input": "8 3 8 4", "output": "2" }, { "input": "5 1 3 3", "output": "5" }, { "input": "100 3 17 22", "output": "27" }, { "input": "4000 2 3 4", "output": "2000" }, { "input": "4000 3 3 5", "output": "1332" }, { "input": "13 4 6 7", "output": "2" }, { "input": "4000 5 2 2", "output": "2000" }, { "input": "3999 2 2 3", "output": "1999" }, { "input": "4000 33 7 3333", "output": "564" }, { "input": "60 33 20 9", "output": "4" }, { "input": "100 9 11 99", "output": "10" }, { "input": "2009 6 8 9", "output": "334" } ]
1,689,842,220
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
4
1,000
0
n,a,b,c = map(int, input().split()) s = 1 k = 0 for i in range (n+1): for j in range(n+1): k = n-a*i-b*j if k>=0 and k%c ==0: s = max(s,(i+j+k//c)) print(s)
Title: Cut Ribbon Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has a ribbon, its length is *n*. He wants to cut the ribbon in a way that fulfils the following two conditions: - After the cutting each ribbon piece should have length *a*, *b* or *c*. - After the cutting the number of ribbon pieces should be maximum. Help Polycarpus and find the number of ribbon pieces after the required cutting. Input Specification: The first line contains four space-separated integers *n*, *a*, *b* and *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=4000) — the length of the original ribbon and the acceptable lengths of the ribbon pieces after the cutting, correspondingly. The numbers *a*, *b* and *c* can coincide. Output Specification: Print a single number — the maximum possible number of ribbon pieces. It is guaranteed that at least one correct ribbon cutting exists. Demo Input: ['5 5 3 2\n', '7 5 5 2\n'] Demo Output: ['2\n', '2\n'] Note: In the first example Polycarpus can cut the ribbon in such way: the first piece has length 2, the second piece has length 3. In the second example Polycarpus can cut the ribbon in such way: the first piece has length 5, the second piece has length 2.
```python n,a,b,c = map(int, input().split()) s = 1 k = 0 for i in range (n+1): for j in range(n+1): k = n-a*i-b*j if k>=0 and k%c ==0: s = max(s,(i+j+k//c)) print(s) ```
0
272
A
Dima and Friends
PROGRAMMING
1,000
[ "implementation", "math" ]
null
null
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place. To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment. For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place. Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show. The numbers in the lines are separated by a single space.
In a single line print the answer to the problem.
[ "1\n1\n", "1\n2\n", "2\n3 5\n" ]
[ "3\n", "2\n", "3\n" ]
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend. In the second sample Dima can show 2 or 4 fingers.
500
[ { "input": "1\n1", "output": "3" }, { "input": "1\n2", "output": "2" }, { "input": "2\n3 5", "output": "3" }, { "input": "2\n3 5", "output": "3" }, { "input": "1\n5", "output": "3" }, { "input": "5\n4 4 3 5 1", "output": "4" }, { "input": "6\n2 3 2 2 1 3", "output": "4" }, { "input": "8\n2 2 5 3 4 3 3 2", "output": "4" }, { "input": "7\n4 1 3 2 2 4 5", "output": "4" }, { "input": "3\n3 5 1", "output": "4" }, { "input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2", "output": "5" }, { "input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1", "output": "4" }, { "input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4", "output": "5" }, { "input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3", "output": "5" }, { "input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3", "output": "4" }, { "input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2", "output": "4" }, { "input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3", "output": "5" }, { "input": "6\n4 2 3 1 3 5", "output": "4" }, { "input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4", "output": "5" }, { "input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2", "output": "5" }, { "input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3", "output": "5" }, { "input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1", "output": "5" }, { "input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5", "output": "5" }, { "input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3", "output": "5" }, { "input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2", "output": "5" }, { "input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1", "output": "5" }, { "input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5", "output": "5" }, { "input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3", "output": "5" }, { "input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4", "output": "4" }, { "input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5", "output": "5" } ]
1,677,648,517
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
5
92
0
friend = int(input()) finger = list(map(int, input().split())) count = 0 for x in range(1,6): if (sum(finger) + x) % 2 != 0 and (1+friend) % 2 != 0: count += 1 elif (sum(finger) + x) % 2 == 0 and (1+friend) % 2 == 0: count += 1 print(count)
Title: Dima and Friends Time Limit: None seconds Memory Limit: None megabytes Problem Description: Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place. To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment. For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place. Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show. The numbers in the lines are separated by a single space. Output Specification: In a single line print the answer to the problem. Demo Input: ['1\n1\n', '1\n2\n', '2\n3 5\n'] Demo Output: ['3\n', '2\n', '3\n'] Note: In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend. In the second sample Dima can show 2 or 4 fingers.
```python friend = int(input()) finger = list(map(int, input().split())) count = 0 for x in range(1,6): if (sum(finger) + x) % 2 != 0 and (1+friend) % 2 != 0: count += 1 elif (sum(finger) + x) % 2 == 0 and (1+friend) % 2 == 0: count += 1 print(count) ```
0
20
C
Dijkstra?
PROGRAMMING
1,900
[ "graphs", "shortest paths" ]
C. Dijkstra?
1
64
You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*.
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge. It is possible that the graph has loops and multiple edges between pair of vertices.
Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them.
[ "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n", "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n" ]
[ "1 4 3 5 ", "1 4 3 5 " ]
none
1,500
[ { "input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1", "output": "1 4 3 5 " }, { "input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1", "output": "1 4 3 5 " }, { "input": "2 1\n1 2 1", "output": "1 2 " }, { "input": "3 1\n1 2 1", "output": "-1" }, { "input": "3 3\n1 2 1\n1 3 2\n2 3 1", "output": "1 3 " }, { "input": "10 10\n1 5 12\n2 4 140\n2 10 149\n3 6 154\n3 7 9\n3 8 226\n3 10 132\n4 10 55\n5 8 33\n7 8 173", "output": "1 5 8 7 3 10 " }, { "input": "10 10\n1 5 178\n1 8 221\n2 7 92\n2 8 159\n3 5 55\n3 6 179\n3 10 237\n4 8 205\n5 6 191\n8 10 157", "output": "1 8 10 " }, { "input": "10 10\n1 4 200\n1 9 197\n3 4 79\n3 5 213\n3 6 149\n5 8 3\n5 9 189\n6 7 130\n6 9 51\n8 10 135", "output": "1 9 5 8 10 " }, { "input": "10 10\n1 4 201\n2 3 238\n3 4 40\n3 6 231\n3 8 45\n4 5 227\n4 6 58\n4 9 55\n5 7 14\n6 10 242", "output": "1 4 6 10 " } ]
1,620,047,088
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
3
61
0
v,e=map(int,input().split()) graph=[[0 for j in range(v)]for i in range(v)] for i in range(e): u,v,w=map(int,input().split()) graph[u-1][v-1]=w graph[v-1][u-1]=w sptset=set() ans=[float('inf') for i in range(v)] parent=[-1 for i in range(v)] ans[0]=0 while len(sptset)!=v: indx=0 mini=float('inf') for i in range(v): if i not in sptset and ans[i]<mini: mini=ans[i] indx=i sptset.add(indx) for i in range(v): if graph[indx][i]!=0 and ans[i]>graph[indx][i]+ans[indx]: ans[i]=graph[indx][i]+ans[indx] parent[i]=indx i=v-1 res=[] while parent[i]!=-1: res.append(i+1) i=parent[i] res.append(i+1) for i in range(len(res)-1,-1,-1): print(res[i],end=' ')
Title: Dijkstra? Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*. Input Specification: The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge. It is possible that the graph has loops and multiple edges between pair of vertices. Output Specification: Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them. Demo Input: ['5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n', '5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n'] Demo Output: ['1 4 3 5 ', '1 4 3 5 '] Note: none
```python v,e=map(int,input().split()) graph=[[0 for j in range(v)]for i in range(v)] for i in range(e): u,v,w=map(int,input().split()) graph[u-1][v-1]=w graph[v-1][u-1]=w sptset=set() ans=[float('inf') for i in range(v)] parent=[-1 for i in range(v)] ans[0]=0 while len(sptset)!=v: indx=0 mini=float('inf') for i in range(v): if i not in sptset and ans[i]<mini: mini=ans[i] indx=i sptset.add(indx) for i in range(v): if graph[indx][i]!=0 and ans[i]>graph[indx][i]+ans[indx]: ans[i]=graph[indx][i]+ans[indx] parent[i]=indx i=v-1 res=[] while parent[i]!=-1: res.append(i+1) i=parent[i] res.append(i+1) for i in range(len(res)-1,-1,-1): print(res[i],end=' ') ```
0
432
A
Choosing Teams
PROGRAMMING
800
[ "greedy", "implementation", "sortings" ]
null
null
The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times?
The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship.
Print a single number — the answer to the problem.
[ "5 2\n0 4 5 1 0\n", "6 4\n0 1 2 3 4 5\n", "6 5\n0 0 0 0 0 0\n" ]
[ "1\n", "0\n", "2\n" ]
In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
500
[ { "input": "5 2\n0 4 5 1 0", "output": "1" }, { "input": "6 4\n0 1 2 3 4 5", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "3 4\n0 1 0", "output": "1" }, { "input": "3 4\n0 2 0", "output": "0" }, { "input": "6 5\n0 0 0 0 0 0", "output": "2" }, { "input": "12 2\n0 1 2 3 4 0 1 2 3 4 0 1", "output": "3" }, { "input": "15 2\n0 1 2 3 4 0 1 2 3 4 0 1 2 3 4", "output": "4" }, { "input": "13 1\n5 0 5 0 1 5 0 4 1 1 1 4 1", "output": "3" }, { "input": "20 1\n5 0 4 2 2 3 2 1 2 4 1 3 5 5 5 4 4 1 3 0", "output": "5" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "20 2\n1 4 5 1 3 4 0 5 0 3 3 0 4 0 0 1 4 2 0 4", "output": "4" }, { "input": "6 3\n4 4 4 4 4 4", "output": "0" }, { "input": "1 4\n1", "output": "0" }, { "input": "1 1\n0", "output": "0" }, { "input": "2 3\n0 0", "output": "0" } ]
1,662,237,712
2,147,483,647
PyPy 3-64
OK
TESTS
35
77
1,638,400
x,y=map(int,input().split()) z=list(map(int,input().split())) s=0 for i in z: if i+y<6: s+=1 print(s//3)
Title: Choosing Teams Time Limit: None seconds Memory Limit: None megabytes Problem Description: The Saratov State University Olympiad Programmers Training Center (SSU OPTC) has *n* students. For each student you know the number of times he/she has participated in the ACM ICPC world programming championship. According to the ACM ICPC rules, each person can participate in the world championship at most 5 times. The head of the SSU OPTC is recently gathering teams to participate in the world championship. Each team must consist of exactly three people, at that, any person cannot be a member of two or more teams. What maximum number of teams can the head make if he wants each team to participate in the world championship with the same members at least *k* times? Input Specification: The first line contains two integers, *n* and *k* (1<=≤<=*n*<=≤<=2000; 1<=≤<=*k*<=≤<=5). The next line contains *n* integers: *y*1,<=*y*2,<=...,<=*y**n* (0<=≤<=*y**i*<=≤<=5), where *y**i* shows the number of times the *i*-th person participated in the ACM ICPC world championship. Output Specification: Print a single number — the answer to the problem. Demo Input: ['5 2\n0 4 5 1 0\n', '6 4\n0 1 2 3 4 5\n', '6 5\n0 0 0 0 0 0\n'] Demo Output: ['1\n', '0\n', '2\n'] Note: In the first sample only one team could be made: the first, the fourth and the fifth participants. In the second sample no teams could be created. In the third sample two teams could be created. Any partition into two teams fits.
```python x,y=map(int,input().split()) z=list(map(int,input().split())) s=0 for i in z: if i+y<6: s+=1 print(s//3) ```
3
22
A
Second Order Statistics
PROGRAMMING
800
[ "brute force" ]
A. Second Order Statistics
2
256
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
[ "4\n1 2 2 -4\n", "5\n1 2 3 1 1\n" ]
[ "1\n", "2\n" ]
none
0
[ { "input": "4\n1 2 2 -4", "output": "1" }, { "input": "5\n1 2 3 1 1", "output": "2" }, { "input": "1\n28", "output": "NO" }, { "input": "2\n-28 12", "output": "12" }, { "input": "3\n-83 40 -80", "output": "-80" }, { "input": "8\n93 77 -92 26 21 -48 53 91", "output": "-48" }, { "input": "20\n-72 -9 -86 80 7 -10 40 -27 -94 92 96 56 28 -19 79 36 -3 -73 -63 -49", "output": "-86" }, { "input": "49\n-74 -100 -80 23 -8 -83 -41 -20 48 17 46 -73 -55 67 85 4 40 -60 -69 -75 56 -74 -42 93 74 -95 64 -46 97 -47 55 0 -78 -34 -31 40 -63 -49 -76 48 21 -1 -49 -29 -98 -11 76 26 94", "output": "-98" }, { "input": "88\n63 48 1 -53 -89 -49 64 -70 -49 71 -17 -16 76 81 -26 -50 67 -59 -56 97 2 100 14 18 -91 -80 42 92 -25 -88 59 8 -56 38 48 -71 -78 24 -14 48 -1 69 73 -76 54 16 -92 44 47 33 -34 -17 -81 21 -59 -61 53 26 10 -76 67 35 -29 70 65 -13 -29 81 80 32 74 -6 34 46 57 1 -45 -55 69 79 -58 11 -2 22 -18 -16 -89 -46", "output": "-91" }, { "input": "100\n34 32 88 20 76 53 -71 -39 -98 -10 57 37 63 -3 -54 -64 -78 -82 73 20 -30 -4 22 75 51 -64 -91 29 -52 -48 83 19 18 -47 46 57 -44 95 89 89 -30 84 -83 67 58 -99 -90 -53 92 -60 -5 -56 -61 27 68 -48 52 -95 64 -48 -30 -67 66 89 14 -33 -31 -91 39 7 -94 -54 92 -96 -99 -83 -16 91 -28 -66 81 44 14 -85 -21 18 40 16 -13 -82 -33 47 -10 -40 -19 10 25 60 -34 -89", "output": "-98" }, { "input": "2\n-1 -1", "output": "NO" }, { "input": "3\n-2 -2 -2", "output": "NO" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "NO" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100", "output": "100" }, { "input": "10\n40 71 -85 -85 40 -85 -85 64 -85 47", "output": "40" }, { "input": "23\n-90 -90 -41 -64 -64 -90 -15 10 -43 -90 -64 -64 89 -64 36 47 38 -90 -64 -90 -90 68 -90", "output": "-64" }, { "input": "39\n-97 -93 -42 -93 -97 -93 56 -97 -97 -97 76 -33 -60 91 7 82 17 47 -97 -97 -93 73 -97 12 -97 -97 -97 -97 56 -92 -83 -93 -93 49 -93 -97 -97 -17 -93", "output": "-93" }, { "input": "51\n-21 6 -35 -98 -86 -98 -86 -43 -65 32 -98 -40 96 -98 -98 -98 -98 -86 -86 -98 56 -86 -98 -98 -30 -98 -86 -31 -98 -86 -86 -86 -86 -30 96 -86 -86 -86 -60 25 88 -86 -86 58 31 -47 57 -86 37 44 -83", "output": "-86" }, { "input": "66\n-14 -95 65 -95 -95 -97 -90 -71 -97 -97 70 -95 -95 -97 -95 -27 35 -87 -95 -5 -97 -97 87 34 -49 -95 -97 -95 -97 -95 -30 -95 -97 47 -95 -17 -97 -95 -97 -69 51 -97 -97 -95 -75 87 59 21 63 56 76 -91 98 -97 6 -97 -95 -95 -97 -73 11 -97 -35 -95 -95 -43", "output": "-95" }, { "input": "77\n-67 -93 -93 -92 97 29 93 -93 -93 -5 -93 -7 60 -92 -93 44 -84 68 -92 -93 69 -92 -37 56 43 -93 35 -92 -93 19 -79 18 -92 -93 -93 -37 -93 -47 -93 -92 -92 74 67 19 40 -92 -92 -92 -92 -93 -93 -41 -93 -92 -93 -93 -92 -93 51 -80 6 -42 -92 -92 -66 -12 -92 -92 -3 93 -92 -49 -93 40 62 -92 -92", "output": "-92" }, { "input": "89\n-98 40 16 -87 -98 63 -100 55 -96 -98 -21 -100 -93 26 -98 -98 -100 -89 -98 -5 -65 -28 -100 -6 -66 67 -100 -98 -98 10 -98 -98 -70 7 -98 2 -100 -100 -98 25 -100 -100 -98 23 -68 -100 -98 3 98 -100 -98 -98 -98 -98 -24 -100 -100 -9 -98 35 -100 99 -5 -98 -100 -100 37 -100 -84 57 -98 40 -47 -100 -1 -92 -76 -98 -98 -100 -100 -100 -63 30 21 -100 -100 -100 -12", "output": "-98" }, { "input": "99\n10 -84 -100 -100 73 -64 -100 -94 33 -100 -100 -100 -100 71 64 24 7 -100 -32 -100 -100 77 -100 62 -12 55 45 -100 -100 -80 -100 -100 -100 -100 -100 -100 -100 -100 -100 -39 -48 -100 -34 47 -100 -100 -100 -100 -100 -77 -100 -100 -100 -100 -100 -100 -52 40 -55 -100 -44 -100 72 33 70 -100 -100 -78 -100 -3 100 -77 22 -100 95 -30 -100 10 -69 -100 -100 -100 -100 52 -39 -100 -100 -100 7 -100 -98 -66 95 -17 -100 52 -100 68 -100", "output": "-98" }, { "input": "100\n-99 -98 -64 89 53 57 -99 29 -78 18 -3 -54 76 -98 -99 -98 37 -98 19 -47 89 73 -98 -91 -99 -99 -98 -48 -99 22 -99 -98 -99 -99 -98 -60 84 67 -99 -98 20 -98 88 -98 46 -98 -99 -98 -99 -71 -99 -98 -98 -39 83 95 -98 63 -98 -99 32 -98 -99 -64 57 -30 -53 -83 -4 -99 58 20 -98 -10 -99 -44 -99 -99 -99 -99 75 34 -98 -52 -98 -30 -98 -99 -98 -98 51 -99 -99 -99 -98 -99 -99 -82 -90 92", "output": "-98" }, { "input": "3\n1 2 3", "output": "2" }, { "input": "3\n1 3 2", "output": "2" }, { "input": "3\n2 1 3", "output": "2" }, { "input": "3\n2 3 1", "output": "2" }, { "input": "3\n3 1 2", "output": "2" }, { "input": "3\n3 2 1", "output": "2" }, { "input": "9\n99 99 99 99 100 100 100 100 100", "output": "100" }, { "input": "5\n-100 -100 -100 -100 -100", "output": "NO" } ]
1,686,606,469
2,147,483,647
PyPy 3-64
OK
TESTS
31
156
0
n=int(input()) sequence=list(map(int, input().split())) sequence=list(set(sequence)) sequence.sort() if len(sequence)>=2: print(sequence[1]) else: print("NO")
Title: Second Order Statistics Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem. Input Specification: The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value. Output Specification: If the given sequence has the second order statistics, output this order statistics, otherwise output NO. Demo Input: ['4\n1 2 2 -4\n', '5\n1 2 3 1 1\n'] Demo Output: ['1\n', '2\n'] Note: none
```python n=int(input()) sequence=list(map(int, input().split())) sequence=list(set(sequence)) sequence.sort() if len(sequence)>=2: print(sequence[1]) else: print("NO") ```
3.961
978
B
File Name
PROGRAMMING
800
[ "greedy", "strings" ]
null
null
You can not just take the file and send it. When Polycarp trying to send a file in the social network "Codehorses", he encountered an unexpected problem. If the name of the file contains three or more "x" (lowercase Latin letters "x") in a row, the system considers that the file content does not correspond to the social network topic. In this case, the file is not sent and an error message is displayed. Determine the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. Print 0 if the file name does not initially contain a forbidden substring "xxx". You can delete characters in arbitrary positions (not necessarily consecutive). If you delete a character, then the length of a string is reduced by $1$. For example, if you delete the character in the position $2$ from the string "exxxii", then the resulting string is "exxii".
The first line contains integer $n$ $(3 \le n \le 100)$ — the length of the file name. The second line contains a string of length $n$ consisting of lowercase Latin letters only — the file name.
Print the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. If initially the file name dost not contain a forbidden substring "xxx", print 0.
[ "6\nxxxiii\n", "5\nxxoxx\n", "10\nxxxxxxxxxx\n" ]
[ "1\n", "0\n", "8\n" ]
In the first example Polycarp tried to send a file with name contains number $33$, written in Roman numerals. But he can not just send the file, because it name contains three letters "x" in a row. To send the file he needs to remove any one of this letters.
0
[ { "input": "6\nxxxiii", "output": "1" }, { "input": "5\nxxoxx", "output": "0" }, { "input": "10\nxxxxxxxxxx", "output": "8" }, { "input": "100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx", "output": "98" }, { "input": "99\nxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxaxxa", "output": "0" }, { "input": "3\nxxx", "output": "1" }, { "input": "77\naaabbbcccdddeeefffggghhhiiijjjkkklllmmmnnnooopppqqqrrrssstttuuuvvvwwwxxyyyzzz", "output": "0" }, { "input": "100\nuxxxxxlmexxxxxxxwnxxexxxxxcxxfydxxxxxxvmdxxxxxxisxxxxxxxxidkxxxpxxxxxxxxmnuxxxxjxxxqcxxwmxxxxxxxxmrx", "output": "41" }, { "input": "100\nxxxxxxxxxxxjtxxxxxxxxcxxxxxxcfxxxxzxxxxxxgxxxxxbxxxxbxxxxxxxxdycxxxxokixxxkizxxgcxxxxxxxxexxxxxfxxxc", "output": "49" }, { "input": "100\nuxxxxxlmexxxxxxxwnxxexxxxxcxxfydxxxxxxvmdxxxxxxisxxxxxxxxidkxxxpxxxxxxxxmnuxxxxjxxxqcxxwmxxxxxwxxxxx", "output": "41" }, { "input": "34\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa", "output": "0" }, { "input": "5\nfcyju", "output": "0" }, { "input": "100\nihygyvdvyeifomhxhkhdkimquvgallbqharcyriyqkidnwykozuhvkwdldlztpabgyuflikychqpdenwzgtlzotyumjgdsrbxxxx", "output": "2" } ]
1,679,901,122
2,147,483,647
Python 3
OK
TESTS
13
46
0
n=int(input()) a=input() while 'xxx' in a: a = a.replace('xxx','xx') print(n-len(a))
Title: File Name Time Limit: None seconds Memory Limit: None megabytes Problem Description: You can not just take the file and send it. When Polycarp trying to send a file in the social network "Codehorses", he encountered an unexpected problem. If the name of the file contains three or more "x" (lowercase Latin letters "x") in a row, the system considers that the file content does not correspond to the social network topic. In this case, the file is not sent and an error message is displayed. Determine the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. Print 0 if the file name does not initially contain a forbidden substring "xxx". You can delete characters in arbitrary positions (not necessarily consecutive). If you delete a character, then the length of a string is reduced by $1$. For example, if you delete the character in the position $2$ from the string "exxxii", then the resulting string is "exxii". Input Specification: The first line contains integer $n$ $(3 \le n \le 100)$ — the length of the file name. The second line contains a string of length $n$ consisting of lowercase Latin letters only — the file name. Output Specification: Print the minimum number of characters to remove from the file name so after that the name does not contain "xxx" as a substring. If initially the file name dost not contain a forbidden substring "xxx", print 0. Demo Input: ['6\nxxxiii\n', '5\nxxoxx\n', '10\nxxxxxxxxxx\n'] Demo Output: ['1\n', '0\n', '8\n'] Note: In the first example Polycarp tried to send a file with name contains number $33$, written in Roman numerals. But he can not just send the file, because it name contains three letters "x" in a row. To send the file he needs to remove any one of this letters.
```python n=int(input()) a=input() while 'xxx' in a: a = a.replace('xxx','xx') print(n-len(a)) ```
3
415
A
Mashmokh and Lights
PROGRAMMING
900
[ "implementation" ]
null
null
Mashmokh works in a factory. At the end of each day he must turn off all of the lights. The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off. Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*. Please, help Mashmokh, print these indices.
The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*). It is guaranteed that all lights will be turned off after pushing all buttons.
Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off.
[ "5 4\n4 3 1 2\n", "5 5\n5 4 3 2 1\n" ]
[ "1 1 3 4 4 \n", "1 2 3 4 5 \n" ]
In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
500
[ { "input": "5 4\n4 3 1 2", "output": "1 1 3 4 4 " }, { "input": "5 5\n5 4 3 2 1", "output": "1 2 3 4 5 " }, { "input": "16 11\n8 5 12 10 14 2 6 3 15 9 1", "output": "1 2 2 2 5 5 5 8 8 8 8 8 8 8 8 8 " }, { "input": "79 22\n76 32 48 28 33 44 58 59 1 51 77 13 15 64 49 72 74 21 61 12 60 57", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 28 28 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 32 76 76 76 76 " }, { "input": "25 19\n3 12 21 11 19 6 5 15 4 16 20 8 9 1 22 23 25 18 13", "output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "48 8\n42 27 40 1 18 3 19 2", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 27 27 27 27 27 27 27 27 27 27 27 27 27 27 27 42 42 42 42 42 42 42 " }, { "input": "44 19\n13 20 7 10 9 14 43 17 18 39 21 42 37 1 33 8 35 4 6", "output": "1 1 1 1 1 1 7 7 7 7 7 7 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 " }, { "input": "80 29\n79 51 28 73 65 39 10 1 59 29 7 70 64 3 35 17 24 71 74 2 6 49 66 80 13 18 60 15 12", "output": "1 1 1 1 1 1 1 1 1 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 28 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 79 79 " }, { "input": "31 4\n8 18 30 1", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 " }, { "input": "62 29\n61 55 35 13 51 56 23 6 8 26 27 40 48 11 18 12 19 50 54 14 24 21 32 17 43 33 1 2 3", "output": "1 1 1 1 1 6 6 6 6 6 6 6 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 13 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 55 55 55 55 55 55 61 61 " }, { "input": "5 4\n2 3 4 1", "output": "1 2 2 2 2 " }, { "input": "39 37\n2 5 17 24 19 33 35 16 20 3 1 34 10 36 15 37 14 8 28 21 13 31 30 29 7 25 32 12 6 27 22 4 11 39 18 9 26", "output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100 100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "1 1\n1", "output": "1 " }, { "input": "18 3\n18 1 11", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 18 " }, { "input": "67 20\n66 23 40 49 3 39 60 43 52 47 16 36 22 5 41 10 55 34 64 1", "output": "1 1 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 23 66 66 " }, { "input": "92 52\n9 85 44 13 27 61 8 1 28 41 6 14 70 67 39 71 56 80 34 21 5 10 40 73 63 38 90 57 37 36 82 86 65 46 7 54 81 12 45 49 83 59 64 26 62 25 60 24 91 47 53 55", "output": "1 1 1 1 1 1 1 8 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 " }, { "input": "66 36\n44 62 32 29 3 15 47 30 50 42 35 2 33 65 10 13 56 12 1 16 7 36 39 11 25 28 20 52 46 38 37 8 61 49 48 14", "output": "1 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 29 29 29 32 32 32 32 32 32 32 32 32 32 32 32 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 44 " }, { "input": "32 8\n27 23 1 13 18 24 17 26", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 23 23 23 23 27 27 27 27 27 27 " }, { "input": "26 13\n1 14 13 2 4 24 21 22 16 3 10 12 6", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "31 20\n10 11 20 2 4 26 31 7 13 12 28 1 30 18 21 8 3 16 15 19", "output": "1 2 2 2 2 2 2 2 2 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 " }, { "input": "86 25\n22 62 8 23 53 77 9 31 43 1 58 16 72 11 15 35 60 39 79 4 82 64 76 63 59", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 22 " }, { "input": "62 54\n2 5 4 47 40 61 37 31 41 16 44 42 48 32 10 6 62 38 52 49 11 20 55 22 3 36 25 21 50 8 28 14 18 39 34 54 53 19 46 27 15 23 12 24 60 17 33 57 58 1 35 29 51 7", "output": "1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "57 19\n43 45 37 40 42 55 16 33 47 32 34 35 9 41 1 6 8 15 5", "output": "1 1 1 1 1 1 1 1 9 9 9 9 9 9 9 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 37 37 37 37 37 37 43 43 43 43 43 43 43 43 43 43 43 43 43 43 43 " }, { "input": "32 14\n4 7 13 1 25 22 9 27 6 28 30 2 14 21", "output": "1 1 1 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 " }, { "input": "57 12\n8 53 51 38 1 6 16 33 13 46 28 35", "output": "1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 " }, { "input": "87 9\n57 34 78 1 52 67 56 6 54", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 34 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 57 " }, { "input": "88 42\n85 45 52 14 63 53 70 71 16 86 66 47 12 22 10 72 4 31 3 69 11 77 17 25 46 75 23 1 21 84 44 20 18 33 48 88 41 83 67 61 73 34", "output": "1 1 3 4 4 4 4 4 4 10 10 12 12 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 14 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 45 85 85 85 85 " }, { "input": "27 25\n9 21 17 5 16 3 23 7 12 4 14 11 13 1 15 19 27 8 20 10 22 25 6 18 26", "output": "1 1 3 3 5 5 5 5 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 " }, { "input": "89 28\n5 22 79 42 16 35 66 48 57 55 1 37 29 31 40 38 45 62 41 87 64 89 81 13 60 44 71 82", "output": "1 1 1 1 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 " }, { "input": "17 4\n4 3 1 2", "output": "1 1 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 " } ]
1,635,311,109
2,147,483,647
PyPy 3
OK
TESTS
31
77
18,944,000
n, m = map(int, input().split()) b, a = list(map(int, input().split())), [0] * n for x in b: for i in range(x - 1, n): if a[i] == 0: a[i] = x print(*a)
Title: Mashmokh and Lights Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mashmokh works in a factory. At the end of each day he must turn off all of the lights. The lights on the factory are indexed from 1 to *n*. There are *n* buttons in Mashmokh's room indexed from 1 to *n* as well. If Mashmokh pushes button with index *i*, then each light with index not less than *i* that is still turned on turns off. Mashmokh is not very clever. So instead of pushing the first button he pushes some of the buttons randomly each night. He pushed *m* distinct buttons *b*1,<=*b*2,<=...,<=*b**m* (the buttons were pushed consecutively in the given order) this night. Now he wants to know for each light the index of the button that turned this light off. Please note that the index of button *b**i* is actually *b**i*, not *i*. Please, help Mashmokh, print these indices. Input Specification: The first line of the input contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of the factory lights and the pushed buttons respectively. The next line contains *m* distinct space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*). It is guaranteed that all lights will be turned off after pushing all buttons. Output Specification: Output *n* space-separated integers where the *i*-th number is index of the button that turns the *i*-th light off. Demo Input: ['5 4\n4 3 1 2\n', '5 5\n5 4 3 2 1\n'] Demo Output: ['1 1 3 4 4 \n', '1 2 3 4 5 \n'] Note: In the first sample, after pressing button number 4, lights 4 and 5 are turned off and lights 1, 2 and 3 are still on. Then after pressing button number 3, light number 3 is turned off as well. Pressing button number 1 turns off lights number 1 and 2 as well so pressing button number 2 in the end has no effect. Thus button number 4 turned lights 4 and 5 off, button number 3 turned light 3 off and button number 1 turned light 1 and 2 off.
```python n, m = map(int, input().split()) b, a = list(map(int, input().split())), [0] * n for x in b: for i in range(x - 1, n): if a[i] == 0: a[i] = x print(*a) ```
3
199
A
Hexadecimal's theorem
PROGRAMMING
900
[ "brute force", "constructive algorithms", "implementation", "number theory" ]
null
null
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers. Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1. So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ... If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
The input contains of a single integer *n* (0<=≤<=*n*<=&lt;<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes. If there are multiple answers, print any of them.
[ "3\n", "13\n" ]
[ "1 1 1\n", "2 3 8\n" ]
none
500
[ { "input": "3", "output": "1 1 1" }, { "input": "13", "output": "2 3 8" }, { "input": "0", "output": "0 0 0" }, { "input": "1", "output": "1 0 0" }, { "input": "2", "output": "1 1 0" }, { "input": "1597", "output": "233 377 987" }, { "input": "0", "output": "0 0 0" }, { "input": "1", "output": "1 0 0" }, { "input": "1", "output": "1 0 0" }, { "input": "2", "output": "1 1 0" }, { "input": "3", "output": "1 1 1" }, { "input": "5", "output": "1 1 3" }, { "input": "8", "output": "1 2 5" }, { "input": "13", "output": "2 3 8" }, { "input": "21", "output": "3 5 13" }, { "input": "34", "output": "5 8 21" }, { "input": "55", "output": "8 13 34" }, { "input": "89", "output": "13 21 55" }, { "input": "144", "output": "21 34 89" }, { "input": "233", "output": "34 55 144" }, { "input": "377", "output": "55 89 233" }, { "input": "610", "output": "89 144 377" }, { "input": "987", "output": "144 233 610" }, { "input": "1597", "output": "233 377 987" }, { "input": "2584", "output": "377 610 1597" }, { "input": "4181", "output": "610 987 2584" }, { "input": "6765", "output": "987 1597 4181" }, { "input": "10946", "output": "1597 2584 6765" }, { "input": "17711", "output": "2584 4181 10946" }, { "input": "28657", "output": "4181 6765 17711" }, { "input": "46368", "output": "6765 10946 28657" }, { "input": "75025", "output": "10946 17711 46368" }, { "input": "121393", "output": "17711 28657 75025" }, { "input": "196418", "output": "28657 46368 121393" }, { "input": "317811", "output": "46368 75025 196418" }, { "input": "514229", "output": "75025 121393 317811" }, { "input": "832040", "output": "121393 196418 514229" }, { "input": "1346269", "output": "196418 317811 832040" }, { "input": "2178309", "output": "317811 514229 1346269" }, { "input": "3524578", "output": "514229 832040 2178309" }, { "input": "5702887", "output": "832040 1346269 3524578" }, { "input": "9227465", "output": "1346269 2178309 5702887" }, { "input": "14930352", "output": "2178309 3524578 9227465" }, { "input": "24157817", "output": "3524578 5702887 14930352" }, { "input": "39088169", "output": "5702887 9227465 24157817" }, { "input": "63245986", "output": "9227465 14930352 39088169" }, { "input": "102334155", "output": "14930352 24157817 63245986" }, { "input": "165580141", "output": "24157817 39088169 102334155" }, { "input": "267914296", "output": "39088169 63245986 165580141" }, { "input": "433494437", "output": "63245986 102334155 267914296" }, { "input": "701408733", "output": "102334155 165580141 433494437" }, { "input": "701408733", "output": "102334155 165580141 433494437" }, { "input": "102334155", "output": "14930352 24157817 63245986" }, { "input": "63245986", "output": "9227465 14930352 39088169" } ]
1,590,176,619
2,147,483,647
Python 3
MEMORY_LIMIT_EXCEEDED
TESTS
2
2,088
268,390,400
n=int(input()) fib_arr=[] fib_arr.append(0) fib_arr.append(1) i=2 while n!=fib_arr[i-1]: fib_arr.append(fib_arr[i-2]+fib_arr[i-1]) i+=1 print(f"{fib_arr[-5]} {fib_arr[-4]} {fib_arr[-2]}")
Title: Hexadecimal's theorem Time Limit: None seconds Memory Limit: None megabytes Problem Description: Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers. Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1. So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ... If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible. Input Specification: The input contains of a single integer *n* (0<=≤<=*n*<=&lt;<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number. Output Specification: Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes. If there are multiple answers, print any of them. Demo Input: ['3\n', '13\n'] Demo Output: ['1 1 1\n', '2 3 8\n'] Note: none
```python n=int(input()) fib_arr=[] fib_arr.append(0) fib_arr.append(1) i=2 while n!=fib_arr[i-1]: fib_arr.append(fib_arr[i-2]+fib_arr[i-1]) i+=1 print(f"{fib_arr[-5]} {fib_arr[-4]} {fib_arr[-2]}") ```
0
870
A
Search for Pretty Integers
PROGRAMMING
900
[ "brute force", "implementation" ]
null
null
You are given two lists of non-zero digits. Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively. The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list. The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list.
Print the smallest pretty integer.
[ "2 3\n4 2\n5 7 6\n", "8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n" ]
[ "25\n", "1\n" ]
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list. In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
500
[ { "input": "2 3\n4 2\n5 7 6", "output": "25" }, { "input": "8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1", "output": "1" }, { "input": "1 1\n9\n1", "output": "19" }, { "input": "9 1\n5 4 2 3 6 1 7 9 8\n9", "output": "9" }, { "input": "5 3\n7 2 5 8 6\n3 1 9", "output": "12" }, { "input": "4 5\n5 2 6 4\n8 9 1 3 7", "output": "12" }, { "input": "5 9\n4 2 1 6 7\n2 3 4 5 6 7 8 9 1", "output": "1" }, { "input": "9 9\n5 4 3 2 1 6 7 8 9\n3 2 1 5 4 7 8 9 6", "output": "1" }, { "input": "9 5\n2 3 4 5 6 7 8 9 1\n4 2 1 6 7", "output": "1" }, { "input": "9 9\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5 6 7 8 9", "output": "1" }, { "input": "9 9\n1 2 3 4 5 6 7 8 9\n9 8 7 6 5 4 3 2 1", "output": "1" }, { "input": "9 9\n9 8 7 6 5 4 3 2 1\n1 2 3 4 5 6 7 8 9", "output": "1" }, { "input": "9 9\n9 8 7 6 5 4 3 2 1\n9 8 7 6 5 4 3 2 1", "output": "1" }, { "input": "1 1\n8\n9", "output": "89" }, { "input": "1 1\n9\n8", "output": "89" }, { "input": "1 1\n1\n2", "output": "12" }, { "input": "1 1\n2\n1", "output": "12" }, { "input": "1 1\n9\n9", "output": "9" }, { "input": "1 1\n1\n1", "output": "1" }, { "input": "4 5\n3 2 4 5\n1 6 5 9 8", "output": "5" }, { "input": "3 2\n4 5 6\n1 5", "output": "5" }, { "input": "5 4\n1 3 5 6 7\n2 4 3 9", "output": "3" }, { "input": "5 5\n1 3 5 7 9\n2 4 6 8 9", "output": "9" }, { "input": "2 2\n1 8\n2 8", "output": "8" }, { "input": "5 5\n5 6 7 8 9\n1 2 3 4 5", "output": "5" }, { "input": "5 5\n1 2 3 4 5\n1 2 3 4 5", "output": "1" }, { "input": "5 5\n1 2 3 4 5\n2 3 4 5 6", "output": "2" }, { "input": "2 2\n1 5\n2 5", "output": "5" }, { "input": "4 4\n1 3 5 8\n2 4 6 8", "output": "8" }, { "input": "3 3\n1 5 3\n2 5 7", "output": "5" }, { "input": "3 3\n3 6 8\n2 6 9", "output": "6" }, { "input": "2 2\n1 4\n2 4", "output": "4" }, { "input": "5 3\n3 4 5 6 7\n1 5 9", "output": "5" }, { "input": "4 4\n1 2 3 4\n2 5 6 7", "output": "2" }, { "input": "5 5\n1 2 3 4 5\n9 2 1 7 5", "output": "1" }, { "input": "2 2\n1 3\n2 3", "output": "3" }, { "input": "3 3\n3 2 1\n3 2 1", "output": "1" }, { "input": "3 3\n1 3 5\n2 3 6", "output": "3" }, { "input": "3 3\n5 6 7\n5 6 7", "output": "5" }, { "input": "1 2\n5\n2 5", "output": "5" }, { "input": "3 3\n2 4 9\n7 8 9", "output": "9" }, { "input": "3 3\n1 2 4\n3 4 5", "output": "4" }, { "input": "3 2\n1 4 9\n2 4", "output": "4" }, { "input": "3 3\n3 5 6\n1 5 9", "output": "5" }, { "input": "3 2\n1 2 4\n3 4", "output": "4" }, { "input": "2 4\n8 9\n1 2 3 9", "output": "9" }, { "input": "1 2\n9\n8 9", "output": "9" }, { "input": "3 2\n1 2 4\n4 2", "output": "2" }, { "input": "2 3\n4 5\n1 3 5", "output": "5" }, { "input": "3 2\n1 2 3\n2 3", "output": "2" }, { "input": "4 3\n1 3 5 9\n2 8 9", "output": "9" }, { "input": "2 2\n1 9\n9 2", "output": "9" } ]
1,587,799,540
2,147,483,647
Python 3
OK
TESTS
52
109
307,200
n , m = map(int,input().split()) l1 = sorted(list(map(int,input().split()))) l2 = sorted(list(map(int,input().split()))) flag = 0 for i in l1: if i in l2: flag = 1 print(i) break if flag==0: a = str(l1[0])+str(l2[0]) b = str(l2[0])+str(l1[0]) print(min(int(a),int(b)))
Title: Search for Pretty Integers Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are given two lists of non-zero digits. Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer? Input Specification: The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively. The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list. The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list. Output Specification: Print the smallest pretty integer. Demo Input: ['2 3\n4 2\n5 7 6\n', '8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n'] Demo Output: ['25\n', '1\n'] Note: In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list. In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer.
```python n , m = map(int,input().split()) l1 = sorted(list(map(int,input().split()))) l2 = sorted(list(map(int,input().split()))) flag = 0 for i in l1: if i in l2: flag = 1 print(i) break if flag==0: a = str(l1[0])+str(l2[0]) b = str(l2[0])+str(l1[0]) print(min(int(a),int(b))) ```
3
513
A
Game
PROGRAMMING
800
[ "constructive algorithms", "math" ]
null
null
Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally.
The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50. This problem doesn't have subproblems. You will get 3 points for the correct submission.
Output "First" if the first player wins and "Second" otherwise.
[ "2 2 1 2\n", "2 1 1 1\n" ]
[ "Second\n", "First\n" ]
Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
3
[ { "input": "2 2 1 2", "output": "Second" }, { "input": "2 1 1 1", "output": "First" }, { "input": "5 7 4 1", "output": "Second" }, { "input": "5 7 1 4", "output": "Second" }, { "input": "5 7 10 10", "output": "Second" }, { "input": "5 7 1 10", "output": "Second" }, { "input": "1 1 1 1", "output": "Second" }, { "input": "50 50 50 50", "output": "Second" }, { "input": "50 49 1 2", "output": "First" }, { "input": "50 48 3 1", "output": "First" }, { "input": "48 50 12 11", "output": "Second" }, { "input": "49 50 11 12", "output": "Second" }, { "input": "49 49 4 1", "output": "Second" }, { "input": "49 49 3 3", "output": "Second" }, { "input": "1 50 1 50", "output": "Second" }, { "input": "1 50 50 50", "output": "Second" }, { "input": "50 1 1 1", "output": "First" }, { "input": "50 1 1 50", "output": "First" }, { "input": "32 31 10 9", "output": "First" }, { "input": "32 4 17 3", "output": "First" } ]
1,603,504,077
2,147,483,647
Python 3
OK
TESTS
20
109
0
n1,n2,k1,k2 = map(int,input().split()) if n1<=n2: print("Second") else: print("First")
Title: Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally. Input Specification: The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50. This problem doesn't have subproblems. You will get 3 points for the correct submission. Output Specification: Output "First" if the first player wins and "Second" otherwise. Demo Input: ['2 2 1 2\n', '2 1 1 1\n'] Demo Output: ['Second\n', 'First\n'] Note: Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
```python n1,n2,k1,k2 = map(int,input().split()) if n1<=n2: print("Second") else: print("First") ```
3
527
A
Playing with Paper
PROGRAMMING
1,100
[ "implementation", "math" ]
null
null
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=&gt;<=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part. After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop. Can you determine how many ships Vasya will make during the lesson?
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=&lt;<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
Print a single integer — the number of ships that Vasya will make.
[ "2 1\n", "10 7\n", "1000000000000 1\n" ]
[ "2\n", "6\n", "1000000000000\n" ]
Pictures to the first and second sample test.
500
[ { "input": "2 1", "output": "2" }, { "input": "10 7", "output": "6" }, { "input": "1000000000000 1", "output": "1000000000000" }, { "input": "3 1", "output": "3" }, { "input": "4 1", "output": "4" }, { "input": "3 2", "output": "3" }, { "input": "4 2", "output": "2" }, { "input": "1000 700", "output": "6" }, { "input": "959986566087 524054155168", "output": "90" }, { "input": "4 3", "output": "4" }, { "input": "7 6", "output": "7" }, { "input": "1000 999", "output": "1000" }, { "input": "1000 998", "output": "500" }, { "input": "1000 997", "output": "336" }, { "input": "42 1", "output": "42" }, { "input": "1000 1", "output": "1000" }, { "input": "8 5", "output": "5" }, { "input": "13 8", "output": "6" }, { "input": "987 610", "output": "15" }, { "input": "442 42", "output": "22" }, { "input": "754 466", "output": "13" }, { "input": "1000000000000 999999999999", "output": "1000000000000" }, { "input": "1000000000000 999999999998", "output": "500000000000" }, { "input": "941 14", "output": "74" }, { "input": "998 2", "output": "499" }, { "input": "1000 42", "output": "32" }, { "input": "1000 17", "output": "66" }, { "input": "5 1", "output": "5" }, { "input": "5 2", "output": "4" }, { "input": "5 3", "output": "4" }, { "input": "5 4", "output": "5" }, { "input": "293 210", "output": "17" }, { "input": "787878787878 424242424242", "output": "8" }, { "input": "956722026041 591286729879", "output": "58" }, { "input": "956722026041 365435296162", "output": "58" }, { "input": "628625247282 464807889701", "output": "102" }, { "input": "695928431619 424778620208", "output": "167" }, { "input": "1000000000000 42", "output": "23809523821" }, { "input": "987654345678 23", "output": "42941493300" }, { "input": "10000000001 2", "output": "5000000002" }, { "input": "1000000000000 2", "output": "500000000000" }, { "input": "1000000000000 3", "output": "333333333336" }, { "input": "100000000000 3", "output": "33333333336" }, { "input": "100000000000 23", "output": "4347826109" }, { "input": "999999999997 7", "output": "142857142861" }, { "input": "8589934592 4294967296", "output": "2" } ]
1,489,393,474
2,147,483,647
Python 3
OK
TESTS
46
62
4,608,000
# Description of the problem can be found at http://codeforces.com/problemset/problem/527/A # originally implemented with recursive function made below, but exceeded recursion depth. ''' def get_ship_count(a, b): if a == b: return 1 if a - b > b: return 1 + get_ship_count(a - b, b) else: return 1 + get_ship_count(b, a - b) ''' a, b = map(int, input().split()) t = 0 while b != 0: t += a // b h = a % b a = b b = h print(t)
Title: Playing with Paper Time Limit: None seconds Memory Limit: None megabytes Problem Description: One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=&gt;<=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part. After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop. Can you determine how many ships Vasya will make during the lesson? Input Specification: The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=&lt;<=*a*<=≤<=1012) — the sizes of the original sheet of paper. Output Specification: Print a single integer — the number of ships that Vasya will make. Demo Input: ['2 1\n', '10 7\n', '1000000000000 1\n'] Demo Output: ['2\n', '6\n', '1000000000000\n'] Note: Pictures to the first and second sample test.
```python # Description of the problem can be found at http://codeforces.com/problemset/problem/527/A # originally implemented with recursive function made below, but exceeded recursion depth. ''' def get_ship_count(a, b): if a == b: return 1 if a - b > b: return 1 + get_ship_count(a - b, b) else: return 1 + get_ship_count(b, a - b) ''' a, b = map(int, input().split()) t = 0 while b != 0: t += a // b h = a % b a = b b = h print(t) ```
3
493
B
Vasya and Wrestling
PROGRAMMING
1,400
[ "implementation" ]
null
null
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins. When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins. If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105). The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points. The techniques are given in chronological order.
If the first wrestler wins, print string "first", otherwise print "second"
[ "5\n1\n2\n-3\n-4\n3\n", "3\n-1\n-2\n3\n", "2\n4\n-4\n" ]
[ "second\n", "first\n", "second\n" ]
Sequence *x*  =  *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y*  =  *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*|  &gt;  |*y*| and *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>, ... ,  *x*<sub class="lower-index">|*y*|</sub>  =  *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r*  &lt;  |*x*|, *r*  &lt;  |*y*|), that *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>,  ... ,  *x*<sub class="lower-index">*r*</sub>  =  *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r*  +  1</sub>  &gt;  *y*<sub class="lower-index">*r*  +  1</sub>. We use notation |*a*| to denote length of sequence *a*.
1,000
[ { "input": "5\n1\n2\n-3\n-4\n3", "output": "second" }, { "input": "3\n-1\n-2\n3", "output": "first" }, { "input": "2\n4\n-4", "output": "second" }, { "input": "7\n1\n2\n-3\n4\n5\n-6\n7", "output": "first" }, { "input": "14\n1\n2\n3\n4\n5\n6\n7\n-8\n-9\n-10\n-11\n-12\n-13\n-14", "output": "second" }, { "input": "4\n16\n12\n19\n-98", "output": "second" }, { "input": "5\n-6\n-1\n-1\n5\n3", "output": "second" }, { "input": "11\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1", "output": "first" }, { "input": "1\n-534365", "output": "second" }, { "input": "1\n10253033", "output": "first" }, { "input": "3\n-1\n-2\n3", "output": "first" }, { "input": "8\n1\n-2\n-3\n4\n5\n-6\n-7\n8", "output": "second" }, { "input": "2\n1\n-1", "output": "second" }, { "input": "5\n1\n2\n3\n4\n5", "output": "first" }, { "input": "5\n-1\n-2\n-3\n-4\n-5", "output": "second" }, { "input": "10\n-1\n-2\n-3\n-4\n-5\n5\n4\n3\n2\n1", "output": "first" }, { "input": "131\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n-1\n-1\n2", "output": "first" }, { "input": "6\n-1\n-2\n-3\n1\n2\n3", "output": "first" }, { "input": "3\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "12\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "4\n1000000000\n1000000000\n1000000000\n-1000000000", "output": "first" }, { "input": "20\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "5\n1000000000\n1000000000\n-1000000000\n-1000000000\n-1000000000", "output": "second" }, { "input": "4\n1\n-1000000000\n-1000000000\n-1000000000", "output": "second" }, { "input": "5\n1000000000\n1000000000\n1000000000\n-1000000000\n-1000000000", "output": "first" }, { "input": "4\n-1\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "11\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000", "output": "first" }, { "input": "2\n-4\n4", "output": "first" }, { "input": "3\n-12\n3\n9", "output": "second" }, { "input": "3\n9\n1\n-10", "output": "second" }, { "input": "3\n1\n2\n-3", "output": "second" }, { "input": "4\n55\n5\n-5\n-55", "output": "first" }, { "input": "4\n5\n-1\n1\n-5", "output": "first" }, { "input": "2\n-5\n6", "output": "first" }, { "input": "4\n5\n-4\n3\n-40", "output": "second" }, { "input": "4\n1000000000\n1000000000\n1000000000\n-5", "output": "first" }, { "input": "6\n3\n2\n1\n-3\n-1\n-2", "output": "first" }, { "input": "5\n4\n1\n1\n-3\n-3", "output": "first" }, { "input": "5\n208\n-52\n-52\n-52\n-52", "output": "first" }, { "input": "3\n-100\n-200\n300", "output": "first" }, { "input": "3\n400\n-200\n-200", "output": "first" }, { "input": "3\n208\n-207\n-1", "output": "first" }, { "input": "3\n98888887\n98888888\n-197777775", "output": "second" } ]
1,638,635,390
2,147,483,647
PyPy 3-64
OK
TESTS
57
296
10,342,400
from sys import stdin, stdout rd = lambda: list(map(int, stdin.readline().split())) rds = lambda: stdin.readline().rstrip() ii = lambda: int(stdin.readline()) INF = 1 << 62 mod = 10**9 + 7 n = ii() a = [] b = [] t = None for _ in range(n): x = ii() if x > 0: a.append(x) t = 0 else: b.append(-x) t = 1 sa = sum(a) sb = sum(b) if sa > sb: print('first') elif sa < sb: print('second') else: ok = False res = None l = min(len(a), len(b)) for i in range(l): if a[i] > b[i]: res = 'first' ok = True break if a[i] < b[i]: ok = True res = 'second' break if not ok: if len(a) > len(b): res = 'first' if len(a) < len(b): res = 'second' if not ok: if t == 0: res = 'first' else: res = 'second' print(res) #stdout.write(' '.join(map(str, ar))) #stdout.write(f'{res}')
Title: Vasya and Wrestling Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins. When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins. If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won. Input Specification: The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105). The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points. The techniques are given in chronological order. Output Specification: If the first wrestler wins, print string "first", otherwise print "second" Demo Input: ['5\n1\n2\n-3\n-4\n3\n', '3\n-1\n-2\n3\n', '2\n4\n-4\n'] Demo Output: ['second\n', 'first\n', 'second\n'] Note: Sequence *x*  =  *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y*  =  *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*|  &gt;  |*y*| and *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>, ... ,  *x*<sub class="lower-index">|*y*|</sub>  =  *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r*  &lt;  |*x*|, *r*  &lt;  |*y*|), that *x*<sub class="lower-index">1</sub>  =  *y*<sub class="lower-index">1</sub>,  *x*<sub class="lower-index">2</sub>  =  *y*<sub class="lower-index">2</sub>,  ... ,  *x*<sub class="lower-index">*r*</sub>  =  *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r*  +  1</sub>  &gt;  *y*<sub class="lower-index">*r*  +  1</sub>. We use notation |*a*| to denote length of sequence *a*.
```python from sys import stdin, stdout rd = lambda: list(map(int, stdin.readline().split())) rds = lambda: stdin.readline().rstrip() ii = lambda: int(stdin.readline()) INF = 1 << 62 mod = 10**9 + 7 n = ii() a = [] b = [] t = None for _ in range(n): x = ii() if x > 0: a.append(x) t = 0 else: b.append(-x) t = 1 sa = sum(a) sb = sum(b) if sa > sb: print('first') elif sa < sb: print('second') else: ok = False res = None l = min(len(a), len(b)) for i in range(l): if a[i] > b[i]: res = 'first' ok = True break if a[i] < b[i]: ok = True res = 'second' break if not ok: if len(a) > len(b): res = 'first' if len(a) < len(b): res = 'second' if not ok: if t == 0: res = 'first' else: res = 'second' print(res) #stdout.write(' '.join(map(str, ar))) #stdout.write(f'{res}') ```
3
408
B
Garland
PROGRAMMING
1,200
[ "implementation" ]
null
null
Once little Vasya read an article in a magazine on how to make beautiful handmade garland from colored paper. Vasya immediately went to the store and bought *n* colored sheets of paper, the area of each sheet is 1 square meter. The garland must consist of exactly *m* pieces of colored paper of arbitrary area, each piece should be of a certain color. To make the garland, Vasya can arbitrarily cut his existing colored sheets into pieces. Vasya is not obliged to use all the sheets to make the garland. Vasya wants the garland to be as attractive as possible, so he wants to maximize the total area of ​​*m* pieces of paper in the garland. Calculate what the maximum total area of ​​the pieces of paper in the garland Vasya can get.
The first line contains a non-empty sequence of *n* (1<=≤<=*n*<=≤<=1000) small English letters ("a"..."z"). Each letter means that Vasya has a sheet of paper of the corresponding color. The second line contains a non-empty sequence of *m* (1<=≤<=*m*<=≤<=1000) small English letters that correspond to the colors of the pieces of paper in the garland that Vasya wants to make.
Print an integer that is the maximum possible total area of the pieces of paper in the garland Vasya wants to get or -1, if it is impossible to make the garland from the sheets he's got. It is guaranteed that the answer is always an integer.
[ "aaabbac\naabbccac\n", "a\nz\n" ]
[ "6\n", "-1" ]
In the first test sample Vasya can make an garland of area 6: he can use both sheets of color *b*, three (but not four) sheets of color *a* and cut a single sheet of color *c* in three, for example, equal pieces. Vasya can use the resulting pieces to make a garland of area 6. In the second test sample Vasya cannot make a garland at all — he doesn't have a sheet of color *z*.
1,000
[ { "input": "aaabbac\naabbccac", "output": "6" }, { "input": "a\nz", "output": "-1" }, { "input": "r\nr", "output": "1" }, { "input": "stnsdn\nndnndsn", "output": "4" }, { "input": "yqfqfp\ntttwtqq", "output": "-1" }, { "input": "zzbbrrtrtzr\ntbbtrrrzr", "output": "9" }, { "input": "ivvfisvsvii\npaihjinno", "output": "-1" }, { "input": "zbvwnlgkshqerxptyod\nz", "output": "1" }, { "input": "xlktwjymocqrahnbesf\nfoo", "output": "2" }, { "input": "bbzmzqazmbambnmzaabznmbabzqnaabmabmnnabbmnzaanzzezebzabqaabzqaemeqqammmbazmmz\naznnbbmeebmanbeemzmemqbaeebnqenqzzbanebmnzqqebqmmnmqqzmmeqqqaaezemmazqqmqaqnnqqzbzeeazammmenbbamzbmnaenemenaaaebnmanebqmqnznqbenmqqnnnaeaebqmamennmqqeaaqqbammnzqmnmqnqbbezmemznqmanzmmqzzzzembqnzqbanamezqaqbazenenqqznqaebzaeezbqqbmeeaqnmmbnqbbnmaqqemaeaezaabmbnbzzaae", "output": "77" }, { "input": "lccfdfnfflncddlksndcwnfcllnnaswcdnldafcalssfcdnkkaklwnnacsncfwanwnwfadawcsdcfwflnnlfsfclkfknlaldna\nuaaldlllhedgugugueahddhedbuddaedhaaeugdubaealbgbagedldbl", "output": "-1" }, { "input": "hvewdvwdwudrwarwmddwnazmwauzatrmwptwwevavpmwrtruwnpwantewrnwmepdwvtmnveanunrvrtwpvhhnuhnmpptdttzmmndtvudmzhhannmmnahdpzamuvhzaavnhtnumwrwvttdetvuewaaennddwuvzvaptdzrzhtetwwzmzedrwuvrwznprhdvnavrruvvhzuwpdtmpwmzrwvermrhdamv\nuvzhwtpuputnahwwarduzddhpnwwvettprwavdmnztdnrddmarmvuevtdezndnezvarhmppwwnmvnrtddzhhnzrwuhvpwmezuurundarwdazwptrpeurrnwautddnhdmhtwhwvvtavdzezumetzezpazndhuentmrhamutrtttpevtuutemdnvwnwnmnvmznatneweuaahdavmaddhnrdenwwztrwh", "output": "199" }, { "input": "aaccddff\nabcdf", "output": "-1" } ]
1,629,480,206
2,147,483,647
Python 3
OK
TESTS
21
77
6,963,200
s=input() g=input() mp1={} mp2={} count=0 cnt=0 for i in s: if(i not in mp1.keys()): mp1[i]=1 else: mp1[i]+=1 for i in g: if(i not in mp2.keys()): mp2[i]=1 else: mp2[i]+=1 for i in mp2.keys(): if(i not in mp1.keys()): print(-1) cnt=1 break else: if(mp2[i]<mp1[i]): count+=mp2[i] else: count+=mp1[i] if(cnt!=1): print(count)
Title: Garland Time Limit: None seconds Memory Limit: None megabytes Problem Description: Once little Vasya read an article in a magazine on how to make beautiful handmade garland from colored paper. Vasya immediately went to the store and bought *n* colored sheets of paper, the area of each sheet is 1 square meter. The garland must consist of exactly *m* pieces of colored paper of arbitrary area, each piece should be of a certain color. To make the garland, Vasya can arbitrarily cut his existing colored sheets into pieces. Vasya is not obliged to use all the sheets to make the garland. Vasya wants the garland to be as attractive as possible, so he wants to maximize the total area of ​​*m* pieces of paper in the garland. Calculate what the maximum total area of ​​the pieces of paper in the garland Vasya can get. Input Specification: The first line contains a non-empty sequence of *n* (1<=≤<=*n*<=≤<=1000) small English letters ("a"..."z"). Each letter means that Vasya has a sheet of paper of the corresponding color. The second line contains a non-empty sequence of *m* (1<=≤<=*m*<=≤<=1000) small English letters that correspond to the colors of the pieces of paper in the garland that Vasya wants to make. Output Specification: Print an integer that is the maximum possible total area of the pieces of paper in the garland Vasya wants to get or -1, if it is impossible to make the garland from the sheets he's got. It is guaranteed that the answer is always an integer. Demo Input: ['aaabbac\naabbccac\n', 'a\nz\n'] Demo Output: ['6\n', '-1'] Note: In the first test sample Vasya can make an garland of area 6: he can use both sheets of color *b*, three (but not four) sheets of color *a* and cut a single sheet of color *c* in three, for example, equal pieces. Vasya can use the resulting pieces to make a garland of area 6. In the second test sample Vasya cannot make a garland at all — he doesn't have a sheet of color *z*.
```python s=input() g=input() mp1={} mp2={} count=0 cnt=0 for i in s: if(i not in mp1.keys()): mp1[i]=1 else: mp1[i]+=1 for i in g: if(i not in mp2.keys()): mp2[i]=1 else: mp2[i]+=1 for i in mp2.keys(): if(i not in mp1.keys()): print(-1) cnt=1 break else: if(mp2[i]<mp1[i]): count+=mp2[i] else: count+=mp1[i] if(cnt!=1): print(count) ```
3
409
H
A + B Strikes Back
PROGRAMMING
1,500
[ "*special", "brute force", "constructive algorithms", "dsu", "implementation" ]
null
null
A + B is often used as an example of the easiest problem possible to show some contest platform. However, some scientists have observed that sometimes this problem is not so easy to get accepted. Want to try?
The input contains two integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=103), separated by a single space.
Output the sum of the given integers.
[ "5 14\n", "381 492\n" ]
[ "19\n", "873\n" ]
none
0
[ { "input": "5 14", "output": "19" }, { "input": "381 492", "output": "873" }, { "input": "536 298", "output": "834" }, { "input": "143 522", "output": "665" }, { "input": "433 126", "output": "559" }, { "input": "723 350", "output": "1073" }, { "input": "632 264", "output": "896" }, { "input": "923 488", "output": "1411" }, { "input": "522 92", "output": "614" }, { "input": "953 553", "output": "1506" }, { "input": "242 86", "output": "328" }, { "input": "151 691", "output": "842" }, { "input": "441 915", "output": "1356" }, { "input": "740 519", "output": "1259" }, { "input": "339 433", "output": "772" }, { "input": "629 657", "output": "1286" }, { "input": "538 261", "output": "799" }, { "input": "828 485", "output": "1313" }, { "input": "117 399", "output": "516" }, { "input": "399 280", "output": "679" } ]
1,587,067,006
2,147,483,647
PyPy 3
WRONG_ANSWER
TESTS
0
0
0
a,b = map(long long, input().split()) print(a + b)
Title: A + B Strikes Back Time Limit: None seconds Memory Limit: None megabytes Problem Description: A + B is often used as an example of the easiest problem possible to show some contest platform. However, some scientists have observed that sometimes this problem is not so easy to get accepted. Want to try? Input Specification: The input contains two integers *a* and *b* (0<=≤<=*a*,<=*b*<=≤<=103), separated by a single space. Output Specification: Output the sum of the given integers. Demo Input: ['5 14\n', '381 492\n'] Demo Output: ['19\n', '873\n'] Note: none
```python a,b = map(long long, input().split()) print(a + b) ```
0
994
A
Fingerprints
PROGRAMMING
800
[ "implementation" ]
null
null
You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code.
The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints.
In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable.
[ "7 3\n3 5 7 1 6 2 8\n1 2 7\n", "4 4\n3 4 1 0\n0 1 7 9\n" ]
[ "7 1 2\n", "1 0\n" ]
In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
500
[ { "input": "7 3\n3 5 7 1 6 2 8\n1 2 7", "output": "7 1 2" }, { "input": "4 4\n3 4 1 0\n0 1 7 9", "output": "1 0" }, { "input": "9 4\n9 8 7 6 5 4 3 2 1\n2 4 6 8", "output": "8 6 4 2" }, { "input": "10 5\n3 7 1 2 4 6 9 0 5 8\n4 3 0 7 9", "output": "3 7 4 9 0" }, { "input": "10 10\n1 2 3 4 5 6 7 8 9 0\n4 5 6 7 1 2 3 0 9 8", "output": "1 2 3 4 5 6 7 8 9 0" }, { "input": "1 1\n4\n4", "output": "4" }, { "input": "3 7\n6 3 4\n4 9 0 1 7 8 6", "output": "6 4" }, { "input": "10 1\n9 0 8 1 7 4 6 5 2 3\n0", "output": "0" }, { "input": "5 10\n6 0 3 8 1\n3 1 0 5 4 7 2 8 9 6", "output": "6 0 3 8 1" }, { "input": "8 2\n7 2 9 6 1 0 3 4\n6 3", "output": "6 3" }, { "input": "5 4\n7 0 1 4 9\n0 9 5 3", "output": "0 9" }, { "input": "10 1\n9 6 2 0 1 8 3 4 7 5\n6", "output": "6" }, { "input": "10 2\n7 1 0 2 4 6 5 9 3 8\n3 2", "output": "2 3" }, { "input": "5 9\n3 7 9 2 4\n3 8 4 5 9 6 1 0 2", "output": "3 9 2 4" }, { "input": "10 6\n7 1 2 3 8 0 6 4 5 9\n1 5 8 2 3 6", "output": "1 2 3 8 6 5" }, { "input": "8 2\n7 4 8 9 2 5 6 1\n6 4", "output": "4 6" }, { "input": "10 2\n1 0 3 5 8 9 4 7 6 2\n0 3", "output": "0 3" }, { "input": "7 6\n9 2 8 6 1 3 7\n4 2 0 3 1 8", "output": "2 8 1 3" }, { "input": "1 6\n3\n6 8 2 4 5 3", "output": "3" }, { "input": "1 8\n0\n9 2 4 8 1 5 0 7", "output": "0" }, { "input": "6 9\n7 3 9 4 1 0\n9 1 5 8 0 6 2 7 4", "output": "7 9 4 1 0" }, { "input": "10 2\n4 9 6 8 3 0 1 5 7 2\n0 1", "output": "0 1" }, { "input": "10 5\n5 2 8 0 9 7 6 1 4 3\n9 6 4 1 2", "output": "2 9 6 1 4" }, { "input": "6 3\n8 3 9 2 7 6\n5 4 3", "output": "3" }, { "input": "4 10\n8 3 9 6\n4 9 6 2 7 0 8 1 3 5", "output": "8 3 9 6" }, { "input": "1 2\n1\n1 0", "output": "1" }, { "input": "3 6\n1 2 3\n4 5 6 1 2 3", "output": "1 2 3" }, { "input": "1 2\n2\n1 2", "output": "2" }, { "input": "1 10\n9\n0 1 2 3 4 5 6 7 8 9", "output": "9" } ]
1,616,756,236
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
0
m=input() s=str(input()).count t=map(int,input().split()) for _ in t: print(*[_]*s(str(_)),end=" ")
Title: Fingerprints Time Limit: None seconds Memory Limit: None megabytes Problem Description: You are locked in a room with a door that has a keypad with 10 keys corresponding to digits from 0 to 9. To escape from the room, you need to enter a correct code. You also have a sequence of digits. Some keys on the keypad have fingerprints. You believe the correct code is the longest not necessarily contiguous subsequence of the sequence you have that only contains digits with fingerprints on the corresponding keys. Find such code. Input Specification: The first line contains two integers $n$ and $m$ ($1 \le n, m \le 10$) representing the number of digits in the sequence you have and the number of keys on the keypad that have fingerprints. The next line contains $n$ distinct space-separated integers $x_1, x_2, \ldots, x_n$ ($0 \le x_i \le 9$) representing the sequence. The next line contains $m$ distinct space-separated integers $y_1, y_2, \ldots, y_m$ ($0 \le y_i \le 9$) — the keys with fingerprints. Output Specification: In a single line print a space-separated sequence of integers representing the code. If the resulting sequence is empty, both printing nothing and printing a single line break is acceptable. Demo Input: ['7 3\n3 5 7 1 6 2 8\n1 2 7\n', '4 4\n3 4 1 0\n0 1 7 9\n'] Demo Output: ['7 1 2\n', '1 0\n'] Note: In the first example, the only digits with fingerprints are $1$, $2$ and $7$. All three of them appear in the sequence you know, $7$ first, then $1$ and then $2$. Therefore the output is 7 1 2. Note that the order is important, and shall be the same as the order in the original sequence. In the second example digits $0$, $1$, $7$ and $9$ have fingerprints, however only $0$ and $1$ appear in the original sequence. $1$ appears earlier, so the output is 1 0. Again, the order is important.
```python m=input() s=str(input()).count t=map(int,input().split()) for _ in t: print(*[_]*s(str(_)),end=" ") ```
0
710
C
Magic Odd Square
PROGRAMMING
1,500
[ "constructive algorithms", "math" ]
null
null
Find an *n*<=×<=*n* matrix with different numbers from 1 to *n*2, so the sum in each row, column and both main diagonals are odd.
The only line contains odd integer *n* (1<=≤<=*n*<=≤<=49).
Print *n* lines with *n* integers. All the integers should be different and from 1 to *n*2. The sum in each row, column and both main diagonals should be odd.
[ "1\n", "3\n" ]
[ "1\n", "2 1 4\n3 5 7\n6 9 8\n" ]
none
0
[ { "input": "1", "output": "1" }, { "input": "3", "output": "2 1 4\n3 5 7\n6 9 8" }, { "input": "5", "output": "2 4 1 6 8\n10 3 5 7 12\n9 11 13 15 17\n14 19 21 23 16\n18 20 25 22 24" }, { "input": "7", "output": "2 4 6 1 8 10 12\n14 16 3 5 7 18 20\n22 9 11 13 15 17 24\n19 21 23 25 27 29 31\n26 33 35 37 39 41 28\n30 32 43 45 47 34 36\n38 40 42 49 44 46 48" }, { "input": "9", "output": "2 4 6 8 1 10 12 14 16\n18 20 22 3 5 7 24 26 28\n30 32 9 11 13 15 17 34 36\n38 19 21 23 25 27 29 31 40\n33 35 37 39 41 43 45 47 49\n42 51 53 55 57 59 61 63 44\n46 48 65 67 69 71 73 50 52\n54 56 58 75 77 79 60 62 64\n66 68 70 72 81 74 76 78 80" }, { "input": "11", "output": "2 4 6 8 10 1 12 14 16 18 20\n22 24 26 28 3 5 7 30 32 34 36\n38 40 42 9 11 13 15 17 44 46 48\n50 52 19 21 23 25 27 29 31 54 56\n58 33 35 37 39 41 43 45 47 49 60\n51 53 55 57 59 61 63 65 67 69 71\n62 73 75 77 79 81 83 85 87 89 64\n66 68 91 93 95 97 99 101 103 70 72\n74 76 78 105 107 109 111 113 80 82 84\n86 88 90 92 115 117 119 94 96 98 100\n102 104 106 108 110 121 112 114 116 118 120" }, { "input": "13", "output": "2 4 6 8 10 12 1 14 16 18 20 22 24\n26 28 30 32 34 3 5 7 36 38 40 42 44\n46 48 50 52 9 11 13 15 17 54 56 58 60\n62 64 66 19 21 23 25 27 29 31 68 70 72\n74 76 33 35 37 39 41 43 45 47 49 78 80\n82 51 53 55 57 59 61 63 65 67 69 71 84\n73 75 77 79 81 83 85 87 89 91 93 95 97\n86 99 101 103 105 107 109 111 113 115 117 119 88\n90 92 121 123 125 127 129 131 133 135 137 94 96\n98 100 102 139 141 143 145 147 149 151 104 106 108\n110 112 114 116 153 155 157 159 161 118 120 122 124\n126 128 130 132 134 163 165 167 136 ..." }, { "input": "15", "output": "2 4 6 8 10 12 14 1 16 18 20 22 24 26 28\n30 32 34 36 38 40 3 5 7 42 44 46 48 50 52\n54 56 58 60 62 9 11 13 15 17 64 66 68 70 72\n74 76 78 80 19 21 23 25 27 29 31 82 84 86 88\n90 92 94 33 35 37 39 41 43 45 47 49 96 98 100\n102 104 51 53 55 57 59 61 63 65 67 69 71 106 108\n110 73 75 77 79 81 83 85 87 89 91 93 95 97 112\n99 101 103 105 107 109 111 113 115 117 119 121 123 125 127\n114 129 131 133 135 137 139 141 143 145 147 149 151 153 116\n118 120 155 157 159 161 163 165 167 169 171 173 175 122 124\n126 128 1..." }, { "input": "17", "output": "2 4 6 8 10 12 14 16 1 18 20 22 24 26 28 30 32\n34 36 38 40 42 44 46 3 5 7 48 50 52 54 56 58 60\n62 64 66 68 70 72 9 11 13 15 17 74 76 78 80 82 84\n86 88 90 92 94 19 21 23 25 27 29 31 96 98 100 102 104\n106 108 110 112 33 35 37 39 41 43 45 47 49 114 116 118 120\n122 124 126 51 53 55 57 59 61 63 65 67 69 71 128 130 132\n134 136 73 75 77 79 81 83 85 87 89 91 93 95 97 138 140\n142 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 144\n129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161..." }, { "input": "19", "output": "2 4 6 8 10 12 14 16 18 1 20 22 24 26 28 30 32 34 36\n38 40 42 44 46 48 50 52 3 5 7 54 56 58 60 62 64 66 68\n70 72 74 76 78 80 82 9 11 13 15 17 84 86 88 90 92 94 96\n98 100 102 104 106 108 19 21 23 25 27 29 31 110 112 114 116 118 120\n122 124 126 128 130 33 35 37 39 41 43 45 47 49 132 134 136 138 140\n142 144 146 148 51 53 55 57 59 61 63 65 67 69 71 150 152 154 156\n158 160 162 73 75 77 79 81 83 85 87 89 91 93 95 97 164 166 168\n170 172 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 174 176\n178..." }, { "input": "21", "output": "2 4 6 8 10 12 14 16 18 20 1 22 24 26 28 30 32 34 36 38 40\n42 44 46 48 50 52 54 56 58 3 5 7 60 62 64 66 68 70 72 74 76\n78 80 82 84 86 88 90 92 9 11 13 15 17 94 96 98 100 102 104 106 108\n110 112 114 116 118 120 122 19 21 23 25 27 29 31 124 126 128 130 132 134 136\n138 140 142 144 146 148 33 35 37 39 41 43 45 47 49 150 152 154 156 158 160\n162 164 166 168 170 51 53 55 57 59 61 63 65 67 69 71 172 174 176 178 180\n182 184 186 188 73 75 77 79 81 83 85 87 89 91 93 95 97 190 192 194 196\n198 200 202 99 101 103 ..." }, { "input": "23", "output": "2 4 6 8 10 12 14 16 18 20 22 1 24 26 28 30 32 34 36 38 40 42 44\n46 48 50 52 54 56 58 60 62 64 3 5 7 66 68 70 72 74 76 78 80 82 84\n86 88 90 92 94 96 98 100 102 9 11 13 15 17 104 106 108 110 112 114 116 118 120\n122 124 126 128 130 132 134 136 19 21 23 25 27 29 31 138 140 142 144 146 148 150 152\n154 156 158 160 162 164 166 33 35 37 39 41 43 45 47 49 168 170 172 174 176 178 180\n182 184 186 188 190 192 51 53 55 57 59 61 63 65 67 69 71 194 196 198 200 202 204\n206 208 210 212 214 73 75 77 79 81 83 85 87 89 ..." }, { "input": "25", "output": "2 4 6 8 10 12 14 16 18 20 22 24 1 26 28 30 32 34 36 38 40 42 44 46 48\n50 52 54 56 58 60 62 64 66 68 70 3 5 7 72 74 76 78 80 82 84 86 88 90 92\n94 96 98 100 102 104 106 108 110 112 9 11 13 15 17 114 116 118 120 122 124 126 128 130 132\n134 136 138 140 142 144 146 148 150 19 21 23 25 27 29 31 152 154 156 158 160 162 164 166 168\n170 172 174 176 178 180 182 184 33 35 37 39 41 43 45 47 49 186 188 190 192 194 196 198 200\n202 204 206 208 210 212 214 51 53 55 57 59 61 63 65 67 69 71 216 218 220 222 224 226 228\n..." }, { "input": "27", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 1 28 30 32 34 36 38 40 42 44 46 48 50 52\n54 56 58 60 62 64 66 68 70 72 74 76 3 5 7 78 80 82 84 86 88 90 92 94 96 98 100\n102 104 106 108 110 112 114 116 118 120 122 9 11 13 15 17 124 126 128 130 132 134 136 138 140 142 144\n146 148 150 152 154 156 158 160 162 164 19 21 23 25 27 29 31 166 168 170 172 174 176 178 180 182 184\n186 188 190 192 194 196 198 200 202 33 35 37 39 41 43 45 47 49 204 206 208 210 212 214 216 218 220\n222 224 226 228 230 232 234 236 51 53 55 57 59 61..." }, { "input": "29", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 1 30 32 34 36 38 40 42 44 46 48 50 52 54 56\n58 60 62 64 66 68 70 72 74 76 78 80 82 3 5 7 84 86 88 90 92 94 96 98 100 102 104 106 108\n110 112 114 116 118 120 122 124 126 128 130 132 9 11 13 15 17 134 136 138 140 142 144 146 148 150 152 154 156\n158 160 162 164 166 168 170 172 174 176 178 19 21 23 25 27 29 31 180 182 184 186 188 190 192 194 196 198 200\n202 204 206 208 210 212 214 216 218 220 33 35 37 39 41 43 45 47 49 222 224 226 228 230 232 234 236 238 240\n242 244 2..." }, { "input": "31", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 1 32 34 36 38 40 42 44 46 48 50 52 54 56 58 60\n62 64 66 68 70 72 74 76 78 80 82 84 86 88 3 5 7 90 92 94 96 98 100 102 104 106 108 110 112 114 116\n118 120 122 124 126 128 130 132 134 136 138 140 142 9 11 13 15 17 144 146 148 150 152 154 156 158 160 162 164 166 168\n170 172 174 176 178 180 182 184 186 188 190 192 19 21 23 25 27 29 31 194 196 198 200 202 204 206 208 210 212 214 216\n218 220 222 224 226 228 230 232 234 236 238 33 35 37 39 41 43 45 47 49 240 242 244 24..." }, { "input": "33", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 1 34 36 38 40 42 44 46 48 50 52 54 56 58 60 62 64\n66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 3 5 7 96 98 100 102 104 106 108 110 112 114 116 118 120 122 124\n126 128 130 132 134 136 138 140 142 144 146 148 150 152 9 11 13 15 17 154 156 158 160 162 164 166 168 170 172 174 176 178 180\n182 184 186 188 190 192 194 196 198 200 202 204 206 19 21 23 25 27 29 31 208 210 212 214 216 218 220 222 224 226 228 230 232\n234 236 238 240 242 244 246 248 250 252 254 256 33 35..." }, { "input": "35", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 1 36 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68\n70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 100 3 5 7 102 104 106 108 110 112 114 116 118 120 122 124 126 128 130 132\n134 136 138 140 142 144 146 148 150 152 154 156 158 160 162 9 11 13 15 17 164 166 168 170 172 174 176 178 180 182 184 186 188 190 192\n194 196 198 200 202 204 206 208 210 212 214 216 218 220 19 21 23 25 27 29 31 222 224 226 228 230 232 234 236 238 240 242 244 246 248\n250 252 254 256 258 2..." }, { "input": "37", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 1 38 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72\n74 76 78 80 82 84 86 88 90 92 94 96 98 100 102 104 106 3 5 7 108 110 112 114 116 118 120 122 124 126 128 130 132 134 136 138 140\n142 144 146 148 150 152 154 156 158 160 162 164 166 168 170 172 9 11 13 15 17 174 176 178 180 182 184 186 188 190 192 194 196 198 200 202 204\n206 208 210 212 214 216 218 220 222 224 226 228 230 232 234 19 21 23 25 27 29 31 236 238 240 242 244 246 248 250 252 254 256 258 26..." }, { "input": "39", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 1 40 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76\n78 80 82 84 86 88 90 92 94 96 98 100 102 104 106 108 110 112 3 5 7 114 116 118 120 122 124 126 128 130 132 134 136 138 140 142 144 146 148\n150 152 154 156 158 160 162 164 166 168 170 172 174 176 178 180 182 9 11 13 15 17 184 186 188 190 192 194 196 198 200 202 204 206 208 210 212 214 216\n218 220 222 224 226 228 230 232 234 236 238 240 242 244 246 248 19 21 23 25 27 29 31 250 252 254 256 258 26..." }, { "input": "41", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 1 42 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80\n82 84 86 88 90 92 94 96 98 100 102 104 106 108 110 112 114 116 118 3 5 7 120 122 124 126 128 130 132 134 136 138 140 142 144 146 148 150 152 154 156\n158 160 162 164 166 168 170 172 174 176 178 180 182 184 186 188 190 192 9 11 13 15 17 194 196 198 200 202 204 206 208 210 212 214 216 218 220 222 224 226 228\n230 232 234 236 238 240 242 244 246 248 250 252 254 256 258 260 262 19 21 23 25 27 ..." }, { "input": "43", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 1 44 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84\n86 88 90 92 94 96 98 100 102 104 106 108 110 112 114 116 118 120 122 124 3 5 7 126 128 130 132 134 136 138 140 142 144 146 148 150 152 154 156 158 160 162 164\n166 168 170 172 174 176 178 180 182 184 186 188 190 192 194 196 198 200 202 9 11 13 15 17 204 206 208 210 212 214 216 218 220 222 224 226 228 230 232 234 236 238 240\n242 244 246 248 250 252 254 256 258 260 262 264 266 268 270..." }, { "input": "45", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 1 46 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88\n90 92 94 96 98 100 102 104 106 108 110 112 114 116 118 120 122 124 126 128 130 3 5 7 132 134 136 138 140 142 144 146 148 150 152 154 156 158 160 162 164 166 168 170 172\n174 176 178 180 182 184 186 188 190 192 194 196 198 200 202 204 206 208 210 212 9 11 13 15 17 214 216 218 220 222 224 226 228 230 232 234 236 238 240 242 244 246 248 250 252\n254 256 258 260 262 264 266 268 270..." }, { "input": "47", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 1 48 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92\n94 96 98 100 102 104 106 108 110 112 114 116 118 120 122 124 126 128 130 132 134 136 3 5 7 138 140 142 144 146 148 150 152 154 156 158 160 162 164 166 168 170 172 174 176 178 180\n182 184 186 188 190 192 194 196 198 200 202 204 206 208 210 212 214 216 218 220 222 9 11 13 15 17 224 226 228 230 232 234 236 238 240 242 244 246 248 250 252 254 256 258 260 262 264\n266 268 270..." }, { "input": "49", "output": "2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 36 38 40 42 44 46 48 1 50 52 54 56 58 60 62 64 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96\n98 100 102 104 106 108 110 112 114 116 118 120 122 124 126 128 130 132 134 136 138 140 142 3 5 7 144 146 148 150 152 154 156 158 160 162 164 166 168 170 172 174 176 178 180 182 184 186 188\n190 192 194 196 198 200 202 204 206 208 210 212 214 216 218 220 222 224 226 228 230 232 9 11 13 15 17 234 236 238 240 242 244 246 248 250 252 254 256 258 260 262 264 266 268 270 ..." } ]
1,639,314,934
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
30
0
n = int(input()) o = 1 e = 2 for i in range(n): for j in range(n): if (i+j) % 2 == 1 or (i == j == n//2): print(o, end=" ") o += 2 else: print(e, end=" ") e += 2 print()
Title: Magic Odd Square Time Limit: None seconds Memory Limit: None megabytes Problem Description: Find an *n*<=×<=*n* matrix with different numbers from 1 to *n*2, so the sum in each row, column and both main diagonals are odd. Input Specification: The only line contains odd integer *n* (1<=≤<=*n*<=≤<=49). Output Specification: Print *n* lines with *n* integers. All the integers should be different and from 1 to *n*2. The sum in each row, column and both main diagonals should be odd. Demo Input: ['1\n', '3\n'] Demo Output: ['1\n', '2 1 4\n3 5 7\n6 9 8\n'] Note: none
```python n = int(input()) o = 1 e = 2 for i in range(n): for j in range(n): if (i+j) % 2 == 1 or (i == j == n//2): print(o, end=" ") o += 2 else: print(e, end=" ") e += 2 print() ```
0
664
A
Complicated GCD
PROGRAMMING
800
[ "math", "number theory" ]
null
null
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm. Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
[ "1 2\n", "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n" ]
[ "1\n", "61803398874989484820458683436563811772030917980576\n" ]
none
500
[ { "input": "1 2", "output": "1" }, { "input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576", "output": "61803398874989484820458683436563811772030917980576" }, { "input": "1 100", "output": "1" }, { "input": "100 100000", "output": "1" }, { "input": "12345 67890123456789123457", "output": "1" }, { "input": "1 1", "output": "1" }, { "input": "2 2", "output": "2" }, { "input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158", "output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158" }, { "input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "1" }, { "input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751", "output": "1" }, { "input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794", "output": "1" }, { "input": "10000 1000000000", "output": "1" }, { "input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000", "output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000" }, { "input": "11210171722243 65715435710585778347", "output": "1" }, { "input": "2921881079263974825226940825843 767693191032295360887755303860323261471", "output": "1" }, { "input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085", "output": "1" }, { "input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424", "output": "1" }, { "input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614", "output": "1" }, { "input": "15943150466658398903 15943150466658398903", "output": "15943150466658398903" }, { "input": "410470228200245407491525399055972 410470228200245407491525399055972", "output": "410470228200245407491525399055972" }, { "input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307", "output": "51894705655711504622197349350106792045098781545973899451307" }, { "input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410", "output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410" }, { "input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535", "output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535" }, { "input": "1 2000000000", "output": "1" }, { "input": "13 1928834874", "output": "1" }, { "input": "87 2938984237482934238", "output": "1" }, { "input": "213 413", "output": "1" }, { "input": "3 4", "output": "1" } ]
1,680,425,382
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
4
1,000
9,728,000
a, b = list(map(int, input().split())) def GCD(a, b): if not b: return a return GCD(b, a % b) #distributiveProperty #if we have a set of integers S = {a1, a2, ..., an}, then: #GCD(S) = GCD(a1, GCD(a2, GCD(a3, ... GCD(an-1, an)...))) def distributiveProperty(a, b): if a == b: return a else: mid = (a + b) // 2 left_gcd = distributiveProperty(a, mid) right_gcd = distributiveProperty(mid + 1, b) return GCD(left_gcd, right_gcd) gcd = distributiveProperty(a, b) print(gcd )
Title: Complicated GCD Time Limit: None seconds Memory Limit: None megabytes Problem Description: Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm. Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type! Input Specification: The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100). Output Specification: Output one integer — greatest common divisor of all integers from *a* to *b* inclusive. Demo Input: ['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n'] Demo Output: ['1\n', '61803398874989484820458683436563811772030917980576\n'] Note: none
```python a, b = list(map(int, input().split())) def GCD(a, b): if not b: return a return GCD(b, a % b) #distributiveProperty #if we have a set of integers S = {a1, a2, ..., an}, then: #GCD(S) = GCD(a1, GCD(a2, GCD(a3, ... GCD(an-1, an)...))) def distributiveProperty(a, b): if a == b: return a else: mid = (a + b) // 2 left_gcd = distributiveProperty(a, mid) right_gcd = distributiveProperty(mid + 1, b) return GCD(left_gcd, right_gcd) gcd = distributiveProperty(a, b) print(gcd ) ```
0
4
A
Watermelon
PROGRAMMING
800
[ "brute force", "math" ]
A. Watermelon
1
64
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem. Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
[ "8\n" ]
[ "YES\n" ]
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
0
[ { "input": "8", "output": "YES" }, { "input": "5", "output": "NO" }, { "input": "4", "output": "YES" }, { "input": "3", "output": "NO" }, { "input": "2", "output": "NO" }, { "input": "1", "output": "NO" }, { "input": "7", "output": "NO" }, { "input": "6", "output": "YES" }, { "input": "10", "output": "YES" }, { "input": "9", "output": "NO" }, { "input": "53", "output": "NO" }, { "input": "77", "output": "NO" }, { "input": "32", "output": "YES" }, { "input": "44", "output": "YES" }, { "input": "98", "output": "YES" }, { "input": "99", "output": "NO" }, { "input": "90", "output": "YES" }, { "input": "67", "output": "NO" }, { "input": "100", "output": "YES" }, { "input": "88", "output": "YES" } ]
1,687,317,201
2,147,483,647
Python 3
OK
TESTS
20
92
0
n = int(input()) if n == 1 or n == 2: print("NO") else: if n%2 != 0: print("NO") else: print("YES")
Title: Watermelon Time Limit: 1 seconds Memory Limit: 64 megabytes Problem Description: One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem. Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. Input Specification: The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. Output Specification: Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. Demo Input: ['8\n'] Demo Output: ['YES\n'] Note: For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
```python n = int(input()) if n == 1 or n == 2: print("NO") else: if n%2 != 0: print("NO") else: print("YES") ```
3.954
405
A
Gravity Flip
PROGRAMMING
900
[ "greedy", "implementation", "sortings" ]
null
null
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
[ "4\n3 2 1 2\n", "3\n2 3 8\n" ]
[ "1 2 2 3 \n", "2 3 8 \n" ]
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.
500
[ { "input": "4\n3 2 1 2", "output": "1 2 2 3 " }, { "input": "3\n2 3 8", "output": "2 3 8 " }, { "input": "5\n2 1 2 1 2", "output": "1 1 2 2 2 " }, { "input": "1\n1", "output": "1 " }, { "input": "2\n4 3", "output": "3 4 " }, { "input": "6\n100 40 60 20 1 80", "output": "1 20 40 60 80 100 " }, { "input": "10\n10 8 6 7 5 3 4 2 9 1", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "10\n1 2 3 4 5 6 7 8 9 10", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "100\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91", "output": "3 3 3 4 7 8 8 8 9 9 10 12 12 13 14 14 15 15 16 17 17 20 21 21 22 22 23 25 29 31 36 37 37 38 39 40 41 41 41 42 43 44 45 46 46 47 47 49 49 49 51 52 52 53 54 55 59 59 59 60 62 63 63 64 66 69 70 71 71 72 74 76 76 77 77 78 78 79 80 81 81 82 82 84 85 86 87 87 87 89 91 92 92 92 92 97 98 99 100 100 " }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 " }, { "input": "10\n1 9 7 6 2 4 7 8 1 3", "output": "1 1 2 3 4 6 7 7 8 9 " }, { "input": "20\n53 32 64 20 41 97 50 20 66 68 22 60 74 61 97 54 80 30 72 59", "output": "20 20 22 30 32 41 50 53 54 59 60 61 64 66 68 72 74 80 97 97 " }, { "input": "30\n7 17 4 18 16 12 14 10 1 13 2 16 13 17 8 16 13 14 9 17 17 5 13 5 1 7 6 20 18 12", "output": "1 1 2 4 5 5 6 7 7 8 9 10 12 12 13 13 13 13 14 14 16 16 16 17 17 17 17 18 18 20 " }, { "input": "40\n22 58 68 58 48 53 52 1 16 78 75 17 63 15 36 32 78 75 49 14 42 46 66 54 49 82 40 43 46 55 12 73 5 45 61 60 1 11 31 84", "output": "1 1 5 11 12 14 15 16 17 22 31 32 36 40 42 43 45 46 46 48 49 49 52 53 54 55 58 58 60 61 63 66 68 73 75 75 78 78 82 84 " }, { "input": "70\n1 3 3 1 3 3 1 1 1 3 3 2 3 3 1 1 1 2 3 1 3 2 3 3 3 2 2 3 1 3 3 2 1 1 2 1 2 1 2 2 1 1 1 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3 3 3 1 1 3 3 1 1 1 1 3 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "90\n17 75 51 30 100 5 50 95 51 73 66 5 7 76 43 49 23 55 3 24 95 79 10 11 44 93 17 99 53 66 82 66 63 76 19 4 51 71 75 43 27 5 24 19 48 7 91 15 55 21 7 6 27 10 2 91 64 58 18 21 16 71 90 88 21 20 6 6 95 85 11 7 40 65 52 49 92 98 46 88 17 48 85 96 77 46 100 34 67 52", "output": "2 3 4 5 5 5 6 6 6 7 7 7 7 10 10 11 11 15 16 17 17 17 18 19 19 20 21 21 21 23 24 24 27 27 30 34 40 43 43 44 46 46 48 48 49 49 50 51 51 51 52 52 53 55 55 58 63 64 65 66 66 66 67 71 71 73 75 75 76 76 77 79 82 85 85 88 88 90 91 91 92 93 95 95 95 96 98 99 100 100 " }, { "input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 " }, { "input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 " }, { "input": "100\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 " }, { "input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6", "output": "1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 " }, { "input": "100\n12 10 5 11 13 12 14 13 7 15 15 12 13 19 12 18 14 10 10 3 1 10 16 11 19 8 10 15 5 10 12 16 11 13 11 15 14 12 16 8 11 8 15 2 18 2 14 13 15 20 8 8 4 12 14 7 10 3 9 1 7 19 6 7 2 14 8 20 7 17 18 20 3 18 18 9 6 10 4 1 4 19 9 13 3 3 12 11 11 20 8 2 13 6 7 12 1 4 17 3", "output": "1 1 1 1 2 2 2 2 3 3 3 3 3 3 4 4 4 4 5 5 6 6 6 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17 18 18 18 18 18 19 19 19 19 20 20 20 20 " }, { "input": "100\n5 13 1 40 30 10 23 32 33 12 6 4 15 29 31 17 23 5 36 31 32 38 24 11 34 39 19 21 6 19 31 35 1 15 6 29 22 15 17 15 1 17 2 34 20 8 27 2 29 26 13 9 22 27 27 3 20 40 4 40 33 29 36 30 35 16 19 28 26 11 36 24 29 5 40 10 38 34 33 23 34 39 31 7 10 31 22 6 36 24 14 31 34 23 2 4 26 16 2 32", "output": "1 1 1 2 2 2 2 3 4 4 4 5 5 5 6 6 6 6 7 8 9 10 10 10 11 11 12 13 13 14 15 15 15 15 16 16 17 17 17 19 19 19 20 20 21 22 22 22 23 23 23 23 24 24 24 26 26 26 27 27 27 28 29 29 29 29 29 30 30 31 31 31 31 31 31 32 32 32 33 33 33 34 34 34 34 34 35 35 36 36 36 36 38 38 39 39 40 40 40 40 " }, { "input": "100\n72 44 34 74 9 60 26 37 55 77 74 69 28 66 54 55 8 36 57 31 31 48 32 66 40 70 77 43 64 28 37 10 21 58 51 32 60 28 51 52 28 35 7 33 1 68 38 70 57 71 8 20 42 57 59 4 58 10 17 47 22 48 16 3 76 67 32 37 64 47 33 41 75 69 2 76 39 9 27 75 20 21 52 25 71 21 11 29 38 10 3 1 45 55 63 36 27 7 59 41", "output": "1 1 2 3 3 4 7 7 8 8 9 9 10 10 10 11 16 17 20 20 21 21 21 22 25 26 27 27 28 28 28 28 29 31 31 32 32 32 33 33 34 35 36 36 37 37 37 38 38 39 40 41 41 42 43 44 45 47 47 48 48 51 51 52 52 54 55 55 55 57 57 57 58 58 59 59 60 60 63 64 64 66 66 67 68 69 69 70 70 71 71 72 74 74 75 75 76 76 77 77 " }, { "input": "100\n75 18 61 10 56 53 42 57 79 80 31 2 50 45 54 99 84 52 71 21 86 3 19 98 14 37 40 62 63 68 5 10 87 8 81 85 52 52 57 94 2 7 56 96 19 76 1 13 81 6 80 47 22 59 99 32 9 5 36 88 98 91 70 70 12 93 12 22 85 1 97 48 94 16 84 84 51 34 62 7 68 51 30 2 37 82 4 7 27 1 80 9 61 16 59 55 12 96 94 82", "output": "1 1 1 2 2 2 3 4 5 5 6 7 7 7 8 9 9 10 10 12 12 12 13 14 16 16 18 19 19 21 22 22 27 30 31 32 34 36 37 37 40 42 45 47 48 50 51 51 52 52 52 53 54 55 56 56 57 57 59 59 61 61 62 62 63 68 68 70 70 71 75 76 79 80 80 80 81 81 82 82 84 84 84 85 85 86 87 88 91 93 94 94 94 96 96 97 98 98 99 99 " }, { "input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 " }, { "input": "100\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50", "output": "50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 " }, { "input": "49\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 " }, { "input": "30\n1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88", "output": "1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88 " }, { "input": "100\n100 51 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 51 100 " }, { "input": "10\n100 90 80 70 60 50 40 30 20 10", "output": "10 20 30 40 50 60 70 80 90 100 " }, { "input": "1\n10", "output": "10 " } ]
1,694,437,571
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
15
0
n = int(input()) k = list(map(int,input().split())) def Swap(A,B,l): Temp = None Temp = l[A] l[A] = l[B] l[B] = Temp for i in range(n-1): while k[i] > k[i+1]: for j in range(n-1): if k[j] > k[j+1]: Swap(j,j+1,k) print(k)
Title: Gravity Flip Time Limit: None seconds Memory Limit: None megabytes Problem Description: Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity. There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange. Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch! Input Specification: The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column. Output Specification: Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch. Demo Input: ['4\n3 2 1 2\n', '3\n2 3 8\n'] Demo Output: ['1 2 2 3 \n', '2 3 8 \n'] Note: The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column. In the second example case the gravity switch does not change the heights of the columns.
```python n = int(input()) k = list(map(int,input().split())) def Swap(A,B,l): Temp = None Temp = l[A] l[A] = l[B] l[B] = Temp for i in range(n-1): while k[i] > k[i+1]: for j in range(n-1): if k[j] > k[j+1]: Swap(j,j+1,k) print(k) ```
0
960
A
Check the string
PROGRAMMING
1,200
[ "implementation" ]
null
null
A has a string consisting of some number of lowercase English letters 'a'. He gives it to his friend B who appends some number of letters 'b' to the end of this string. Since both A and B like the characters 'a' and 'b', they have made sure that at this point, at least one 'a' and one 'b' exist in the string. B now gives this string to C and he appends some number of letters 'c' to the end of the string. However, since C is a good friend of A and B, the number of letters 'c' he appends is equal to the number of 'a' or to the number of 'b' in the string. It is also possible that the number of letters 'c' equals both to the number of letters 'a' and to the number of letters 'b' at the same time. You have a string in your hands, and you want to check if it is possible to obtain the string in this way or not. If it is possible to obtain the string, print "YES", otherwise print "NO" (without the quotes).
The first and only line consists of a string $S$ ($ 1 \le |S| \le 5\,000 $). It is guaranteed that the string will only consist of the lowercase English letters 'a', 'b', 'c'.
Print "YES" or "NO", according to the condition.
[ "aaabccc\n", "bbacc\n", "aabc\n" ]
[ "YES\n", "NO\n", "YES\n" ]
Consider first example: the number of 'c' is equal to the number of 'a'. Consider second example: although the number of 'c' is equal to the number of the 'b', the order is not correct. Consider third example: the number of 'c' is equal to the number of 'b'.
500
[ { "input": "aaabccc", "output": "YES" }, { "input": "bbacc", "output": "NO" }, { "input": "aabc", "output": "YES" }, { "input": "aabbcc", "output": "YES" }, { "input": "aaacccbb", "output": "NO" }, { "input": "abc", "output": "YES" }, { "input": "acba", "output": "NO" }, { "input": "bbabbc", "output": "NO" }, { "input": "bbbabacca", "output": "NO" }, { "input": "aabcbcaca", "output": "NO" }, { "input": "aaaaabbbbbb", "output": "NO" }, { "input": "c", "output": "NO" }, { "input": "cc", "output": "NO" }, { "input": "bbb", "output": "NO" }, { "input": "bc", "output": "NO" }, { "input": "ccbcc", "output": "NO" }, { "input": "aaa", "output": "NO" }, { "input": "aaccaa", "output": "NO" }, { "input": "a", "output": "NO" }, { "input": "b", "output": "NO" }, { "input": "abca", "output": "NO" }, { "input": "aabbcccc", "output": "NO" }, { "input": "abac", "output": "NO" }, { "input": "abcc", "output": "NO" }, { "input": "abcb", "output": "NO" }, { "input": "aacc", "output": "NO" }, { "input": "aabbaacccc", "output": "NO" }, { "input": "aabb", "output": "NO" }, { "input": "ac", "output": "NO" }, { "input": "abbacc", "output": "NO" }, { "input": "abacc", "output": "NO" }, { "input": "ababc", "output": "NO" }, { "input": "aa", "output": "NO" }, { "input": "aabaccc", "output": "NO" }, { "input": "bbcc", "output": "NO" }, { "input": "aaabcbc", "output": "NO" }, { "input": "acbbc", "output": "NO" }, { "input": "babc", "output": "NO" }, { "input": "bbbcc", "output": "NO" }, { "input": "bbc", "output": "NO" }, { "input": "abababccc", "output": "NO" }, { "input": "ccbbaa", "output": "NO" } ]
1,529,572,788
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
16
78
0
s=input() x='a' ka,kb,kc=0,0,0 for c in s: if c=='a': if x=='a': ka+=1 else: print("NO") exit() else: if c=='b': if x=='b': kb+=1 else: if x=='a': kb=1 x='b' else: print("NO") exit() else: if c=='c': if x=='c': kc+=1 else: if x=='b': x='c' kc=1 else: print("NO") exit() else: print("NO") exit() if ka==0 or kb!=kc and ka!=kc: print("NO") else: print("YES")
Title: Check the string Time Limit: None seconds Memory Limit: None megabytes Problem Description: A has a string consisting of some number of lowercase English letters 'a'. He gives it to his friend B who appends some number of letters 'b' to the end of this string. Since both A and B like the characters 'a' and 'b', they have made sure that at this point, at least one 'a' and one 'b' exist in the string. B now gives this string to C and he appends some number of letters 'c' to the end of the string. However, since C is a good friend of A and B, the number of letters 'c' he appends is equal to the number of 'a' or to the number of 'b' in the string. It is also possible that the number of letters 'c' equals both to the number of letters 'a' and to the number of letters 'b' at the same time. You have a string in your hands, and you want to check if it is possible to obtain the string in this way or not. If it is possible to obtain the string, print "YES", otherwise print "NO" (without the quotes). Input Specification: The first and only line consists of a string $S$ ($ 1 \le |S| \le 5\,000 $). It is guaranteed that the string will only consist of the lowercase English letters 'a', 'b', 'c'. Output Specification: Print "YES" or "NO", according to the condition. Demo Input: ['aaabccc\n', 'bbacc\n', 'aabc\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: Consider first example: the number of 'c' is equal to the number of 'a'. Consider second example: although the number of 'c' is equal to the number of the 'b', the order is not correct. Consider third example: the number of 'c' is equal to the number of 'b'.
```python s=input() x='a' ka,kb,kc=0,0,0 for c in s: if c=='a': if x=='a': ka+=1 else: print("NO") exit() else: if c=='b': if x=='b': kb+=1 else: if x=='a': kb=1 x='b' else: print("NO") exit() else: if c=='c': if x=='c': kc+=1 else: if x=='b': x='c' kc=1 else: print("NO") exit() else: print("NO") exit() if ka==0 or kb!=kc and ka!=kc: print("NO") else: print("YES") ```
0
139
A
Petr and Book
PROGRAMMING
1,000
[ "implementation" ]
null
null
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages. Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week. Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book. The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
[ "100\n15 20 20 15 10 30 45\n", "2\n1 0 0 0 0 0 0\n" ]
[ "6\n", "1\n" ]
Note to the first sample: By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else). Note to the second sample: On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
500
[ { "input": "100\n15 20 20 15 10 30 45", "output": "6" }, { "input": "2\n1 0 0 0 0 0 0", "output": "1" }, { "input": "100\n100 200 100 200 300 400 500", "output": "1" }, { "input": "3\n1 1 1 1 1 1 1", "output": "3" }, { "input": "1\n1 1 1 1 1 1 1", "output": "1" }, { "input": "20\n5 3 7 2 1 6 4", "output": "6" }, { "input": "10\n5 1 1 1 1 1 5", "output": "6" }, { "input": "50\n10 1 10 1 10 1 10", "output": "1" }, { "input": "77\n11 11 11 11 11 11 10", "output": "1" }, { "input": "1\n1000 1000 1000 1000 1000 1000 1000", "output": "1" }, { "input": "1000\n100 100 100 100 100 100 100", "output": "3" }, { "input": "999\n10 20 10 20 30 20 10", "output": "3" }, { "input": "433\n109 58 77 10 39 125 15", "output": "7" }, { "input": "1\n0 0 0 0 0 0 1", "output": "7" }, { "input": "5\n1 0 1 0 1 0 1", "output": "1" }, { "input": "997\n1 1 0 0 1 0 1", "output": "1" }, { "input": "1000\n1 1 1 1 1 1 1", "output": "6" }, { "input": "1000\n1000 1000 1000 1000 1000 1000 1000", "output": "1" }, { "input": "1000\n1 0 0 0 0 0 0", "output": "1" }, { "input": "1000\n0 0 0 0 0 0 1", "output": "7" }, { "input": "1000\n1 0 0 1 0 0 1", "output": "1" }, { "input": "509\n105 23 98 0 7 0 155", "output": "2" }, { "input": "7\n1 1 1 1 1 1 1", "output": "7" }, { "input": "2\n1 1 0 0 0 0 0", "output": "2" }, { "input": "1\n0 0 0 0 0 1 0", "output": "6" }, { "input": "10\n0 0 0 0 0 0 1", "output": "7" }, { "input": "5\n0 0 0 0 0 6 0", "output": "6" }, { "input": "3\n0 1 0 0 0 0 0", "output": "2" }, { "input": "10\n0 0 0 0 0 0 10", "output": "7" }, { "input": "28\n1 2 3 4 5 6 7", "output": "7" }, { "input": "100\n5 5 5 5 5 5 5", "output": "6" }, { "input": "4\n1 0 0 0 0 0 1", "output": "7" }, { "input": "2\n0 0 0 0 0 0 1", "output": "7" }, { "input": "7\n0 0 0 0 0 0 7", "output": "7" }, { "input": "7\n2 1 1 1 1 1 0", "output": "6" }, { "input": "2\n0 0 1 1 0 0 0", "output": "4" }, { "input": "6\n1 1 1 1 1 1 0", "output": "6" }, { "input": "5\n1 1 1 0 0 1 1", "output": "7" }, { "input": "100\n10 20 30 10 10 10 10", "output": "7" }, { "input": "1\n0 0 0 1 0 0 0", "output": "4" }, { "input": "70\n10 10 10 10 10 10 10", "output": "7" }, { "input": "22\n1 2 3 4 5 6 10", "output": "7" }, { "input": "5\n0 0 0 1 0 0 0", "output": "4" }, { "input": "2\n0 0 0 1 0 0 0", "output": "4" }, { "input": "6\n1 0 0 0 0 0 2", "output": "7" }, { "input": "10\n1 2 2 1 2 1 1", "output": "7" }, { "input": "5\n0 0 0 0 0 0 10", "output": "7" }, { "input": "4\n0 1 1 0 0 0 0", "output": "3" }, { "input": "100\n0 0 0 0 0 1 0", "output": "6" } ]
1,673,711,340
2,147,483,647
Python 3
OK
TESTS
49
92
0
pages_count = int(input()) read_per_day = [int(x) for x in input().split()] i = 0 while True: pages_count -= read_per_day[i] if pages_count <= 0: break i += 1 if i > 6: i = 0 print(i + 1)
Title: Petr and Book Time Limit: None seconds Memory Limit: None megabytes Problem Description: One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages. Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week. Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book. Input Specification: The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book. The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero. Output Specification: Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday. Demo Input: ['100\n15 20 20 15 10 30 45\n', '2\n1 0 0 0 0 0 0\n'] Demo Output: ['6\n', '1\n'] Note: Note to the first sample: By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else). Note to the second sample: On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
```python pages_count = int(input()) read_per_day = [int(x) for x in input().split()] i = 0 while True: pages_count -= read_per_day[i] if pages_count <= 0: break i += 1 if i > 6: i = 0 print(i + 1) ```
3
819
A
Mister B and Boring Game
PROGRAMMING
2,200
[ "games", "greedy" ]
null
null
Sometimes Mister B has free evenings when he doesn't know what to do. Fortunately, Mister B found a new game, where the player can play against aliens. All characters in this game are lowercase English letters. There are two players: Mister B and his competitor. Initially the players have a string *s* consisting of the first *a* English letters in alphabetical order (for example, if *a*<==<=5, then *s* equals to "abcde"). The players take turns appending letters to string *s*. Mister B moves first. Mister B must append exactly *b* letters on each his move. He can arbitrary choose these letters. His opponent adds exactly *a* letters on each move. Mister B quickly understood that his opponent was just a computer that used a simple algorithm. The computer on each turn considers the suffix of string *s* of length *a* and generates a string *t* of length *a* such that all letters in the string *t* are distinct and don't appear in the considered suffix. From multiple variants of *t* lexicographically minimal is chosen (if *a*<==<=4 and the suffix is "bfdd", the computer chooses string *t* equal to "aceg"). After that the chosen string *t* is appended to the end of *s*. Mister B soon found the game boring and came up with the following question: what can be the minimum possible number of different letters in string *s* on the segment between positions *l* and *r*, inclusive. Letters of string *s* are numerated starting from 1.
First and only line contains four space-separated integers: *a*, *b*, *l* and *r* (1<=≤<=*a*,<=*b*<=≤<=12, 1<=≤<=*l*<=≤<=*r*<=≤<=109) — the numbers of letters each player appends and the bounds of the segment.
Print one integer — the minimum possible number of different letters in the segment from position *l* to position *r*, inclusive, in string *s*.
[ "1 1 1 8\n", "4 2 2 6\n", "3 7 4 6\n" ]
[ "2", "3", "1" ]
In the first sample test one of optimal strategies generate string *s* = "abababab...", that's why answer is 2. In the second sample test string *s* = "abcdbcaefg..." can be obtained, chosen segment will look like "bcdbc", that's why answer is 3. In the third sample test string *s* = "abczzzacad..." can be obtained, chosen, segment will look like "zzz", that's why answer is 1.
500
[ { "input": "1 1 1 8", "output": "2" }, { "input": "4 2 2 6", "output": "3" }, { "input": "3 7 4 6", "output": "1" }, { "input": "4 5 1 1", "output": "1" }, { "input": "12 12 1 1000", "output": "13" }, { "input": "12 1 1000 1000", "output": "1" }, { "input": "3 4 701 703", "output": "3" }, { "input": "12 12 13 1000000000", "output": "13" }, { "input": "3 4 999999999 1000000000", "output": "1" }, { "input": "5 6 1000000000 1000000000", "output": "1" }, { "input": "1 1 1 1", "output": "1" }, { "input": "12 1 100000011 100000024", "output": "13" }, { "input": "10 12 220000011 220000032", "output": "11" }, { "input": "1 1 1 1000000000", "output": "2" }, { "input": "1 1 999999999 1000000000", "output": "1" }, { "input": "1 1 1000000000 1000000000", "output": "1" }, { "input": "12 12 1 24", "output": "12" }, { "input": "12 12 876543210 1000000000", "output": "13" }, { "input": "5 11 654321106 654321117", "output": "4" }, { "input": "5 11 654321117 654321140", "output": "6" }, { "input": "9 12 654321114 654321128", "output": "4" }, { "input": "5 12 654321101 654321140", "output": "6" }, { "input": "2 12 654321104 654321122", "output": "3" }, { "input": "6 1 654321100 654321115", "output": "11" }, { "input": "2 1 654321122 654321129", "output": "3" }, { "input": "6 2 654321100 654321140", "output": "10" }, { "input": "6 2 654321113 654321123", "output": "7" }, { "input": "1 7 654321103 654321105", "output": "2" }, { "input": "5 3 654321111 654321117", "output": "6" }, { "input": "1 3 654321122 654321140", "output": "2" }, { "input": "5 8 654321118 654321137", "output": "6" }, { "input": "5 8 654321103 654321106", "output": "1" }, { "input": "9 8 654321109 654321126", "output": "10" }, { "input": "2 2 987654333 987654335", "output": "2" }, { "input": "4 8 987654341 987654343", "output": "1" }, { "input": "3 12 987654345 987654347", "output": "3" }, { "input": "8 1 987654349 987654354", "output": "6" }, { "input": "6 8 987654322 987654327", "output": "3" }, { "input": "6 10 987654330 987654337", "output": "2" }, { "input": "11 4 987654330 987654343", "output": "12" }, { "input": "10 7 987654339 987654340", "output": "2" }, { "input": "12 12 987654321 987654328", "output": "4" }, { "input": "3 10 498103029 647879228", "output": "4" }, { "input": "11 3 378541409 796916287", "output": "19" }, { "input": "3 3 240953737 404170887", "output": "4" }, { "input": "3 8 280057261 834734290", "output": "4" }, { "input": "7 8 305686738 573739036", "output": "8" }, { "input": "3 8 36348920 167519590", "output": "4" }, { "input": "10 2 1 1000000000", "output": "18" }, { "input": "4 1 1 100000", "output": "7" }, { "input": "2 1 288 300", "output": "3" }, { "input": "5 1 1 100", "output": "9" }, { "input": "3 3 3 8", "output": "3" }, { "input": "5 1 1 100000", "output": "9" }, { "input": "5 1 1 1000", "output": "9" }, { "input": "6 1 1 10000", "output": "11" }, { "input": "12 1 1 100", "output": "23" }, { "input": "2 1 1 1000000", "output": "3" }, { "input": "10 1 100 1000000000", "output": "19" }, { "input": "2 2 7 12", "output": "3" }, { "input": "12 1 1 1000", "output": "23" }, { "input": "4 1 1 9", "output": "7" }, { "input": "5 2 5 1000", "output": "8" }, { "input": "3 1 4 10", "output": "4" }, { "input": "12 1 1 1000000", "output": "23" }, { "input": "10 5 1 1000000000", "output": "15" }, { "input": "10 10 1999 3998", "output": "11" }, { "input": "3 1 1 1000", "output": "5" }, { "input": "10 1 1 21", "output": "19" }, { "input": "5 3 15 18", "output": "3" }, { "input": "4 4 2 10", "output": "4" } ]
1,500,060,068
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
31
4,608,000
cv0v1al = input().split() c = int(cv0v1al[0]) v0 = int(cv0v1al[1]) v1 = int(cv0v1al[2]) a = int(cv0v1al[3]) l = int(cv0v1al[4]) c_now = 0 days = 0 if v0 == 0 and a == 0: print(0) elif v0 == 0 and v1 == 0: print(0) elif v0 == 0 and a > v1: print(0) else: while c_now < c: if days == 0 and c_now == 0: c_now += v0 days += 1 else: if v0 + a <= v1: v0 += a else: v0 = v1 if v0 - l == 0 and a == 0 and l > 0: days = 0 break c_now += v0 - l days += 1 print(days) """ c,v0,v1,a,l = map(int,input().split()) cnt = 0 ans = 0 v = v0 while(cnt < c): cnt += v if(ans != 0): cnt -= l if(v + a < v1): v += a else: v = v1 ans += 1 print(ans) """
Title: Mister B and Boring Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sometimes Mister B has free evenings when he doesn't know what to do. Fortunately, Mister B found a new game, where the player can play against aliens. All characters in this game are lowercase English letters. There are two players: Mister B and his competitor. Initially the players have a string *s* consisting of the first *a* English letters in alphabetical order (for example, if *a*<==<=5, then *s* equals to "abcde"). The players take turns appending letters to string *s*. Mister B moves first. Mister B must append exactly *b* letters on each his move. He can arbitrary choose these letters. His opponent adds exactly *a* letters on each move. Mister B quickly understood that his opponent was just a computer that used a simple algorithm. The computer on each turn considers the suffix of string *s* of length *a* and generates a string *t* of length *a* such that all letters in the string *t* are distinct and don't appear in the considered suffix. From multiple variants of *t* lexicographically minimal is chosen (if *a*<==<=4 and the suffix is "bfdd", the computer chooses string *t* equal to "aceg"). After that the chosen string *t* is appended to the end of *s*. Mister B soon found the game boring and came up with the following question: what can be the minimum possible number of different letters in string *s* on the segment between positions *l* and *r*, inclusive. Letters of string *s* are numerated starting from 1. Input Specification: First and only line contains four space-separated integers: *a*, *b*, *l* and *r* (1<=≤<=*a*,<=*b*<=≤<=12, 1<=≤<=*l*<=≤<=*r*<=≤<=109) — the numbers of letters each player appends and the bounds of the segment. Output Specification: Print one integer — the minimum possible number of different letters in the segment from position *l* to position *r*, inclusive, in string *s*. Demo Input: ['1 1 1 8\n', '4 2 2 6\n', '3 7 4 6\n'] Demo Output: ['2', '3', '1'] Note: In the first sample test one of optimal strategies generate string *s* = "abababab...", that's why answer is 2. In the second sample test string *s* = "abcdbcaefg..." can be obtained, chosen segment will look like "bcdbc", that's why answer is 3. In the third sample test string *s* = "abczzzacad..." can be obtained, chosen, segment will look like "zzz", that's why answer is 1.
```python cv0v1al = input().split() c = int(cv0v1al[0]) v0 = int(cv0v1al[1]) v1 = int(cv0v1al[2]) a = int(cv0v1al[3]) l = int(cv0v1al[4]) c_now = 0 days = 0 if v0 == 0 and a == 0: print(0) elif v0 == 0 and v1 == 0: print(0) elif v0 == 0 and a > v1: print(0) else: while c_now < c: if days == 0 and c_now == 0: c_now += v0 days += 1 else: if v0 + a <= v1: v0 += a else: v0 = v1 if v0 - l == 0 and a == 0 and l > 0: days = 0 break c_now += v0 - l days += 1 print(days) """ c,v0,v1,a,l = map(int,input().split()) cnt = 0 ans = 0 v = v0 while(cnt < c): cnt += v if(ans != 0): cnt -= l if(v + a < v1): v += a else: v = v1 ans += 1 print(ans) """ ```
-1
172
B
Pseudorandom Sequence Period
PROGRAMMING
1,200
[ "*special", "implementation", "number theory" ]
null
null
Polycarpus has recently got interested in sequences of pseudorandom numbers. He learned that many programming languages generate such sequences in a similar way: (for *i*<=≥<=1). Here *a*, *b*, *m* are constants, fixed for the given realization of the pseudorandom numbers generator, *r*0 is the so-called *randseed* (this value can be set from the program using functions like RandSeed(r) or srand(n)), and denotes the operation of taking the remainder of division. For example, if *a*<==<=2,<=*b*<==<=6,<=*m*<==<=12,<=*r*0<==<=11, the generated sequence will be: 4,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=.... Polycarpus realized that any such sequence will sooner or later form a cycle, but the cycle may occur not in the beginning, so there exist a preperiod and a period. The example above shows a preperiod equal to 1 and a period equal to 2. Your task is to find the period of a sequence defined by the given values of *a*,<=*b*,<=*m* and *r*0. Formally, you have to find such minimum positive integer *t*, for which exists such positive integer *k*, that for any *i*<=≥<=*k*: *r**i*<==<=*r**i*<=+<=*t*.
The single line of the input contains four integers *a*, *b*, *m* and *r*0 (1<=≤<=*m*<=≤<=105,<=0<=≤<=*a*,<=*b*<=≤<=1000,<=0<=≤<=*r*0<=&lt;<=*m*), separated by single spaces.
Print a single integer — the period of the sequence.
[ "2 6 12 11\n", "2 3 5 1\n", "3 6 81 9\n" ]
[ "2\n", "4\n", "1\n" ]
The first sample is described above. In the second sample the sequence is (starting from the first element): 0, 3, 4, 1, 0, 3, 4, 1, 0, ... In the third sample the sequence is (starting from the first element): 33, 24, 78, 78, 78, 78, ...
1,000
[ { "input": "2 6 12 11", "output": "2" }, { "input": "2 3 5 1", "output": "4" }, { "input": "3 6 81 9", "output": "1" }, { "input": "10 11 12 3", "output": "3" }, { "input": "4 4 5 4", "output": "2" }, { "input": "0 1 6 5", "output": "1" }, { "input": "1 0 7 3", "output": "1" }, { "input": "25 154 200 68", "output": "4" }, { "input": "0 0 1 0", "output": "1" }, { "input": "1 1 100000 0", "output": "100000" }, { "input": "73 778 36193 20163", "output": "1064" }, { "input": "65 101 43738 16242", "output": "3450" }, { "input": "177 329 83469 5951", "output": "9274" }, { "input": "452 53 51476 50033", "output": "3024" }, { "input": "900 209 34129 21607", "output": "4266" }, { "input": "137 936 79151 3907", "output": "79150" }, { "input": "687 509 56521 48466", "output": "3409" }, { "input": "977 461 14937 9343", "output": "2292" }, { "input": "545 541 43487 31725", "output": "43486" }, { "input": "550 5 88379 9433", "output": "44189" }, { "input": "173 105 24791 23343", "output": "5718" }, { "input": "239 695 50503 18287", "output": "25251" }, { "input": "397 24 21491 18004", "output": "21490" }, { "input": "887 265 55829 22027", "output": "55828" }, { "input": "821 163 39195 20770", "output": "660" }, { "input": "491 3 64907 3847", "output": "115" }, { "input": "503 233 5683 3462", "output": "1894" }, { "input": "367 701 18523 11701", "output": "882" }, { "input": "349 673 81953 56773", "output": "81952" }, { "input": "619 37 37223 877", "output": "18611" }, { "input": "643 863 77551 25943", "output": "38775" }, { "input": "937 859 7333 2141", "output": "7332" }, { "input": "271 761 99991 75353", "output": "49995" }, { "input": "1 1 10000 0", "output": "10000" }, { "input": "0 0 16709 12233", "output": "1" }, { "input": "0 1 55305 6822", "output": "1" }, { "input": "1 0 54062 35990", "output": "1" }, { "input": "0 0 23896 0", "output": "1" }, { "input": "0 1 53172 0", "output": "1" }, { "input": "1 0 54652 0", "output": "1" }, { "input": "6 0 99991 1", "output": "99990" }, { "input": "101 0 100000 1", "output": "1000" }, { "input": "2 0 99989 1", "output": "99988" }, { "input": "2 0 54539 1", "output": "54538" }, { "input": "3 0 42953 1", "output": "42952" }, { "input": "7 0 67129 1", "output": "67128" }, { "input": "2 0 89261 1", "output": "89260" }, { "input": "11 0 35311 1", "output": "35310" }, { "input": "0 0 2 0", "output": "1" }, { "input": "1 0 2 0", "output": "1" }, { "input": "0 1 2 0", "output": "1" }, { "input": "1 1 2 0", "output": "2" }, { "input": "0 0 2 1", "output": "1" }, { "input": "1 0 2 1", "output": "1" }, { "input": "0 1 2 1", "output": "1" }, { "input": "1 1 2 1", "output": "2" } ]
1,368,086,701
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
9
2,000
0
a,b,m,r0=0,0,0,0 a,b,m,r0=map(int,input().split()) R=[] ri=0 i=1 R.append(r0) while 1: ri=(a*R[i-1]+b)%m if (ri) not in R: R.append(ri) i+=1 elif ri in R: break print (abs(i-R.index(ri)))
Title: Pseudorandom Sequence Period Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarpus has recently got interested in sequences of pseudorandom numbers. He learned that many programming languages generate such sequences in a similar way: (for *i*<=≥<=1). Here *a*, *b*, *m* are constants, fixed for the given realization of the pseudorandom numbers generator, *r*0 is the so-called *randseed* (this value can be set from the program using functions like RandSeed(r) or srand(n)), and denotes the operation of taking the remainder of division. For example, if *a*<==<=2,<=*b*<==<=6,<=*m*<==<=12,<=*r*0<==<=11, the generated sequence will be: 4,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=2,<=10,<=.... Polycarpus realized that any such sequence will sooner or later form a cycle, but the cycle may occur not in the beginning, so there exist a preperiod and a period. The example above shows a preperiod equal to 1 and a period equal to 2. Your task is to find the period of a sequence defined by the given values of *a*,<=*b*,<=*m* and *r*0. Formally, you have to find such minimum positive integer *t*, for which exists such positive integer *k*, that for any *i*<=≥<=*k*: *r**i*<==<=*r**i*<=+<=*t*. Input Specification: The single line of the input contains four integers *a*, *b*, *m* and *r*0 (1<=≤<=*m*<=≤<=105,<=0<=≤<=*a*,<=*b*<=≤<=1000,<=0<=≤<=*r*0<=&lt;<=*m*), separated by single spaces. Output Specification: Print a single integer — the period of the sequence. Demo Input: ['2 6 12 11\n', '2 3 5 1\n', '3 6 81 9\n'] Demo Output: ['2\n', '4\n', '1\n'] Note: The first sample is described above. In the second sample the sequence is (starting from the first element): 0, 3, 4, 1, 0, 3, 4, 1, 0, ... In the third sample the sequence is (starting from the first element): 33, 24, 78, 78, 78, 78, ...
```python a,b,m,r0=0,0,0,0 a,b,m,r0=map(int,input().split()) R=[] ri=0 i=1 R.append(r0) while 1: ri=(a*R[i-1]+b)%m if (ri) not in R: R.append(ri) i+=1 elif ri in R: break print (abs(i-R.index(ri))) ```
0
376
A
Lever
PROGRAMMING
900
[ "implementation", "math" ]
null
null
You have a description of a lever as string *s*. We'll represent the string length as record |*s*|, then the lever looks as a horizontal bar with weights of length |*s*|<=-<=1 with exactly one pivot. We will assume that the bar is a segment on the *Ox* axis between points 0 and |*s*|<=-<=1. The decoding of the lever description is given below. - If the *i*-th character of the string equals "^", that means that at coordinate *i* there is the pivot under the bar. - If the *i*-th character of the string equals "=", that means that at coordinate *i* there is nothing lying on the bar. - If the *i*-th character of the string equals digit *c* (1-9), that means that at coordinate *i* there is a weight of mass *c* on the bar. Your task is, given the lever description, print if it will be in balance or not. Assume that the bar doesn't weight anything. Assume that the bar initially is in balance then all weights are simultaneously put on it. After that the bar either tilts to the left, or tilts to the right, or is in balance.
The first line contains the lever description as a non-empty string *s* (3<=≤<=|*s*|<=≤<=106), consisting of digits (1-9) and characters "^" and "=". It is guaranteed that the line contains exactly one character "^". It is guaranteed that the pivot of the lever isn't located in any end of the lever bar. To solve the problem you may need 64-bit integer numbers. Please, do not forget to use them in your programs.
Print "left" if the given lever tilts to the left, "right" if it tilts to the right and "balance", if it is in balance.
[ "=^==\n", "9===^==1\n", "2==^7==\n", "41^52==\n" ]
[ "balance\n", "left\n", "right\n", "balance\n" ]
As you solve the problem, you may find the following link useful to better understand how a lever functions: http://en.wikipedia.org/wiki/Lever. The pictures to the examples:
500
[ { "input": "=^==", "output": "balance" }, { "input": "9===^==1", "output": "left" }, { "input": "2==^7==", "output": "right" }, { "input": "41^52==", "output": "balance" }, { "input": "=^2=4=1===1=", "output": "right" }, { "input": "9=6===5==3=9=1=1^7=1==", "output": "left" }, { "input": "85=61=36=^93===4==44==35==94===39===15===", "output": "right" }, { "input": "==88=^95==83=45===8====73===7==7====1=29====29=8=85=", "output": "right" }, { "input": "==41^52==", "output": "balance" }, { "input": "2===================^2", "output": "left" }, { "input": "9^=============1", "output": "right" }, { "input": "4=========^=55", "output": "left" }, { "input": "123^321", "output": "balance" }, { "input": "7^1=2", "output": "balance" }, { "input": "589==^==958", "output": "right" } ]
1,571,067,800
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
77
0
s= input() l=-1 r=-1 digl={} digr={} lever=0 for i in range(len(s)): if s[i].isdigit() and lever==0: l=i digl[i+1]=s[i] elif s[i].isdigit() and lever!=0: r=i digr[i+1]= s[i] elif s[i]=='^': lever=i tl=0 tr=0 for e in digl: tl+= (lever+1-int(digl[e]))*int(e) for e in digr: tr+=(int(digr[e])-lever-1)*int(e) if tl>tr: print('left') elif tl<tr: print('right') else: print('balanced')
Title: Lever Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have a description of a lever as string *s*. We'll represent the string length as record |*s*|, then the lever looks as a horizontal bar with weights of length |*s*|<=-<=1 with exactly one pivot. We will assume that the bar is a segment on the *Ox* axis between points 0 and |*s*|<=-<=1. The decoding of the lever description is given below. - If the *i*-th character of the string equals "^", that means that at coordinate *i* there is the pivot under the bar. - If the *i*-th character of the string equals "=", that means that at coordinate *i* there is nothing lying on the bar. - If the *i*-th character of the string equals digit *c* (1-9), that means that at coordinate *i* there is a weight of mass *c* on the bar. Your task is, given the lever description, print if it will be in balance or not. Assume that the bar doesn't weight anything. Assume that the bar initially is in balance then all weights are simultaneously put on it. After that the bar either tilts to the left, or tilts to the right, or is in balance. Input Specification: The first line contains the lever description as a non-empty string *s* (3<=≤<=|*s*|<=≤<=106), consisting of digits (1-9) and characters "^" and "=". It is guaranteed that the line contains exactly one character "^". It is guaranteed that the pivot of the lever isn't located in any end of the lever bar. To solve the problem you may need 64-bit integer numbers. Please, do not forget to use them in your programs. Output Specification: Print "left" if the given lever tilts to the left, "right" if it tilts to the right and "balance", if it is in balance. Demo Input: ['=^==\n', '9===^==1\n', '2==^7==\n', '41^52==\n'] Demo Output: ['balance\n', 'left\n', 'right\n', 'balance\n'] Note: As you solve the problem, you may find the following link useful to better understand how a lever functions: http://en.wikipedia.org/wiki/Lever. The pictures to the examples:
```python s= input() l=-1 r=-1 digl={} digr={} lever=0 for i in range(len(s)): if s[i].isdigit() and lever==0: l=i digl[i+1]=s[i] elif s[i].isdigit() and lever!=0: r=i digr[i+1]= s[i] elif s[i]=='^': lever=i tl=0 tr=0 for e in digl: tl+= (lever+1-int(digl[e]))*int(e) for e in digr: tr+=(int(digr[e])-lever-1)*int(e) if tl>tr: print('left') elif tl<tr: print('right') else: print('balanced') ```
0
402
E
Strictly Positive Matrix
PROGRAMMING
2,200
[ "graphs", "math" ]
null
null
You have matrix *a* of size *n*<=×<=*n*. Let's number the rows of the matrix from 1 to *n* from top to bottom, let's number the columns from 1 to *n* from left to right. Let's use *a**ij* to represent the element on the intersection of the *i*-th row and the *j*-th column. Matrix *a* meets the following two conditions: - for any numbers *i*,<=*j* (1<=≤<=*i*,<=*j*<=≤<=*n*) the following inequality holds: *a**ij*<=≥<=0; - . Matrix *b* is strictly positive, if for any numbers *i*,<=*j* (1<=≤<=*i*,<=*j*<=≤<=*n*) the inequality *b**ij*<=&gt;<=0 holds. You task is to determine if there is such integer *k*<=≥<=1, that matrix *a**k* is strictly positive.
The first line contains integer *n* (2<=≤<=*n*<=≤<=2000) — the number of rows and columns in matrix *a*. The next *n* lines contain the description of the rows of matrix *a*. The *i*-th line contains *n* non-negative integers *a**i*1,<=*a**i*2,<=...,<=*a**in* (0<=≤<=*a**ij*<=≤<=50). It is guaranteed that .
If there is a positive integer *k*<=≥<=1, such that matrix *a**k* is strictly positive, print "YES" (without the quotes). Otherwise, print "NO" (without the quotes).
[ "2\n1 0\n0 1\n", "5\n4 5 6 1 2\n1 2 3 4 5\n6 4 1 2 4\n1 1 1 1 1\n4 4 4 4 4\n" ]
[ "NO\n", "YES\n" ]
none
2,500
[ { "input": "2\n1 0\n0 1", "output": "NO" }, { "input": "5\n4 5 6 1 2\n1 2 3 4 5\n6 4 1 2 4\n1 1 1 1 1\n4 4 4 4 4", "output": "YES" }, { "input": "5\n1 1 0 0 0\n0 0 1 0 0\n0 0 0 1 0\n0 0 0 1 1\n0 0 0 0 1", "output": "NO" }, { "input": "5\n1 0 0 0 0\n1 1 0 0 0\n0 1 1 0 0\n0 0 1 1 0\n0 0 0 1 1", "output": "NO" }, { "input": "10\n1 0 1 1 0 1 1 1 0 1\n0 1 0 0 1 0 0 0 1 0\n1 0 1 1 0 1 1 1 0 1\n1 0 1 1 0 1 1 1 0 1\n0 1 0 0 1 0 0 0 1 0\n1 0 1 1 0 1 1 1 0 1\n1 0 1 1 0 1 1 1 0 1\n1 0 1 1 0 1 1 1 0 1\n0 1 0 0 1 0 0 0 1 0\n1 0 1 1 0 1 1 1 0 1", "output": "NO" }, { "input": "10\n0 0 0 0 0 0 0 0 1 0\n0 0 0 0 0 0 0 1 0 0\n0 0 0 1 0 0 0 0 0 0\n1 0 0 0 0 0 0 0 0 0\n0 0 0 0 1 0 1 0 0 0\n0 0 1 0 0 0 0 0 0 0\n0 0 0 0 0 1 0 0 0 0\n0 0 0 0 0 0 0 0 0 1\n0 1 0 0 0 0 0 0 0 0\n0 0 0 0 1 0 0 0 0 0", "output": "YES" }, { "input": "3\n1 1 0\n0 0 1\n1 0 0", "output": "YES" }, { "input": "10\n16 7 11 41 25 6 8 40 38 13\n0 0 37 22 0 34 5 43 38 34\n13 3 0 38 13 7 41 45 2 20\n50 41 12 22 24 43 38 3 0 0\n33 0 5 47 3 48 3 0 48 17\n28 2 43 43 20 6 12 13 47 28\n38 45 47 49 33 2 26 26 43 0\n39 0 11 39 15 31 5 5 39 22\n27 15 0 18 19 47 3 18 14 40\n20 32 33 25 43 10 0 0 15 43", "output": "YES" }, { "input": "9\n22 32 19 16 27 0 8 31 36\n49 2 13 16 7 38 36 45 48\n9 24 19 45 6 18 19 11 2\n3 23 48 7 13 42 16 44 33\n30 8 37 0 4 12 27 29 11\n9 1 7 2 11 15 21 15 40\n41 23 0 38 17 36 15 2 10\n13 37 39 18 26 20 41 48 17\n13 12 43 10 46 8 46 22 46", "output": "YES" }, { "input": "2\n33 50\n20 27", "output": "YES" }, { "input": "5\n0 1 0 0 0\n0 0 0 1 0\n1 0 0 0 0\n0 0 0 1 1\n0 0 1 0 0", "output": "YES" }, { "input": "2\n0 1\n1 1", "output": "YES" }, { "input": "5\n0 1 1 0 1\n1 1 1 0 0\n1 1 0 0 0\n0 0 0 1 1\n0 0 0 1 0", "output": "NO" }, { "input": "5\n0 1 1 0 0\n1 1 1 0 0\n1 1 0 0 0\n0 0 0 1 1\n1 0 0 1 0", "output": "NO" }, { "input": "10\n0 1 1 1 1 1 1 0 0 0\n1 0 1 1 1 1 1 0 0 0\n1 1 0 1 1 1 1 0 0 0\n1 1 1 0 1 1 1 0 0 0\n1 1 1 1 1 1 1 0 0 0\n1 1 1 1 1 0 1 0 0 0\n1 1 1 1 1 1 0 0 0 0\n0 0 0 0 0 0 0 1 1 1\n0 0 0 0 0 0 0 1 0 1\n0 1 0 0 0 0 0 1 1 0", "output": "NO" }, { "input": "5\n0 1 0 0 0\n1 0 0 0 0\n0 0 1 1 0\n0 0 0 1 1\n0 0 1 0 1", "output": "NO" }, { "input": "4\n1 1 0 0\n1 1 0 0\n0 0 1 1\n0 0 1 1", "output": "NO" }, { "input": "5\n0 1 0 0 0\n1 0 1 0 0\n0 0 1 1 0\n0 0 0 1 1\n0 0 1 0 1", "output": "NO" }, { "input": "3\n1 2 0\n0 0 3\n0 0 0", "output": "NO" }, { "input": "2\n1 1\n0 1", "output": "NO" }, { "input": "4\n1 1 0 0\n1 0 1 0\n0 0 0 1\n0 0 1 0", "output": "NO" }, { "input": "4\n1 1 1 1\n0 1 1 0\n0 1 1 0\n1 1 1 1", "output": "NO" }, { "input": "3\n1 1 0\n0 1 1\n0 0 1", "output": "NO" }, { "input": "4\n1 0 0 1\n0 1 1 0\n0 1 1 0\n1 0 0 1", "output": "NO" }, { "input": "4\n1 1 0 0\n1 1 0 0\n1 1 1 1\n1 1 1 1", "output": "NO" }, { "input": "5\n1 1 0 0 0\n1 0 1 0 0\n0 0 0 1 0\n0 0 0 0 1\n0 0 1 0 1", "output": "NO" }, { "input": "2\n1 1\n0 0", "output": "NO" }, { "input": "15\n1 1 0 0 0 0 0 0 0 0 0 0 0 0 0\n1 1 1 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 0 0 0 0 0 0 0 0 0 0 0\n0 0 1 1 1 0 0 0 0 0 0 0 0 0 0\n0 0 0 1 1 1 0 0 0 0 0 0 0 0 0\n0 0 0 0 1 1 1 0 0 0 0 0 0 0 0\n0 0 0 0 0 1 1 1 0 0 0 0 0 0 0\n0 0 0 0 0 0 1 1 1 0 0 0 0 0 0\n0 0 0 0 0 0 0 1 1 1 0 0 0 0 0\n0 0 0 0 0 0 0 0 1 1 1 0 0 0 0\n0 0 0 0 0 0 0 0 0 1 1 1 0 0 0\n0 0 0 0 0 0 0 0 0 0 1 1 1 0 0\n0 0 0 0 0 0 0 0 0 0 0 1 1 1 0\n0 0 0 0 0 0 0 0 0 0 0 0 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 1 1", "output": "YES" }, { "input": "4\n1 1 0 0\n1 0 0 0\n0 1 0 1\n0 0 1 0", "output": "NO" }, { "input": "6\n1 1 0 0 0 0\n0 1 1 0 0 0\n1 0 1 0 0 0\n0 0 0 1 1 0\n0 0 0 0 1 1\n0 0 0 1 0 1", "output": "NO" }, { "input": "3\n1 1 1\n0 0 0\n0 0 0", "output": "NO" } ]
1,689,429,811
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
30
0
print("_RANDOM_GUESS_1689429811.167354")# 1689429811.167374
Title: Strictly Positive Matrix Time Limit: None seconds Memory Limit: None megabytes Problem Description: You have matrix *a* of size *n*<=×<=*n*. Let's number the rows of the matrix from 1 to *n* from top to bottom, let's number the columns from 1 to *n* from left to right. Let's use *a**ij* to represent the element on the intersection of the *i*-th row and the *j*-th column. Matrix *a* meets the following two conditions: - for any numbers *i*,<=*j* (1<=≤<=*i*,<=*j*<=≤<=*n*) the following inequality holds: *a**ij*<=≥<=0; - . Matrix *b* is strictly positive, if for any numbers *i*,<=*j* (1<=≤<=*i*,<=*j*<=≤<=*n*) the inequality *b**ij*<=&gt;<=0 holds. You task is to determine if there is such integer *k*<=≥<=1, that matrix *a**k* is strictly positive. Input Specification: The first line contains integer *n* (2<=≤<=*n*<=≤<=2000) — the number of rows and columns in matrix *a*. The next *n* lines contain the description of the rows of matrix *a*. The *i*-th line contains *n* non-negative integers *a**i*1,<=*a**i*2,<=...,<=*a**in* (0<=≤<=*a**ij*<=≤<=50). It is guaranteed that . Output Specification: If there is a positive integer *k*<=≥<=1, such that matrix *a**k* is strictly positive, print "YES" (without the quotes). Otherwise, print "NO" (without the quotes). Demo Input: ['2\n1 0\n0 1\n', '5\n4 5 6 1 2\n1 2 3 4 5\n6 4 1 2 4\n1 1 1 1 1\n4 4 4 4 4\n'] Demo Output: ['NO\n', 'YES\n'] Note: none
```python print("_RANDOM_GUESS_1689429811.167354")# 1689429811.167374 ```
0
994
B
Knights of a Polygonal Table
PROGRAMMING
1,400
[ "greedy", "implementation", "sortings" ]
null
null
Unlike Knights of a Round Table, Knights of a Polygonal Table deprived of nobility and happy to kill each other. But each knight has some power and a knight can kill another knight if and only if his power is greater than the power of victim. However, even such a knight will torment his conscience, so he can kill no more than $k$ other knights. Also, each knight has some number of coins. After a kill, a knight can pick up all victim's coins. Now each knight ponders: how many coins he can have if only he kills other knights? You should answer this question for each knight.
The first line contains two integers $n$ and $k$ $(1 \le n \le 10^5, 0 \le k \le \min(n-1,10))$ — the number of knights and the number $k$ from the statement. The second line contains $n$ integers $p_1, p_2 ,\ldots,p_n$ $(1 \le p_i \le 10^9)$ — powers of the knights. All $p_i$ are distinct. The third line contains $n$ integers $c_1, c_2 ,\ldots,c_n$ $(0 \le c_i \le 10^9)$ — the number of coins each knight has.
Print $n$ integers — the maximum number of coins each knight can have it only he kills other knights.
[ "4 2\n4 5 9 7\n1 2 11 33\n", "5 1\n1 2 3 4 5\n1 2 3 4 5\n", "1 0\n2\n3\n" ]
[ "1 3 46 36 ", "1 3 5 7 9 ", "3 " ]
Consider the first example. - The first knight is the weakest, so he can't kill anyone. That leaves him with the only coin he initially has. - The second knight can kill the first knight and add his coin to his own two. - The third knight is the strongest, but he can't kill more than $k = 2$ other knights. It is optimal to kill the second and the fourth knights: $2+11+33 = 46$. - The fourth knight should kill the first and the second knights: $33+1+2 = 36$. In the second example the first knight can't kill anyone, while all the others should kill the one with the index less by one than their own. In the third example there is only one knight, so he can't kill anyone.
1,000
[ { "input": "4 2\n4 5 9 7\n1 2 11 33", "output": "1 3 46 36 " }, { "input": "5 1\n1 2 3 4 5\n1 2 3 4 5", "output": "1 3 5 7 9 " }, { "input": "1 0\n2\n3", "output": "3 " }, { "input": "7 1\n2 3 4 5 7 8 9\n0 3 7 9 5 8 9", "output": "0 3 10 16 14 17 18 " }, { "input": "7 2\n2 4 6 7 8 9 10\n10 8 4 8 4 5 9", "output": "10 18 22 26 22 23 27 " }, { "input": "11 10\n1 2 3 4 5 6 7 8 9 10 11\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000", "output": "1000000000 2000000000 3000000000 4000000000 5000000000 6000000000 7000000000 8000000000 9000000000 10000000000 11000000000 " }, { "input": "2 0\n2 3\n3 3", "output": "3 3 " }, { "input": "7 3\n1 2 3 4 5 6 7\n3 3 3 4 5 6 7", "output": "3 6 9 13 15 18 22 " }, { "input": "3 0\n3 2 1\n1 2 3", "output": "1 2 3 " }, { "input": "5 3\n4 5 7 9 11\n10 10 10 10 10", "output": "10 20 30 40 40 " }, { "input": "4 0\n4 5 9 7\n1 2 11 33", "output": "1 2 11 33 " }, { "input": "7 3\n1 2 3 4 5 6 7\n3 3 3 8 8 8 8", "output": "3 6 9 17 22 27 32 " }, { "input": "3 0\n1 2 3\n5 5 5", "output": "5 5 5 " }, { "input": "4 2\n4 5 9 7\n2 2 11 33", "output": "2 4 46 37 " }, { "input": "6 3\n1 2 3 4 5 6\n1 1 1 1 1 1", "output": "1 2 3 4 4 4 " }, { "input": "10 5\n1 2 3 4 5 6 7 8 9 10\n1 1 1 1 1 1 1 1 1 1", "output": "1 2 3 4 5 6 6 6 6 6 " }, { "input": "3 2\n1 2 3\n1 1 1", "output": "1 2 3 " }, { "input": "3 0\n1 2 3\n10 20 30", "output": "10 20 30 " }, { "input": "4 0\n4 5 9 7\n1 2 3 4", "output": "1 2 3 4 " }, { "input": "5 4\n1 2 3 4 5\n1 1 1 1 1", "output": "1 2 3 4 5 " }, { "input": "4 3\n1 2 3 4\n5 5 5 5", "output": "5 10 15 20 " }, { "input": "5 3\n1 2 3 4 5\n7 7 7 7 7", "output": "7 14 21 28 28 " } ]
1,529,204,154
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
7
1,000
18,739,200
import heapq N,K=map(int, input().split()) P=dict(zip(range(N),list(map(int, input().split())))) C=dict(zip(range(N),list(map(int, input().split())))) Ps = sorted(P.items(), key=lambda x:x[1], reverse=True) # Cs = sorted(C.items(), key=lambda x:x[1], reverse=True) # print(Ps) # print(Cs) ansDic = {} # rem = -1 for n in range(N): k=0 knightIdx = Ps[n][0] eachMaxCoin = C[knightIdx] selected = [] heapq.heapify(selected) for pn in range(n+1,N): p = Ps[pn] targIdx = p[0] if k < K: heapq.heappush(selected,C[targIdx]) k+=1 elif selected[0] < C[targIdx]: heapq.heappop(selected) heapq.heappush(selected,C[targIdx]) eachMaxCoin += sum(selected) # print( str(knightIdx) + ":" + str(eachMaxCoin) ) ansDic[knightIdx] = eachMaxCoin ans = "" for n in range(N): if 0<len(ans): ans += " " ans += str(ansDic[n]) print(ans)
Title: Knights of a Polygonal Table Time Limit: None seconds Memory Limit: None megabytes Problem Description: Unlike Knights of a Round Table, Knights of a Polygonal Table deprived of nobility and happy to kill each other. But each knight has some power and a knight can kill another knight if and only if his power is greater than the power of victim. However, even such a knight will torment his conscience, so he can kill no more than $k$ other knights. Also, each knight has some number of coins. After a kill, a knight can pick up all victim's coins. Now each knight ponders: how many coins he can have if only he kills other knights? You should answer this question for each knight. Input Specification: The first line contains two integers $n$ and $k$ $(1 \le n \le 10^5, 0 \le k \le \min(n-1,10))$ — the number of knights and the number $k$ from the statement. The second line contains $n$ integers $p_1, p_2 ,\ldots,p_n$ $(1 \le p_i \le 10^9)$ — powers of the knights. All $p_i$ are distinct. The third line contains $n$ integers $c_1, c_2 ,\ldots,c_n$ $(0 \le c_i \le 10^9)$ — the number of coins each knight has. Output Specification: Print $n$ integers — the maximum number of coins each knight can have it only he kills other knights. Demo Input: ['4 2\n4 5 9 7\n1 2 11 33\n', '5 1\n1 2 3 4 5\n1 2 3 4 5\n', '1 0\n2\n3\n'] Demo Output: ['1 3 46 36 ', '1 3 5 7 9 ', '3 '] Note: Consider the first example. - The first knight is the weakest, so he can't kill anyone. That leaves him with the only coin he initially has. - The second knight can kill the first knight and add his coin to his own two. - The third knight is the strongest, but he can't kill more than $k = 2$ other knights. It is optimal to kill the second and the fourth knights: $2+11+33 = 46$. - The fourth knight should kill the first and the second knights: $33+1+2 = 36$. In the second example the first knight can't kill anyone, while all the others should kill the one with the index less by one than their own. In the third example there is only one knight, so he can't kill anyone.
```python import heapq N,K=map(int, input().split()) P=dict(zip(range(N),list(map(int, input().split())))) C=dict(zip(range(N),list(map(int, input().split())))) Ps = sorted(P.items(), key=lambda x:x[1], reverse=True) # Cs = sorted(C.items(), key=lambda x:x[1], reverse=True) # print(Ps) # print(Cs) ansDic = {} # rem = -1 for n in range(N): k=0 knightIdx = Ps[n][0] eachMaxCoin = C[knightIdx] selected = [] heapq.heapify(selected) for pn in range(n+1,N): p = Ps[pn] targIdx = p[0] if k < K: heapq.heappush(selected,C[targIdx]) k+=1 elif selected[0] < C[targIdx]: heapq.heappop(selected) heapq.heappush(selected,C[targIdx]) eachMaxCoin += sum(selected) # print( str(knightIdx) + ":" + str(eachMaxCoin) ) ansDic[knightIdx] = eachMaxCoin ans = "" for n in range(N): if 0<len(ans): ans += " " ans += str(ansDic[n]) print(ans) ```
0
313
B
Ilya and Queries
PROGRAMMING
1,100
[ "dp", "implementation" ]
null
null
Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam. You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=&lt;<=*r**i*), that *s**i*<==<=*s**i*<=+<=1. Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem.
The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#". The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*).
Print *m* integers — the answers to the queries in the order in which they are given in the input.
[ "......\n4\n3 4\n2 3\n1 6\n2 6\n", "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n" ]
[ "1\n1\n5\n4\n", "1\n1\n2\n2\n0\n" ]
none
1,000
[ { "input": "......\n4\n3 4\n2 3\n1 6\n2 6", "output": "1\n1\n5\n4" }, { "input": "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4", "output": "1\n1\n2\n2\n0" }, { "input": ".#...#..\n6\n1 5\n2 3\n6 7\n2 4\n2 5\n1 3", "output": "2\n0\n0\n1\n2\n0" }, { "input": "#.#.#..\n5\n3 4\n4 5\n5 7\n5 7\n1 3", "output": "0\n0\n1\n1\n0" }, { "input": "#.##.##.\n7\n1 8\n2 6\n2 6\n6 8\n3 5\n2 4\n2 5", "output": "2\n1\n1\n1\n1\n1\n1" }, { "input": "#..#\n1\n1 4", "output": "1" }, { "input": "#..##...#.\n7\n5 9\n6 10\n1 7\n5 8\n3 5\n2 10\n3 4", "output": "2\n2\n3\n2\n1\n4\n0" }, { "input": "#.#.#\n7\n1 2\n3 4\n3 5\n2 3\n3 5\n1 5\n1 3", "output": "0\n0\n0\n0\n0\n0\n0" }, { "input": "###..#...#\n2\n2 4\n1 2", "output": "1\n1" }, { "input": "..\n1\n1 2", "output": "1" }, { "input": "##\n1\n1 2", "output": "1" }, { "input": ".#\n1\n1 2", "output": "0" }, { "input": "#.\n1\n1 2", "output": "0" }, { "input": "...\n2\n1 2\n1 2", "output": "1\n1" } ]
1,682,887,783
2,147,483,647
PyPy 3-64
TIME_LIMIT_EXCEEDED
TESTS
9
2,000
3,788,800
s=input() for _ in range(int(input())): count_=0 l,r=map(int,input().split()) for i in range(l-1,r-1): if s[i]==s[i+1]: count_+=1 print(count_)
Title: Ilya and Queries Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam. You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=&lt;<=*r**i*), that *s**i*<==<=*s**i*<=+<=1. Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem. Input Specification: The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#". The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). Output Specification: Print *m* integers — the answers to the queries in the order in which they are given in the input. Demo Input: ['......\n4\n3 4\n2 3\n1 6\n2 6\n', '#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n'] Demo Output: ['1\n1\n5\n4\n', '1\n1\n2\n2\n0\n'] Note: none
```python s=input() for _ in range(int(input())): count_=0 l,r=map(int,input().split()) for i in range(l-1,r-1): if s[i]==s[i+1]: count_+=1 print(count_) ```
0
312
B
Archer
PROGRAMMING
1,300
[ "math", "probabilities" ]
null
null
SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match.
A single line contains four integers .
Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6.
[ "1 2 1 2\n" ]
[ "0.666666666667" ]
none
1,000
[ { "input": "1 2 1 2", "output": "0.666666666667" }, { "input": "1 3 1 3", "output": "0.600000000000" }, { "input": "1 3 2 3", "output": "0.428571428571" }, { "input": "3 4 3 4", "output": "0.800000000000" }, { "input": "1 2 10 11", "output": "0.523809523810" }, { "input": "4 5 4 5", "output": "0.833333333333" }, { "input": "466 701 95 721", "output": "0.937693791148" }, { "input": "268 470 444 885", "output": "0.725614009325" }, { "input": "632 916 713 821", "output": "0.719292895126" }, { "input": "269 656 918 992", "output": "0.428937461623" }, { "input": "71 657 187 695", "output": "0.310488463257" }, { "input": "435 852 973 978", "output": "0.511844133157" }, { "input": "518 816 243 359", "output": "0.719734031025" }, { "input": "882 962 311 811", "output": "0.966386645447" }, { "input": "684 774 580 736", "output": "0.906051574446" }, { "input": "486 868 929 999", "output": "0.577723252958" }, { "input": "132 359 996 998", "output": "0.368154532345" }, { "input": "933 977 266 450", "output": "0.972879407907" }, { "input": "298 833 615 872", "output": "0.441270817024" }, { "input": "34 554 14 958", "output": "0.817324099167" }, { "input": "836 934 800 905", "output": "0.906105535462" }, { "input": "482 815 69 509", "output": "0.914365577772" }, { "input": "284 423 137 521", "output": "0.885974839378" }, { "input": "648 881 486 703", "output": "0.800911421248" }, { "input": "450 885 755 836", "output": "0.533901011176" }, { "input": "533 773 823 998", "output": "0.729222130525" }, { "input": "897 957 92 898", "output": "0.993193806364" }, { "input": "699 925 441 928", "output": "0.866816866175" }, { "input": "64 704 148 603", "output": "0.289486317811" }, { "input": "719 735 626 990", "output": "0.986124079764" }, { "input": "1 1000 1 1000", "output": "0.500250125063" } ]
1,637,079,631
2,147,483,647
Python 3
OK
TESTS
31
46
0
a, b, c, d = map(int, input().split()) k1 = a * d k2 = b * d - (b - a) * (d - c) print(k1 / k2)
Title: Archer Time Limit: None seconds Memory Limit: None megabytes Problem Description: SmallR is an archer. SmallR is taking a match of archer with Zanoes. They try to shoot in the target in turns, and SmallR shoots first. The probability of shooting the target each time is for SmallR while for Zanoes. The one who shoots in the target first should be the winner. Output the probability that SmallR will win the match. Input Specification: A single line contains four integers . Output Specification: Print a single real number, the probability that SmallR will win the match. The answer will be considered correct if the absolute or relative error doesn't exceed 10<=-<=6. Demo Input: ['1 2 1 2\n'] Demo Output: ['0.666666666667'] Note: none
```python a, b, c, d = map(int, input().split()) k1 = a * d k2 = b * d - (b - a) * (d - c) print(k1 / k2) ```
3
22
A
Second Order Statistics
PROGRAMMING
800
[ "brute force" ]
A. Second Order Statistics
2
256
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
[ "4\n1 2 2 -4\n", "5\n1 2 3 1 1\n" ]
[ "1\n", "2\n" ]
none
0
[ { "input": "4\n1 2 2 -4", "output": "1" }, { "input": "5\n1 2 3 1 1", "output": "2" }, { "input": "1\n28", "output": "NO" }, { "input": "2\n-28 12", "output": "12" }, { "input": "3\n-83 40 -80", "output": "-80" }, { "input": "8\n93 77 -92 26 21 -48 53 91", "output": "-48" }, { "input": "20\n-72 -9 -86 80 7 -10 40 -27 -94 92 96 56 28 -19 79 36 -3 -73 -63 -49", "output": "-86" }, { "input": "49\n-74 -100 -80 23 -8 -83 -41 -20 48 17 46 -73 -55 67 85 4 40 -60 -69 -75 56 -74 -42 93 74 -95 64 -46 97 -47 55 0 -78 -34 -31 40 -63 -49 -76 48 21 -1 -49 -29 -98 -11 76 26 94", "output": "-98" }, { "input": "88\n63 48 1 -53 -89 -49 64 -70 -49 71 -17 -16 76 81 -26 -50 67 -59 -56 97 2 100 14 18 -91 -80 42 92 -25 -88 59 8 -56 38 48 -71 -78 24 -14 48 -1 69 73 -76 54 16 -92 44 47 33 -34 -17 -81 21 -59 -61 53 26 10 -76 67 35 -29 70 65 -13 -29 81 80 32 74 -6 34 46 57 1 -45 -55 69 79 -58 11 -2 22 -18 -16 -89 -46", "output": "-91" }, { "input": "100\n34 32 88 20 76 53 -71 -39 -98 -10 57 37 63 -3 -54 -64 -78 -82 73 20 -30 -4 22 75 51 -64 -91 29 -52 -48 83 19 18 -47 46 57 -44 95 89 89 -30 84 -83 67 58 -99 -90 -53 92 -60 -5 -56 -61 27 68 -48 52 -95 64 -48 -30 -67 66 89 14 -33 -31 -91 39 7 -94 -54 92 -96 -99 -83 -16 91 -28 -66 81 44 14 -85 -21 18 40 16 -13 -82 -33 47 -10 -40 -19 10 25 60 -34 -89", "output": "-98" }, { "input": "2\n-1 -1", "output": "NO" }, { "input": "3\n-2 -2 -2", "output": "NO" }, { "input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "NO" }, { "input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100", "output": "100" }, { "input": "10\n40 71 -85 -85 40 -85 -85 64 -85 47", "output": "40" }, { "input": "23\n-90 -90 -41 -64 -64 -90 -15 10 -43 -90 -64 -64 89 -64 36 47 38 -90 -64 -90 -90 68 -90", "output": "-64" }, { "input": "39\n-97 -93 -42 -93 -97 -93 56 -97 -97 -97 76 -33 -60 91 7 82 17 47 -97 -97 -93 73 -97 12 -97 -97 -97 -97 56 -92 -83 -93 -93 49 -93 -97 -97 -17 -93", "output": "-93" }, { "input": "51\n-21 6 -35 -98 -86 -98 -86 -43 -65 32 -98 -40 96 -98 -98 -98 -98 -86 -86 -98 56 -86 -98 -98 -30 -98 -86 -31 -98 -86 -86 -86 -86 -30 96 -86 -86 -86 -60 25 88 -86 -86 58 31 -47 57 -86 37 44 -83", "output": "-86" }, { "input": "66\n-14 -95 65 -95 -95 -97 -90 -71 -97 -97 70 -95 -95 -97 -95 -27 35 -87 -95 -5 -97 -97 87 34 -49 -95 -97 -95 -97 -95 -30 -95 -97 47 -95 -17 -97 -95 -97 -69 51 -97 -97 -95 -75 87 59 21 63 56 76 -91 98 -97 6 -97 -95 -95 -97 -73 11 -97 -35 -95 -95 -43", "output": "-95" }, { "input": "77\n-67 -93 -93 -92 97 29 93 -93 -93 -5 -93 -7 60 -92 -93 44 -84 68 -92 -93 69 -92 -37 56 43 -93 35 -92 -93 19 -79 18 -92 -93 -93 -37 -93 -47 -93 -92 -92 74 67 19 40 -92 -92 -92 -92 -93 -93 -41 -93 -92 -93 -93 -92 -93 51 -80 6 -42 -92 -92 -66 -12 -92 -92 -3 93 -92 -49 -93 40 62 -92 -92", "output": "-92" }, { "input": "89\n-98 40 16 -87 -98 63 -100 55 -96 -98 -21 -100 -93 26 -98 -98 -100 -89 -98 -5 -65 -28 -100 -6 -66 67 -100 -98 -98 10 -98 -98 -70 7 -98 2 -100 -100 -98 25 -100 -100 -98 23 -68 -100 -98 3 98 -100 -98 -98 -98 -98 -24 -100 -100 -9 -98 35 -100 99 -5 -98 -100 -100 37 -100 -84 57 -98 40 -47 -100 -1 -92 -76 -98 -98 -100 -100 -100 -63 30 21 -100 -100 -100 -12", "output": "-98" }, { "input": "99\n10 -84 -100 -100 73 -64 -100 -94 33 -100 -100 -100 -100 71 64 24 7 -100 -32 -100 -100 77 -100 62 -12 55 45 -100 -100 -80 -100 -100 -100 -100 -100 -100 -100 -100 -100 -39 -48 -100 -34 47 -100 -100 -100 -100 -100 -77 -100 -100 -100 -100 -100 -100 -52 40 -55 -100 -44 -100 72 33 70 -100 -100 -78 -100 -3 100 -77 22 -100 95 -30 -100 10 -69 -100 -100 -100 -100 52 -39 -100 -100 -100 7 -100 -98 -66 95 -17 -100 52 -100 68 -100", "output": "-98" }, { "input": "100\n-99 -98 -64 89 53 57 -99 29 -78 18 -3 -54 76 -98 -99 -98 37 -98 19 -47 89 73 -98 -91 -99 -99 -98 -48 -99 22 -99 -98 -99 -99 -98 -60 84 67 -99 -98 20 -98 88 -98 46 -98 -99 -98 -99 -71 -99 -98 -98 -39 83 95 -98 63 -98 -99 32 -98 -99 -64 57 -30 -53 -83 -4 -99 58 20 -98 -10 -99 -44 -99 -99 -99 -99 75 34 -98 -52 -98 -30 -98 -99 -98 -98 51 -99 -99 -99 -98 -99 -99 -82 -90 92", "output": "-98" }, { "input": "3\n1 2 3", "output": "2" }, { "input": "3\n1 3 2", "output": "2" }, { "input": "3\n2 1 3", "output": "2" }, { "input": "3\n2 3 1", "output": "2" }, { "input": "3\n3 1 2", "output": "2" }, { "input": "3\n3 2 1", "output": "2" }, { "input": "9\n99 99 99 99 100 100 100 100 100", "output": "100" }, { "input": "5\n-100 -100 -100 -100 -100", "output": "NO" } ]
1,526,469,841
2,147,483,647
Python 3
OK
TESTS
31
216
7,372,800
n = input() a = sorted(list(map(int,input().split()))) for i in range(len(a)): if a[i]!=a[0]: print(a[i]) exit() print("NO")
Title: Second Order Statistics Time Limit: 2 seconds Memory Limit: 256 megabytes Problem Description: Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem. Input Specification: The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value. Output Specification: If the given sequence has the second order statistics, output this order statistics, otherwise output NO. Demo Input: ['4\n1 2 2 -4\n', '5\n1 2 3 1 1\n'] Demo Output: ['1\n', '2\n'] Note: none
```python n = input() a = sorted(list(map(int,input().split()))) for i in range(len(a)): if a[i]!=a[0]: print(a[i]) exit() print("NO") ```
3.932267
584
A
Olesya and Rodion
PROGRAMMING
1,000
[ "math" ]
null
null
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
[ "3 2\n" ]
[ "712" ]
none
500
[ { "input": "3 2", "output": "222" }, { "input": "2 2", "output": "22" }, { "input": "4 3", "output": "3333" }, { "input": "5 3", "output": "33333" }, { "input": "10 7", "output": "7777777777" }, { "input": "2 9", "output": "99" }, { "input": "18 8", "output": "888888888888888888" }, { "input": "1 5", "output": "5" }, { "input": "1 10", "output": "-1" }, { "input": "100 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "10 2", "output": "2222222222" }, { "input": "18 10", "output": "111111111111111110" }, { "input": "1 9", "output": "9" }, { "input": "7 6", "output": "6666666" }, { "input": "4 4", "output": "4444" }, { "input": "14 7", "output": "77777777777777" }, { "input": "3 8", "output": "888" }, { "input": "1 3", "output": "3" }, { "input": "2 8", "output": "88" }, { "input": "3 8", "output": "888" }, { "input": "4 3", "output": "3333" }, { "input": "5 9", "output": "99999" }, { "input": "4 8", "output": "8888" }, { "input": "3 4", "output": "444" }, { "input": "9 4", "output": "444444444" }, { "input": "8 10", "output": "11111110" }, { "input": "1 6", "output": "6" }, { "input": "20 3", "output": "33333333333333333333" }, { "input": "15 10", "output": "111111111111110" }, { "input": "31 4", "output": "4444444444444444444444444444444" }, { "input": "18 9", "output": "999999999999999999" }, { "input": "72 4", "output": "444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "76 8", "output": "8888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "12 5", "output": "555555555555" }, { "input": "54 5", "output": "555555555555555555555555555555555555555555555555555555" }, { "input": "96 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "15 9", "output": "999999999999999" }, { "input": "100 2", "output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222" }, { "input": "99 3", "output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333" }, { "input": "98 4", "output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444" }, { "input": "97 5", "output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "100 6", "output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "98 8", "output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888" }, { "input": "97 9", "output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "3 10", "output": "110" }, { "input": "2 4", "output": "44" }, { "input": "2 10", "output": "10" }, { "input": "10 10", "output": "1111111110" }, { "input": "4 10", "output": "1110" }, { "input": "25 10", "output": "1111111111111111111111110" }, { "input": "50 10", "output": "11111111111111111111111111111111111111111111111110" }, { "input": "5 10", "output": "11110" }, { "input": "99 10", "output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "100 10", "output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110" }, { "input": "1 2", "output": "2" }, { "input": "20 10", "output": "11111111111111111110" }, { "input": "99 7", "output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" }, { "input": "89 5", "output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555" }, { "input": "6 10", "output": "111110" }, { "input": "3 8", "output": "888" }, { "input": "1 9", "output": "9" }, { "input": "1 4", "output": "4" }, { "input": "100 7", "output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777" } ]
1,691,520,879
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
4
1,000
0
n,t=map(int,input().split()) r=0 while len(str(r))<n: r+=t if r==0: print(-1) else: print(r)
Title: Olesya and Rodion Time Limit: None seconds Memory Limit: None megabytes Problem Description: Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them. Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1. Input Specification: The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by. Output Specification: Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them. Demo Input: ['3 2\n'] Demo Output: ['712'] Note: none
```python n,t=map(int,input().split()) r=0 while len(str(r))<n: r+=t if r==0: print(-1) else: print(r) ```
0
753
A
Santa Claus and Candies
PROGRAMMING
1,000
[ "dp", "greedy", "math" ]
null
null
Santa Claus has *n* candies, he dreams to give them as gifts to children. What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has.
The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has.
Print to the first line integer number *k* — maximal number of kids which can get candies. Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*. If there are many solutions, print any of them.
[ "5\n", "9\n", "2\n" ]
[ "2\n2 3\n", "3\n3 5 1\n", "1\n2 \n" ]
none
500
[ { "input": "5", "output": "2\n1 4 " }, { "input": "9", "output": "3\n1 2 6 " }, { "input": "2", "output": "1\n2 " }, { "input": "1", "output": "1\n1 " }, { "input": "3", "output": "2\n1 2 " }, { "input": "1000", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 54 " }, { "input": "4", "output": "2\n1 3 " }, { "input": "6", "output": "3\n1 2 3 " }, { "input": "7", "output": "3\n1 2 4 " }, { "input": "8", "output": "3\n1 2 5 " }, { "input": "10", "output": "4\n1 2 3 4 " }, { "input": "11", "output": "4\n1 2 3 5 " }, { "input": "12", "output": "4\n1 2 3 6 " }, { "input": "13", "output": "4\n1 2 3 7 " }, { "input": "14", "output": "4\n1 2 3 8 " }, { "input": "15", "output": "5\n1 2 3 4 5 " }, { "input": "16", "output": "5\n1 2 3 4 6 " }, { "input": "20", "output": "5\n1 2 3 4 10 " }, { "input": "21", "output": "6\n1 2 3 4 5 6 " }, { "input": "22", "output": "6\n1 2 3 4 5 7 " }, { "input": "27", "output": "6\n1 2 3 4 5 12 " }, { "input": "28", "output": "7\n1 2 3 4 5 6 7 " }, { "input": "29", "output": "7\n1 2 3 4 5 6 8 " }, { "input": "35", "output": "7\n1 2 3 4 5 6 14 " }, { "input": "36", "output": "8\n1 2 3 4 5 6 7 8 " }, { "input": "37", "output": "8\n1 2 3 4 5 6 7 9 " }, { "input": "44", "output": "8\n1 2 3 4 5 6 7 16 " }, { "input": "45", "output": "9\n1 2 3 4 5 6 7 8 9 " }, { "input": "46", "output": "9\n1 2 3 4 5 6 7 8 10 " }, { "input": "230", "output": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 40 " }, { "input": "231", "output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 " }, { "input": "232", "output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 22 " }, { "input": "239", "output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 29 " }, { "input": "629", "output": "34\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 68 " }, { "input": "630", "output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 " }, { "input": "631", "output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 36 " }, { "input": "945", "output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 84 " }, { "input": "946", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 " }, { "input": "947", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 44 " }, { "input": "989", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 86 " }, { "input": "990", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 " }, { "input": "991", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 " }, { "input": "956", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 53 " }, { "input": "981", "output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 78 " }, { "input": "867", "output": "41\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 47 " }, { "input": "906", "output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 45 " }, { "input": "999", "output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 53 " }, { "input": "100", "output": "13\n1 2 3 4 5 6 7 8 9 10 11 12 22 " }, { "input": "126", "output": "15\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 21 " } ]
1,677,081,501
2,147,483,647
PyPy 3-64
WRONG_ANSWER
TESTS
0
31
0
n = int(input()) c = 1 a = [] while c < n : a.append(c) c += 1 print(len(a)) print(*a)
Title: Santa Claus and Candies Time Limit: None seconds Memory Limit: None megabytes Problem Description: Santa Claus has *n* candies, he dreams to give them as gifts to children. What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has. Input Specification: The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has. Output Specification: Print to the first line integer number *k* — maximal number of kids which can get candies. Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*. If there are many solutions, print any of them. Demo Input: ['5\n', '9\n', '2\n'] Demo Output: ['2\n2 3\n', '3\n3 5 1\n', '1\n2 \n'] Note: none
```python n = int(input()) c = 1 a = [] while c < n : a.append(c) c += 1 print(len(a)) print(*a) ```
0
381
A
Sereja and Dima
PROGRAMMING
800
[ "greedy", "implementation", "two pointers" ]
null
null
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins. Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move. Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
[ "4\n4 1 2 10\n", "7\n1 2 3 4 5 6 7\n" ]
[ "12 5\n", "16 12\n" ]
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
500
[ { "input": "4\n4 1 2 10", "output": "12 5" }, { "input": "7\n1 2 3 4 5 6 7", "output": "16 12" }, { "input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13", "output": "613 418" }, { "input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24", "output": "644 500" }, { "input": "1\n3", "output": "3 0" }, { "input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646", "output": "6848 6568" }, { "input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727", "output": "9562 9561" }, { "input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12", "output": "315 315" }, { "input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304", "output": "3238 2222" }, { "input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325", "output": "5246 4864" }, { "input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71", "output": "8147 7807" }, { "input": "1\n1", "output": "1 0" } ]
1,692,354,994
2,147,483,647
PyPy 3-64
OK
TESTS
34
77
0
import sys from collections import Counter, deque input = lambda: sys.stdin.readline().rstrip() def solve(): n = int(input()) li = list(map(int, input().split())) i, j, first, second, take , x = 0, n-1, 0, 0, 0, 0 while i<=j: if li[i] > li[j]: x = li[i] i+=1 else: x = li[j] j -= 1 take ^= 1 if take: first += x else: second += x print(first, second) if __name__ == "__main__": t = 1 #t = int(input()) for _ in range(t): solve()
Title: Sereja and Dima Time Limit: None seconds Memory Limit: None megabytes Problem Description: Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins. Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move. Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her. Input Specification: The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000. Output Specification: On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game. Demo Input: ['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n'] Demo Output: ['12 5\n', '16 12\n'] Note: In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
```python import sys from collections import Counter, deque input = lambda: sys.stdin.readline().rstrip() def solve(): n = int(input()) li = list(map(int, input().split())) i, j, first, second, take , x = 0, n-1, 0, 0, 0, 0 while i<=j: if li[i] > li[j]: x = li[i] i+=1 else: x = li[j] j -= 1 take ^= 1 if take: first += x else: second += x print(first, second) if __name__ == "__main__": t = 1 #t = int(input()) for _ in range(t): solve() ```
3
253
A
Boys and Girls
PROGRAMMING
1,100
[ "greedy" ]
null
null
There are *n* boys and *m* girls studying in the class. They should stand in a line so that boys and girls alternated there as much as possible. Let's assume that positions in the line are indexed from left to right by numbers from 1 to *n*<=+<=*m*. Then the number of integers *i* (1<=≤<=*i*<=&lt;<=*n*<=+<=*m*) such that positions with indexes *i* and *i*<=+<=1 contain children of different genders (position *i* has a girl and position *i*<=+<=1 has a boy or vice versa) must be as large as possible. Help the children and tell them how to form the line.
The single line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), separated by a space.
Print a line of *n*<=+<=*m* characters. Print on the *i*-th position of the line character "B", if the *i*-th position of your arrangement should have a boy and "G", if it should have a girl. Of course, the number of characters "B" should equal *n* and the number of characters "G" should equal *m*. If there are multiple optimal solutions, print any of them.
[ "3 3\n", "4 2\n" ]
[ "GBGBGB\n", "BGBGBB\n" ]
In the first sample another possible answer is BGBGBG. In the second sample answer BBGBGB is also optimal.
500
[ { "input": "3 3", "output": "GBGBGB" }, { "input": "4 2", "output": "BGBGBB" }, { "input": "5 5", "output": "GBGBGBGBGB" }, { "input": "6 4", "output": "BGBGBGBGBB" }, { "input": "100 1", "output": "BGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "76 48", "output": "BGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "100 90", "output": "BGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBBBBBBBBBB" }, { "input": "90 100", "output": "GBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGGGGGGGGGG" }, { "input": "1 98", "output": "GBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "1 100", "output": "GBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "56 98", "output": "GBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "89 89", "output": "GBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGB" }, { "input": "18 94", "output": "GBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "84 27", "output": "BGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "1 1", "output": "GB" }, { "input": "1 2", "output": "GBG" }, { "input": "2 1", "output": "BGB" }, { "input": "1 34", "output": "GBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "46 2", "output": "BGBGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "99 3", "output": "BGBGBGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB" }, { "input": "10 100", "output": "GBGBGBGBGBGBGBGBGBGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG" }, { "input": "100 100", "output": "GBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGBGB" }, { "input": "1 4", "output": "GBGGG" } ]
1,692,861,777
2,147,483,647
PyPy 3-64
RUNTIME_ERROR
TESTS
7
154
2,867,200
with open("input.txt", 'r') as f: n, m = map(int, f.readline().split()) l = [0]*(n+m) a, b = n, m if n == m: i = 0 while i < n+m-1: l[i] = 'G' l[i+1] = 'B' i = i+2 elif n > m: i = 1 while b > 0: l[i] = 'G' i = i+2 b = b-1 l = ["B" if x == 0 else x for x in l] else: i = 1 while b > 0: l[i] = 'G' i = i+2 b = b-1 l = ["B" if x == 0 else x for x in l] with open("output.txt", 'w') as g: g.write("".join(l))
Title: Boys and Girls Time Limit: None seconds Memory Limit: None megabytes Problem Description: There are *n* boys and *m* girls studying in the class. They should stand in a line so that boys and girls alternated there as much as possible. Let's assume that positions in the line are indexed from left to right by numbers from 1 to *n*<=+<=*m*. Then the number of integers *i* (1<=≤<=*i*<=&lt;<=*n*<=+<=*m*) such that positions with indexes *i* and *i*<=+<=1 contain children of different genders (position *i* has a girl and position *i*<=+<=1 has a boy or vice versa) must be as large as possible. Help the children and tell them how to form the line. Input Specification: The single line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), separated by a space. Output Specification: Print a line of *n*<=+<=*m* characters. Print on the *i*-th position of the line character "B", if the *i*-th position of your arrangement should have a boy and "G", if it should have a girl. Of course, the number of characters "B" should equal *n* and the number of characters "G" should equal *m*. If there are multiple optimal solutions, print any of them. Demo Input: ['3 3\n', '4 2\n'] Demo Output: ['GBGBGB\n', 'BGBGBB\n'] Note: In the first sample another possible answer is BGBGBG. In the second sample answer BBGBGB is also optimal.
```python with open("input.txt", 'r') as f: n, m = map(int, f.readline().split()) l = [0]*(n+m) a, b = n, m if n == m: i = 0 while i < n+m-1: l[i] = 'G' l[i+1] = 'B' i = i+2 elif n > m: i = 1 while b > 0: l[i] = 'G' i = i+2 b = b-1 l = ["B" if x == 0 else x for x in l] else: i = 1 while b > 0: l[i] = 'G' i = i+2 b = b-1 l = ["B" if x == 0 else x for x in l] with open("output.txt", 'w') as g: g.write("".join(l)) ```
-1
779
B
Weird Rounding
PROGRAMMING
1,100
[ "brute force", "greedy" ]
null
null
Polycarp is crazy about round numbers. He especially likes the numbers divisible by 10*k*. In the given number of *n* Polycarp wants to remove the least number of digits to get a number that is divisible by 10*k*. For example, if *k*<==<=3, in the number 30020 it is enough to delete a single digit (2). In this case, the result is 3000 that is divisible by 103<==<=1000. Write a program that prints the minimum number of digits to be deleted from the given integer number *n*, so that the result is divisible by 10*k*. The result should not start with the unnecessary leading zero (i.e., zero can start only the number 0, which is required to be written as exactly one digit). It is guaranteed that the answer exists.
The only line of the input contains two integer numbers *n* and *k* (0<=≤<=*n*<=≤<=2<=000<=000<=000, 1<=≤<=*k*<=≤<=9). It is guaranteed that the answer exists. All numbers in the input are written in traditional notation of integers, that is, without any extra leading zeros.
Print *w* — the required minimal number of digits to erase. After removing the appropriate *w* digits from the number *n*, the result should have a value that is divisible by 10*k*. The result can start with digit 0 in the single case (the result is zero and written by exactly the only digit 0).
[ "30020 3\n", "100 9\n", "10203049 2\n" ]
[ "1\n", "2\n", "3\n" ]
In the example 2 you can remove two digits: 1 and any 0. The result is number 0 which is divisible by any number.
1,000
[ { "input": "30020 3", "output": "1" }, { "input": "100 9", "output": "2" }, { "input": "10203049 2", "output": "3" }, { "input": "0 1", "output": "0" }, { "input": "0 9", "output": "0" }, { "input": "100 2", "output": "0" }, { "input": "102030404 2", "output": "2" }, { "input": "1000999999 3", "output": "6" }, { "input": "12000000 4", "output": "0" }, { "input": "1090090090 5", "output": "2" }, { "input": "10 1", "output": "0" }, { "input": "10 2", "output": "1" }, { "input": "10 9", "output": "1" }, { "input": "100 1", "output": "0" }, { "input": "100 3", "output": "2" }, { "input": "101010110 3", "output": "3" }, { "input": "101010110 1", "output": "0" }, { "input": "101010110 2", "output": "2" }, { "input": "101010110 4", "output": "4" }, { "input": "101010110 5", "output": "8" }, { "input": "101010110 9", "output": "8" }, { "input": "1234567890 1", "output": "0" }, { "input": "1234567890 2", "output": "9" }, { "input": "1234567890 9", "output": "9" }, { "input": "2000000000 1", "output": "0" }, { "input": "2000000000 2", "output": "0" }, { "input": "2000000000 3", "output": "0" }, { "input": "2000000000 9", "output": "0" }, { "input": "1010101010 1", "output": "0" }, { "input": "1010101010 2", "output": "1" }, { "input": "1010101010 3", "output": "2" }, { "input": "1010101010 4", "output": "3" }, { "input": "1010101010 5", "output": "4" }, { "input": "1010101010 6", "output": "9" }, { "input": "1010101010 7", "output": "9" }, { "input": "1010101010 8", "output": "9" }, { "input": "1010101010 9", "output": "9" }, { "input": "10001000 1", "output": "0" }, { "input": "10001000 2", "output": "0" }, { "input": "10001000 3", "output": "0" }, { "input": "10001000 4", "output": "1" }, { "input": "10001000 5", "output": "1" }, { "input": "10001000 6", "output": "1" }, { "input": "10001000 7", "output": "7" }, { "input": "10001000 8", "output": "7" }, { "input": "10001000 9", "output": "7" }, { "input": "1000000001 1", "output": "1" }, { "input": "1000000001 2", "output": "1" }, { "input": "1000000001 3", "output": "1" }, { "input": "1000000001 6", "output": "1" }, { "input": "1000000001 7", "output": "1" }, { "input": "1000000001 8", "output": "1" }, { "input": "1000000001 9", "output": "9" }, { "input": "1000 1", "output": "0" }, { "input": "100001100 3", "output": "2" }, { "input": "7057 6", "output": "3" }, { "input": "30000000 5", "output": "0" }, { "input": "470 1", "output": "0" }, { "input": "500500000 4", "output": "0" }, { "input": "2103 8", "output": "3" }, { "input": "600000000 2", "output": "0" }, { "input": "708404442 1", "output": "4" }, { "input": "5000140 6", "output": "6" }, { "input": "1100047 3", "output": "2" }, { "input": "309500 5", "output": "5" }, { "input": "70053160 4", "output": "7" }, { "input": "44000 1", "output": "0" }, { "input": "400370000 3", "output": "0" }, { "input": "5800 6", "output": "3" }, { "input": "20700050 1", "output": "0" }, { "input": "650 1", "output": "0" }, { "input": "320005070 6", "output": "8" }, { "input": "370000 4", "output": "0" }, { "input": "1011 2", "output": "3" }, { "input": "1000111 5", "output": "6" }, { "input": "1001111 5", "output": "6" }, { "input": "99990 3", "output": "4" }, { "input": "10100200 6", "output": "7" }, { "input": "200 3", "output": "2" }, { "input": "103055 3", "output": "5" }, { "input": "1030555 3", "output": "6" }, { "input": "100111 4", "output": "5" }, { "input": "101 2", "output": "2" }, { "input": "1001 3", "output": "3" }, { "input": "100000 6", "output": "5" }, { "input": "1100000 6", "output": "6" }, { "input": "123450 2", "output": "5" }, { "input": "1003 3", "output": "3" }, { "input": "1111100 4", "output": "6" }, { "input": "532415007 8", "output": "8" }, { "input": "801 2", "output": "2" }, { "input": "1230 2", "output": "3" }, { "input": "9900 3", "output": "3" }, { "input": "14540444 2", "output": "7" }, { "input": "11111100 4", "output": "7" }, { "input": "11001 3", "output": "4" }, { "input": "1011110 3", "output": "6" }, { "input": "15450112 2", "output": "7" }, { "input": "2220 3", "output": "3" }, { "input": "90099 3", "output": "4" }, { "input": "10005 4", "output": "4" }, { "input": "1010 3", "output": "3" }, { "input": "444444400 3", "output": "8" }, { "input": "10020 4", "output": "4" }, { "input": "10303 3", "output": "4" }, { "input": "123000 4", "output": "5" }, { "input": "12300 3", "output": "4" }, { "input": "101 1", "output": "1" }, { "input": "500001 8", "output": "5" }, { "input": "121002 3", "output": "5" }, { "input": "10011 3", "output": "4" }, { "input": "505050 4", "output": "5" }, { "input": "1421011 2", "output": "6" }, { "input": "1202022 3", "output": "6" }, { "input": "1000023 7", "output": "6" }, { "input": "110 2", "output": "2" }, { "input": "111000 4", "output": "5" }, { "input": "10340 3", "output": "4" }, { "input": "101 9", "output": "2" }, { "input": "2001 3", "output": "3" }, { "input": "122320 2", "output": "5" }, { "input": "22200 3", "output": "4" }, { "input": "11110 2", "output": "4" }, { "input": "11010 3", "output": "4" }, { "input": "1000002333 6", "output": "9" }, { "input": "101010 4", "output": "5" }, { "input": "210 9", "output": "2" }, { "input": "500555 3", "output": "5" }, { "input": "1110111 3", "output": "6" }, { "input": "1100000000 9", "output": "9" }, { "input": "11000 4", "output": "4" }, { "input": "100 4", "output": "2" }, { "input": "234560 3", "output": "5" }, { "input": "10230 3", "output": "4" }, { "input": "10030234 5", "output": "7" }, { "input": "1200 3", "output": "3" }, { "input": "123400 3", "output": "5" }, { "input": "1034543 4", "output": "6" }, { "input": "10100 4", "output": "4" }, { "input": "10 5", "output": "1" }, { "input": "4501022 3", "output": "6" }, { "input": "12340 2", "output": "4" }, { "input": "30020 4", "output": "4" }, { "input": "1111100 6", "output": "6" }, { "input": "10101 5", "output": "4" }, { "input": "32132100 3", "output": "7" }, { "input": "1000023 6", "output": "6" }, { "input": "12300 4", "output": "4" }, { "input": "78400 3", "output": "4" }, { "input": "10203049 5", "output": "7" }, { "input": "404044 3", "output": "5" }, { "input": "1024 2", "output": "3" }, { "input": "505 2", "output": "2" }, { "input": "20 2", "output": "1" }, { "input": "1111100 3", "output": "6" }, { "input": "1000 9", "output": "3" }, { "input": "3333300 3", "output": "6" }, { "input": "1100 3", "output": "3" }, { "input": "963000 4", "output": "5" }, { "input": "100457 5", "output": "5" }, { "input": "10049 3", "output": "4" } ]
1,488,162,225
2,325
Python 3
WRONG_ANSWER
TESTS
2
61
4,608,000
import math n,k = map(int,input().split(' ')) j = 1 + int(math.log10(n)) if j<k: print(j-1) exit() count = 0 for i in range(0,k,1): if n%10 != 0: count += 1 n = int(n/10) print(count)
Title: Weird Rounding Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp is crazy about round numbers. He especially likes the numbers divisible by 10*k*. In the given number of *n* Polycarp wants to remove the least number of digits to get a number that is divisible by 10*k*. For example, if *k*<==<=3, in the number 30020 it is enough to delete a single digit (2). In this case, the result is 3000 that is divisible by 103<==<=1000. Write a program that prints the minimum number of digits to be deleted from the given integer number *n*, so that the result is divisible by 10*k*. The result should not start with the unnecessary leading zero (i.e., zero can start only the number 0, which is required to be written as exactly one digit). It is guaranteed that the answer exists. Input Specification: The only line of the input contains two integer numbers *n* and *k* (0<=≤<=*n*<=≤<=2<=000<=000<=000, 1<=≤<=*k*<=≤<=9). It is guaranteed that the answer exists. All numbers in the input are written in traditional notation of integers, that is, without any extra leading zeros. Output Specification: Print *w* — the required minimal number of digits to erase. After removing the appropriate *w* digits from the number *n*, the result should have a value that is divisible by 10*k*. The result can start with digit 0 in the single case (the result is zero and written by exactly the only digit 0). Demo Input: ['30020 3\n', '100 9\n', '10203049 2\n'] Demo Output: ['1\n', '2\n', '3\n'] Note: In the example 2 you can remove two digits: 1 and any 0. The result is number 0 which is divisible by any number.
```python import math n,k = map(int,input().split(' ')) j = 1 + int(math.log10(n)) if j<k: print(j-1) exit() count = 0 for i in range(0,k,1): if n%10 != 0: count += 1 n = int(n/10) print(count) ```
0
808
A
Lucky Year
PROGRAMMING
900
[ "implementation" ]
null
null
Apart from having lots of holidays throughout the year, residents of Berland also have whole lucky years. Year is considered lucky if it has no more than 1 non-zero digit in its number. So years 100, 40000, 5 are lucky and 12, 3001 and 12345 are not. You are given current year in Berland. Your task is to find how long will residents of Berland wait till the next lucky year.
The first line contains integer number *n* (1<=≤<=*n*<=≤<=109) — current year in Berland.
Output amount of years from the current year to the next lucky one.
[ "4\n", "201\n", "4000\n" ]
[ "1\n", "99\n", "1000\n" ]
In the first example next lucky year is 5. In the second one — 300. In the third — 5000.
0
[ { "input": "4", "output": "1" }, { "input": "201", "output": "99" }, { "input": "4000", "output": "1000" }, { "input": "9", "output": "1" }, { "input": "10", "output": "10" }, { "input": "1", "output": "1" }, { "input": "100000000", "output": "100000000" }, { "input": "900000000", "output": "100000000" }, { "input": "999999999", "output": "1" }, { "input": "1000000000", "output": "1000000000" }, { "input": "9999999", "output": "1" }, { "input": "100000001", "output": "99999999" }, { "input": "3660", "output": "340" }, { "input": "21", "output": "9" }, { "input": "900000001", "output": "99999999" }, { "input": "62911", "output": "7089" }, { "input": "11", "output": "9" }, { "input": "940302010", "output": "59697990" }, { "input": "91", "output": "9" }, { "input": "101", "output": "99" }, { "input": "1090", "output": "910" }, { "input": "987654321", "output": "12345679" }, { "input": "703450474", "output": "96549526" }, { "input": "1091", "output": "909" }, { "input": "89", "output": "1" }, { "input": "109", "output": "91" }, { "input": "190", "output": "10" }, { "input": "19", "output": "1" }, { "input": "8", "output": "1" }, { "input": "482", "output": "18" }, { "input": "1", "output": "1" }, { "input": "2", "output": "1" }, { "input": "3", "output": "1" }, { "input": "4", "output": "1" }, { "input": "5", "output": "1" }, { "input": "6", "output": "1" }, { "input": "7", "output": "1" }, { "input": "8", "output": "1" }, { "input": "9", "output": "1" }, { "input": "10", "output": "10" }, { "input": "11", "output": "9" }, { "input": "12", "output": "8" }, { "input": "13", "output": "7" }, { "input": "14", "output": "6" }, { "input": "15", "output": "5" }, { "input": "16", "output": "4" }, { "input": "17", "output": "3" }, { "input": "18", "output": "2" }, { "input": "19", "output": "1" }, { "input": "20", "output": "10" }, { "input": "21", "output": "9" }, { "input": "22", "output": "8" }, { "input": "23", "output": "7" }, { "input": "24", "output": "6" }, { "input": "25", "output": "5" }, { "input": "26", "output": "4" }, { "input": "27", "output": "3" }, { "input": "28", "output": "2" }, { "input": "29", "output": "1" }, { "input": "30", "output": "10" }, { "input": "31", "output": "9" }, { "input": "32", "output": "8" }, { "input": "33", "output": "7" }, { "input": "34", "output": "6" }, { "input": "35", "output": "5" }, { "input": "36", "output": "4" }, { "input": "37", "output": "3" }, { "input": "38", "output": "2" }, { "input": "39", "output": "1" }, { "input": "40", "output": "10" }, { "input": "41", "output": "9" }, { "input": "42", "output": "8" }, { "input": "43", "output": "7" }, { "input": "44", "output": "6" }, { "input": "45", "output": "5" }, { "input": "46", "output": "4" }, { "input": "47", "output": "3" }, { "input": "48", "output": "2" }, { "input": "49", "output": "1" }, { "input": "50", "output": "10" }, { "input": "51", "output": "9" }, { "input": "52", "output": "8" }, { "input": "53", "output": "7" }, { "input": "54", "output": "6" }, { "input": "55", "output": "5" }, { "input": "56", "output": "4" }, { "input": "57", "output": "3" }, { "input": "58", "output": "2" }, { "input": "59", "output": "1" }, { "input": "60", "output": "10" }, { "input": "61", "output": "9" }, { "input": "62", "output": "8" }, { "input": "63", "output": "7" }, { "input": "64", "output": "6" }, { "input": "65", "output": "5" }, { "input": "66", "output": "4" }, { "input": "67", "output": "3" }, { "input": "68", "output": "2" }, { "input": "69", "output": "1" }, { "input": "70", "output": "10" }, { "input": "71", "output": "9" }, { "input": "72", "output": "8" }, { "input": "73", "output": "7" }, { "input": "74", "output": "6" }, { "input": "75", "output": "5" }, { "input": "76", "output": "4" }, { "input": "77", "output": "3" }, { "input": "78", "output": "2" }, { "input": "79", "output": "1" }, { "input": "80", "output": "10" }, { "input": "81", "output": "9" }, { "input": "82", "output": "8" }, { "input": "83", "output": "7" }, { "input": "84", "output": "6" }, { "input": "85", "output": "5" }, { "input": "86", "output": "4" }, { "input": "87", "output": "3" }, { "input": "88", "output": "2" }, { "input": "89", "output": "1" }, { "input": "90", "output": "10" }, { "input": "91", "output": "9" }, { "input": "92", "output": "8" }, { "input": "93", "output": "7" }, { "input": "94", "output": "6" }, { "input": "95", "output": "5" }, { "input": "96", "output": "4" }, { "input": "97", "output": "3" }, { "input": "98", "output": "2" }, { "input": "99", "output": "1" }, { "input": "100", "output": "100" }, { "input": "100", "output": "100" }, { "input": "100", "output": "100" }, { "input": "1000", "output": "1000" }, { "input": "1000", "output": "1000" }, { "input": "1000", "output": "1000" }, { "input": "10000", "output": "10000" }, { "input": "10000", "output": "10000" }, { "input": "101", "output": "99" }, { "input": "110", "output": "90" }, { "input": "1001", "output": "999" }, { "input": "1100", "output": "900" }, { "input": "1010", "output": "990" }, { "input": "10010", "output": "9990" }, { "input": "10100", "output": "9900" }, { "input": "102", "output": "98" }, { "input": "120", "output": "80" }, { "input": "1002", "output": "998" }, { "input": "1200", "output": "800" }, { "input": "1020", "output": "980" }, { "input": "10020", "output": "9980" }, { "input": "10200", "output": "9800" }, { "input": "108", "output": "92" }, { "input": "180", "output": "20" }, { "input": "1008", "output": "992" }, { "input": "1800", "output": "200" }, { "input": "1080", "output": "920" }, { "input": "10080", "output": "9920" }, { "input": "10800", "output": "9200" }, { "input": "109", "output": "91" }, { "input": "190", "output": "10" }, { "input": "1009", "output": "991" }, { "input": "1900", "output": "100" }, { "input": "1090", "output": "910" }, { "input": "10090", "output": "9910" }, { "input": "10900", "output": "9100" }, { "input": "200", "output": "100" }, { "input": "200", "output": "100" }, { "input": "2000", "output": "1000" }, { "input": "2000", "output": "1000" }, { "input": "2000", "output": "1000" }, { "input": "20000", "output": "10000" }, { "input": "20000", "output": "10000" }, { "input": "201", "output": "99" }, { "input": "210", "output": "90" }, { "input": "2001", "output": "999" }, { "input": "2100", "output": "900" }, { "input": "2010", "output": "990" }, { "input": "20010", "output": "9990" }, { "input": "20100", "output": "9900" }, { "input": "202", "output": "98" }, { "input": "220", "output": "80" }, { "input": "2002", "output": "998" }, { "input": "2200", "output": "800" }, { "input": "2020", "output": "980" }, { "input": "20020", "output": "9980" }, { "input": "20200", "output": "9800" }, { "input": "208", "output": "92" }, { "input": "280", "output": "20" }, { "input": "2008", "output": "992" }, { "input": "2800", "output": "200" }, { "input": "2080", "output": "920" }, { "input": "20080", "output": "9920" }, { "input": "20800", "output": "9200" }, { "input": "209", "output": "91" }, { "input": "290", "output": "10" }, { "input": "2009", "output": "991" }, { "input": "2900", "output": "100" }, { "input": "2090", "output": "910" }, { "input": "20090", "output": "9910" }, { "input": "20900", "output": "9100" }, { "input": "800", "output": "100" }, { "input": "800", "output": "100" }, { "input": "8000", "output": "1000" }, { "input": "8000", "output": "1000" }, { "input": "8000", "output": "1000" }, { "input": "80000", "output": "10000" }, { "input": "80000", "output": "10000" }, { "input": "801", "output": "99" }, { "input": "810", "output": "90" }, { "input": "8001", "output": "999" }, { "input": "8100", "output": "900" }, { "input": "8010", "output": "990" }, { "input": "80010", "output": "9990" }, { "input": "80100", "output": "9900" }, { "input": "802", "output": "98" }, { "input": "820", "output": "80" }, { "input": "8002", "output": "998" }, { "input": "8200", "output": "800" }, { "input": "8020", "output": "980" }, { "input": "80020", "output": "9980" }, { "input": "80200", "output": "9800" }, { "input": "808", "output": "92" }, { "input": "880", "output": "20" }, { "input": "8008", "output": "992" }, { "input": "8800", "output": "200" }, { "input": "8080", "output": "920" }, { "input": "80080", "output": "9920" }, { "input": "80800", "output": "9200" }, { "input": "809", "output": "91" }, { "input": "890", "output": "10" }, { "input": "8009", "output": "991" }, { "input": "8900", "output": "100" }, { "input": "8090", "output": "910" }, { "input": "80090", "output": "9910" }, { "input": "80900", "output": "9100" }, { "input": "900", "output": "100" }, { "input": "900", "output": "100" }, { "input": "9000", "output": "1000" }, { "input": "9000", "output": "1000" }, { "input": "9000", "output": "1000" }, { "input": "90000", "output": "10000" }, { "input": "90000", "output": "10000" }, { "input": "901", "output": "99" }, { "input": "910", "output": "90" }, { "input": "9001", "output": "999" }, { "input": "9100", "output": "900" }, { "input": "9010", "output": "990" }, { "input": "90010", "output": "9990" }, { "input": "90100", "output": "9900" }, { "input": "902", "output": "98" }, { "input": "920", "output": "80" }, { "input": "9002", "output": "998" }, { "input": "9200", "output": "800" }, { "input": "9020", "output": "980" }, { "input": "90020", "output": "9980" }, { "input": "90200", "output": "9800" }, { "input": "908", "output": "92" }, { "input": "980", "output": "20" }, { "input": "9008", "output": "992" }, { "input": "9800", "output": "200" }, { "input": "9080", "output": "920" }, { "input": "90080", "output": "9920" }, { "input": "90800", "output": "9200" }, { "input": "909", "output": "91" }, { "input": "990", "output": "10" }, { "input": "9009", "output": "991" }, { "input": "9900", "output": "100" }, { "input": "9090", "output": "910" }, { "input": "90090", "output": "9910" }, { "input": "90900", "output": "9100" }, { "input": "92651241", "output": "7348759" } ]
1,670,765,438
2,147,483,647
Python 3
OK
TESTS
271
46
0
x = int(input()) def First(year): year = str(year) return int(year[0])+1 def zeroes(year): year = str(year) return 10**(int(len(year))-1) print(First(x)*zeroes(x)-x)
Title: Lucky Year Time Limit: None seconds Memory Limit: None megabytes Problem Description: Apart from having lots of holidays throughout the year, residents of Berland also have whole lucky years. Year is considered lucky if it has no more than 1 non-zero digit in its number. So years 100, 40000, 5 are lucky and 12, 3001 and 12345 are not. You are given current year in Berland. Your task is to find how long will residents of Berland wait till the next lucky year. Input Specification: The first line contains integer number *n* (1<=≤<=*n*<=≤<=109) — current year in Berland. Output Specification: Output amount of years from the current year to the next lucky one. Demo Input: ['4\n', '201\n', '4000\n'] Demo Output: ['1\n', '99\n', '1000\n'] Note: In the first example next lucky year is 5. In the second one — 300. In the third — 5000.
```python x = int(input()) def First(year): year = str(year) return int(year[0])+1 def zeroes(year): year = str(year) return 10**(int(len(year))-1) print(First(x)*zeroes(x)-x) ```
3
1
A
Theatre Square
PROGRAMMING
1,000
[ "math" ]
A. Theatre Square
1
256
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Write the needed number of flagstones.
[ "6 6 4\n" ]
[ "4\n" ]
none
0
[ { "input": "6 6 4", "output": "4" }, { "input": "1 1 1", "output": "1" }, { "input": "2 1 1", "output": "2" }, { "input": "1 2 1", "output": "2" }, { "input": "2 2 1", "output": "4" }, { "input": "2 1 2", "output": "1" }, { "input": "1 1 3", "output": "1" }, { "input": "2 3 4", "output": "1" }, { "input": "1000000000 1000000000 1", "output": "1000000000000000000" }, { "input": "12 13 4", "output": "12" }, { "input": "222 332 5", "output": "3015" }, { "input": "1000 1000 10", "output": "10000" }, { "input": "1001 1000 10", "output": "10100" }, { "input": "100 10001 1000000000", "output": "1" }, { "input": "1000000000 1000000000 1000000000", "output": "1" }, { "input": "1000000000 1000000000 999999999", "output": "4" }, { "input": "1000000000 1000000000 192", "output": "27126743055556" }, { "input": "1000000000 987654321 1", "output": "987654321000000000" }, { "input": "456784567 1000000000 51", "output": "175618850864484" }, { "input": "39916800 134217728 40320", "output": "3295710" } ]
1,689,311,480
2,147,483,647
Python 3
RUNTIME_ERROR
TESTS
0
30
0
import math m = int(input()) n = int(input()) a = int(input()) x = math.ceil(m/a) y = math.ceil(m/a) print(x*y)
Title: Theatre Square Time Limit: 1 seconds Memory Limit: 256 megabytes Problem Description: Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*. What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. Input Specification: The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). Output Specification: Write the needed number of flagstones. Demo Input: ['6 6 4\n'] Demo Output: ['4\n'] Note: none
```python import math m = int(input()) n = int(input()) a = int(input()) x = math.ceil(m/a) y = math.ceil(m/a) print(x*y) ```
-1
36
A
Extra-terrestrial Intelligence
PROGRAMMING
1,300
[ "implementation" ]
A. Extra-terrestrial Intelligence
2
64
Recently Vasya got interested in finding extra-terrestrial intelligence. He made a simple extra-terrestrial signals’ receiver and was keeping a record of the signals for *n* days in a row. Each of those *n* days Vasya wrote a 1 in his notebook if he had received a signal that day and a 0 if he hadn’t. Vasya thinks that he has found extra-terrestrial intelligence if there is a system in the way the signals has been received, i.e. if all the intervals between successive signals are equal. Otherwise, Vasya thinks that the signals were sent by some stupid aliens no one cares about. Help Vasya to deduce from the information given by the receiver if he has found extra-terrestrial intelligence or not.
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of days during which Vasya checked if there were any signals. The second line contains *n* characters 1 or 0 — the record Vasya kept each of those *n* days. It’s guaranteed that the given record sequence contains at least three 1s.
If Vasya has found extra-terrestrial intelligence, output YES, otherwise output NO.
[ "8\n00111000\n", "7\n1001011\n", "7\n1010100\n" ]
[ "YES\n", "NO\n", "YES\n" ]
none
500
[ { "input": "8\n00111000", "output": "YES" }, { "input": "7\n1001011", "output": "NO" }, { "input": "7\n1010100", "output": "YES" }, { "input": "5\n10101", "output": "YES" }, { "input": "3\n111", "output": "YES" }, { "input": "10\n0011111011", "output": "NO" }, { "input": "12\n001010101010", "output": "YES" }, { "input": "25\n1000000010000000100000001", "output": "YES" }, { "input": "30\n111110111101110111111111111111", "output": "NO" }, { "input": "50\n00101010101010101010101010101010101010101010101010", "output": "YES" }, { "input": "60\n000000000000000000100001000000001000000001000000001000000001", "output": "NO" }, { "input": "66\n000000000000000000000010011110000010000010000010000000000000000000", "output": "NO" }, { "input": "77\n10000100001010000000000001000000000000100000101000010010000000001100000000000", "output": "NO" }, { "input": "99\n000000000000000000100000010000001000000100000010000001000000100000010000001000000100000010000001000", "output": "YES" }, { "input": "100\n0000000000001000000000000000000000000000000000000010000000000000000000000000000000000000100000000000", "output": "YES" }, { "input": "100\n0010000000000000000000000000000100000000000010000000000000001000000000000000000000000000010000000000", "output": "NO" }, { "input": "5\n10111", "output": "NO" }, { "input": "100\n0000100000000000000000000000000000000000010000000000000000000000000000000000001000000000000000000000", "output": "YES" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111", "output": "YES" }, { "input": "100\n1111111111111111111111111111111111111111111111111111111111111101111111111111111111111111111111111111", "output": "NO" } ]
1,612,265,372
2,147,483,647
Python 3
OK
TESTS
20
154
307,200
def main(): n=int(inf.readline()) sz=scr=0 str=inf.readline() for i in range(n): if str[i]=='1': scr+=1 if scr==2: sz=prev-i elif scr>2: if prev-i!=sz: return False prev=i return True inf=open("input.txt","r") ouf=open("output.txt","w") if main(): ouf.write("YES") else: ouf.write("NO") inf.close() ouf.close()
Title: Extra-terrestrial Intelligence Time Limit: 2 seconds Memory Limit: 64 megabytes Problem Description: Recently Vasya got interested in finding extra-terrestrial intelligence. He made a simple extra-terrestrial signals’ receiver and was keeping a record of the signals for *n* days in a row. Each of those *n* days Vasya wrote a 1 in his notebook if he had received a signal that day and a 0 if he hadn’t. Vasya thinks that he has found extra-terrestrial intelligence if there is a system in the way the signals has been received, i.e. if all the intervals between successive signals are equal. Otherwise, Vasya thinks that the signals were sent by some stupid aliens no one cares about. Help Vasya to deduce from the information given by the receiver if he has found extra-terrestrial intelligence or not. Input Specification: The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of days during which Vasya checked if there were any signals. The second line contains *n* characters 1 or 0 — the record Vasya kept each of those *n* days. It’s guaranteed that the given record sequence contains at least three 1s. Output Specification: If Vasya has found extra-terrestrial intelligence, output YES, otherwise output NO. Demo Input: ['8\n00111000\n', '7\n1001011\n', '7\n1010100\n'] Demo Output: ['YES\n', 'NO\n', 'YES\n'] Note: none
```python def main(): n=int(inf.readline()) sz=scr=0 str=inf.readline() for i in range(n): if str[i]=='1': scr+=1 if scr==2: sz=prev-i elif scr>2: if prev-i!=sz: return False prev=i return True inf=open("input.txt","r") ouf=open("output.txt","w") if main(): ouf.write("YES") else: ouf.write("NO") inf.close() ouf.close() ```
3.959211
591
A
Wizards' Duel
PROGRAMMING
900
[ "implementation", "math" ]
null
null
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second. The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse. Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place. The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4. Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
[ "100\n50\n50\n", "199\n60\n40\n" ]
[ "50\n", "119.4\n" ]
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
500
[ { "input": "100\n50\n50", "output": "50" }, { "input": "199\n60\n40", "output": "119.4" }, { "input": "1\n1\n1", "output": "0.5" }, { "input": "1\n1\n500", "output": "0.001996007984" }, { "input": "1\n500\n1", "output": "0.998003992" }, { "input": "1\n500\n500", "output": "0.5" }, { "input": "1000\n1\n1", "output": "500" }, { "input": "1000\n1\n500", "output": "1.996007984" }, { "input": "1000\n500\n1", "output": "998.003992" }, { "input": "1000\n500\n500", "output": "500" }, { "input": "101\n11\n22", "output": "33.66666667" }, { "input": "987\n1\n3", "output": "246.75" }, { "input": "258\n25\n431", "output": "14.14473684" }, { "input": "979\n39\n60", "output": "385.6666667" }, { "input": "538\n479\n416", "output": "287.9351955" }, { "input": "583\n112\n248", "output": "181.3777778" }, { "input": "978\n467\n371", "output": "545.0190931" }, { "input": "980\n322\n193", "output": "612.7378641" }, { "input": "871\n401\n17", "output": "835.576555" }, { "input": "349\n478\n378", "output": "194.885514" }, { "input": "425\n458\n118", "output": "337.9340278" }, { "input": "919\n323\n458", "output": "380.0729834" }, { "input": "188\n59\n126", "output": "59.95675676" }, { "input": "644\n428\n484", "output": "302.2280702" }, { "input": "253\n80\n276", "output": "56.85393258" }, { "input": "745\n152\n417", "output": "199.0158172" }, { "input": "600\n221\n279", "output": "265.2" }, { "input": "690\n499\n430", "output": "370.6243272" }, { "input": "105\n68\n403", "output": "15.15923567" }, { "input": "762\n462\n371", "output": "422.6218487" }, { "input": "903\n460\n362", "output": "505.3284672" }, { "input": "886\n235\n95", "output": "630.9393939" }, { "input": "655\n203\n18", "output": "601.6515837" }, { "input": "718\n29\n375", "output": "51.53960396" }, { "input": "296\n467\n377", "output": "163.7819905" }, { "input": "539\n61\n56", "output": "281.017094" }, { "input": "133\n53\n124", "output": "39.82485876" }, { "input": "998\n224\n65", "output": "773.5363322" }, { "input": "961\n173\n47", "output": "755.6954545" }, { "input": "285\n468\n62", "output": "251.6603774" }, { "input": "496\n326\n429", "output": "214.1668874" }, { "input": "627\n150\n285", "output": "216.2068966" }, { "input": "961\n443\n50", "output": "863.535497" }, { "input": "623\n422\n217", "output": "411.4334898" }, { "input": "678\n295\n29", "output": "617.3148148" } ]
1,664,307,756
2,147,483,647
PyPy 3-64
OK
TESTS
45
62
0
l=int(input()) p=int(input()) q=int(input()) s= l/(p+q) x=p*s print(x)
Title: Wizards' Duel Time Limit: None seconds Memory Limit: None megabytes Problem Description: Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second. The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse. Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight. Input Specification: The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place. The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively. Output Specification: Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4. Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if . Demo Input: ['100\n50\n50\n', '199\n60\n40\n'] Demo Output: ['50\n', '119.4\n'] Note: In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
```python l=int(input()) p=int(input()) q=int(input()) s= l/(p+q) x=p*s print(x) ```
3
615
A
Bulbs
PROGRAMMING
800
[ "implementation" ]
null
null
Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on.
The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs.
If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO".
[ "3 4\n2 1 4\n3 1 3 1\n1 2\n", "3 3\n1 1\n1 2\n1 1\n" ]
[ "YES\n", "NO\n" ]
In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
500
[ { "input": "3 4\n2 1 4\n3 1 3 1\n1 2", "output": "YES" }, { "input": "3 3\n1 1\n1 2\n1 1", "output": "NO" }, { "input": "3 4\n1 1\n1 2\n1 3", "output": "NO" }, { "input": "1 5\n5 1 2 3 4 5", "output": "YES" }, { "input": "1 5\n5 4 4 1 2 3", "output": "NO" }, { "input": "1 5\n5 1 1 1 1 5", "output": "NO" }, { "input": "2 5\n4 3 1 4 2\n4 2 3 4 5", "output": "YES" }, { "input": "5 7\n2 6 7\n5 1 1 1 1 1\n3 6 5 4\n0\n4 4 3 2 1", "output": "YES" }, { "input": "100 100\n0\n0\n0\n1 53\n0\n0\n1 34\n1 54\n0\n1 14\n0\n1 33\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 82\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n1 26\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 34\n0\n0\n0\n0\n0\n1 3\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 40\n0\n0\n0\n1 26\n0\n0\n0\n0\n0\n1 97\n0\n1 5\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "5 6\n3 1 2 6\n3 1 2 6\n1 1\n2 3 4\n3 1 5 6", "output": "YES" }, { "input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "NO" }, { "input": "1 4\n3 1 2 3", "output": "NO" }, { "input": "1 4\n3 2 3 4", "output": "NO" }, { "input": "2 4\n3 2 3 4\n1 1", "output": "YES" }, { "input": "2 4\n3 1 2 3\n1 4", "output": "YES" }, { "input": "5 1\n0\n0\n0\n0\n0", "output": "NO" }, { "input": "1 1\n0", "output": "NO" }, { "input": "1 10\n10 1 2 3 4 5 6 7 8 9 10", "output": "YES" }, { "input": "1 1\n1 1", "output": "YES" }, { "input": "1 100\n99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99", "output": "NO" }, { "input": "1 3\n3 1 2 1", "output": "NO" }, { "input": "1 100\n100 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100", "output": "YES" } ]
1,618,233,021
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
4
62
0
n, m = list(map(int, input().rstrip().split())) bulbs_that_on = [] switches = [bulbs_that_on.extend(list(map(int, input().rstrip().split()))) for _ in range(n)] set_of_bulbs = set(bulbs_that_on) if len(set_of_bulbs) == m: print("YES") else: print("NO")
Title: Bulbs Time Limit: None seconds Memory Limit: None megabytes Problem Description: Vasya wants to turn on Christmas lights consisting of *m* bulbs. Initially, all bulbs are turned off. There are *n* buttons, each of them is connected to some set of bulbs. Vasya can press any of these buttons. When the button is pressed, it turns on all the bulbs it's connected to. Can Vasya light up all the bulbs? If Vasya presses the button such that some bulbs connected to it are already turned on, they do not change their state, i.e. remain turned on. Input Specification: The first line of the input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of buttons and the number of bulbs respectively. Each of the next *n* lines contains *x**i* (0<=≤<=*x**i*<=≤<=*m*) — the number of bulbs that are turned on by the *i*-th button, and then *x**i* numbers *y**ij* (1<=≤<=*y**ij*<=≤<=*m*) — the numbers of these bulbs. Output Specification: If it's possible to turn on all *m* bulbs print "YES", otherwise print "NO". Demo Input: ['3 4\n2 1 4\n3 1 3 1\n1 2\n', '3 3\n1 1\n1 2\n1 1\n'] Demo Output: ['YES\n', 'NO\n'] Note: In the first sample you can press each button once and turn on all the bulbs. In the 2 sample it is impossible to turn on the 3-rd lamp.
```python n, m = list(map(int, input().rstrip().split())) bulbs_that_on = [] switches = [bulbs_that_on.extend(list(map(int, input().rstrip().split()))) for _ in range(n)] set_of_bulbs = set(bulbs_that_on) if len(set_of_bulbs) == m: print("YES") else: print("NO") ```
0
313
B
Ilya and Queries
PROGRAMMING
1,100
[ "dp", "implementation" ]
null
null
Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam. You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=&lt;<=*r**i*), that *s**i*<==<=*s**i*<=+<=1. Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem.
The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#". The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*).
Print *m* integers — the answers to the queries in the order in which they are given in the input.
[ "......\n4\n3 4\n2 3\n1 6\n2 6\n", "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n" ]
[ "1\n1\n5\n4\n", "1\n1\n2\n2\n0\n" ]
none
1,000
[ { "input": "......\n4\n3 4\n2 3\n1 6\n2 6", "output": "1\n1\n5\n4" }, { "input": "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4", "output": "1\n1\n2\n2\n0" }, { "input": ".#...#..\n6\n1 5\n2 3\n6 7\n2 4\n2 5\n1 3", "output": "2\n0\n0\n1\n2\n0" }, { "input": "#.#.#..\n5\n3 4\n4 5\n5 7\n5 7\n1 3", "output": "0\n0\n1\n1\n0" }, { "input": "#.##.##.\n7\n1 8\n2 6\n2 6\n6 8\n3 5\n2 4\n2 5", "output": "2\n1\n1\n1\n1\n1\n1" }, { "input": "#..#\n1\n1 4", "output": "1" }, { "input": "#..##...#.\n7\n5 9\n6 10\n1 7\n5 8\n3 5\n2 10\n3 4", "output": "2\n2\n3\n2\n1\n4\n0" }, { "input": "#.#.#\n7\n1 2\n3 4\n3 5\n2 3\n3 5\n1 5\n1 3", "output": "0\n0\n0\n0\n0\n0\n0" }, { "input": "###..#...#\n2\n2 4\n1 2", "output": "1\n1" }, { "input": "..\n1\n1 2", "output": "1" }, { "input": "##\n1\n1 2", "output": "1" }, { "input": ".#\n1\n1 2", "output": "0" }, { "input": "#.\n1\n1 2", "output": "0" }, { "input": "...\n2\n1 2\n1 2", "output": "1\n1" } ]
1,699,519,881
2,147,483,647
Python 3
OK
TESTS
37
1,776
5,529,600
from functools import lru_cache line = list(input()) n = len(line) dp = [0]*n ans = [] for i in range(1,n): if line[i] == line[i-1]: dp[i] = dp[i-1] + 1 else: dp[i] = dp[i-1] n = int(input()) @lru_cache() def main(x,y): ans = dp[y-1] - dp[x-1] return ans for i in range(n): x,y = map(int,input().split()) print(main(x,y))
Title: Ilya and Queries Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam. You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=&lt;<=*r**i*), that *s**i*<==<=*s**i*<=+<=1. Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem. Input Specification: The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#". The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=&lt;<=*r**i*<=≤<=*n*). Output Specification: Print *m* integers — the answers to the queries in the order in which they are given in the input. Demo Input: ['......\n4\n3 4\n2 3\n1 6\n2 6\n', '#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n'] Demo Output: ['1\n1\n5\n4\n', '1\n1\n2\n2\n0\n'] Note: none
```python from functools import lru_cache line = list(input()) n = len(line) dp = [0]*n ans = [] for i in range(1,n): if line[i] == line[i-1]: dp[i] = dp[i-1] + 1 else: dp[i] = dp[i-1] n = int(input()) @lru_cache() def main(x,y): ans = dp[y-1] - dp[x-1] return ans for i in range(n): x,y = map(int,input().split()) print(main(x,y)) ```
3
735
D
Taxes
PROGRAMMING
1,600
[ "math", "number theory" ]
null
null
Mr. Funt now lives in a country with a very specific tax laws. The total income of mr. Funt during this year is equal to *n* (*n*<=≥<=2) burles and the amount of tax he has to pay is calculated as the maximum divisor of *n* (not equal to *n*, of course). For example, if *n*<==<=6 then Funt has to pay 3 burles, while for *n*<==<=25 he needs to pay 5 and if *n*<==<=2 he pays only 1 burle. As mr. Funt is a very opportunistic person he wants to cheat a bit. In particular, he wants to split the initial *n* in several parts *n*1<=+<=*n*2<=+<=...<=+<=*n**k*<==<=*n* (here *k* is arbitrary, even *k*<==<=1 is allowed) and pay the taxes for each part separately. He can't make some part equal to 1 because it will reveal him. So, the condition *n**i*<=≥<=2 should hold for all *i* from 1 to *k*. Ostap Bender wonders, how many money Funt has to pay (i.e. minimal) if he chooses and optimal way to split *n* in parts.
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=2·109) — the total year income of mr. Funt.
Print one integer — minimum possible number of burles that mr. Funt has to pay as a tax.
[ "4\n", "27\n" ]
[ "2\n", "3\n" ]
none
1,750
[ { "input": "4", "output": "2" }, { "input": "27", "output": "3" }, { "input": "3", "output": "1" }, { "input": "5", "output": "1" }, { "input": "10", "output": "2" }, { "input": "2000000000", "output": "2" }, { "input": "26", "output": "2" }, { "input": "7", "output": "1" }, { "input": "2", "output": "1" }, { "input": "11", "output": "1" }, { "input": "1000000007", "output": "1" }, { "input": "1000000009", "output": "1" }, { "input": "1999999999", "output": "3" }, { "input": "1000000011", "output": "2" }, { "input": "101", "output": "1" }, { "input": "103", "output": "1" }, { "input": "1001", "output": "3" }, { "input": "1003", "output": "3" }, { "input": "10001", "output": "3" }, { "input": "10003", "output": "3" }, { "input": "129401294", "output": "2" }, { "input": "234911024", "output": "2" }, { "input": "192483501", "output": "3" }, { "input": "1234567890", "output": "2" }, { "input": "719241201", "output": "3" }, { "input": "9", "output": "2" }, { "input": "33", "output": "2" }, { "input": "25", "output": "2" }, { "input": "15", "output": "2" }, { "input": "147", "output": "3" }, { "input": "60119912", "output": "2" }, { "input": "45", "output": "2" }, { "input": "21", "output": "2" }, { "input": "9975", "output": "2" }, { "input": "17", "output": "1" }, { "input": "99", "output": "2" }, { "input": "49", "output": "2" }, { "input": "243", "output": "2" }, { "input": "43", "output": "1" }, { "input": "39", "output": "2" }, { "input": "6", "output": "2" }, { "input": "8", "output": "2" }, { "input": "12", "output": "2" }, { "input": "13", "output": "1" }, { "input": "14", "output": "2" }, { "input": "16", "output": "2" }, { "input": "18", "output": "2" }, { "input": "19", "output": "1" }, { "input": "20", "output": "2" }, { "input": "22", "output": "2" }, { "input": "23", "output": "1" }, { "input": "24", "output": "2" }, { "input": "962", "output": "2" }, { "input": "29", "output": "1" }, { "input": "55", "output": "2" }, { "input": "125", "output": "3" }, { "input": "1999999929", "output": "2" }, { "input": "493", "output": "2" }, { "input": "10000021", "output": "2" }, { "input": "541", "output": "1" }, { "input": "187", "output": "3" }, { "input": "95", "output": "3" }, { "input": "999991817", "output": "3" }, { "input": "37998938", "output": "2" }, { "input": "1847133842", "output": "2" }, { "input": "1000000005", "output": "3" }, { "input": "19828", "output": "2" }, { "input": "998321704", "output": "2" }, { "input": "370359", "output": "3" }, { "input": "115", "output": "2" }, { "input": "200000015", "output": "3" }, { "input": "479001600", "output": "2" }, { "input": "536870912", "output": "2" }, { "input": "10759922", "output": "2" }, { "input": "1999999927", "output": "1" }, { "input": "123", "output": "3" }, { "input": "200743933", "output": "3" }, { "input": "949575615", "output": "3" }, { "input": "99990001", "output": "1" }, { "input": "715827883", "output": "1" }, { "input": "5592406", "output": "2" }, { "input": "8388609", "output": "3" }, { "input": "1908903481", "output": "3" }, { "input": "1076153021", "output": "3" }, { "input": "344472101", "output": "3" } ]
1,604,039,241
2,147,483,647
PyPy 3
OK
TESTS
85
155
1,228,800
import math n=int(input()) if n<=3: print(1) if n>3 and n%2==0: print(2) if n>3 and n%2!=0: con1=True for i in range(2, int(math.sqrt(n))+1): if n%i==0: con1=False break if con1: print(1) if not con1: n1=n-2 con2=True for i in range(2, int(math.sqrt(n1))+1): if n1%i==0: con2=False break if con2: print(2) if not con2: print(3)
Title: Taxes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mr. Funt now lives in a country with a very specific tax laws. The total income of mr. Funt during this year is equal to *n* (*n*<=≥<=2) burles and the amount of tax he has to pay is calculated as the maximum divisor of *n* (not equal to *n*, of course). For example, if *n*<==<=6 then Funt has to pay 3 burles, while for *n*<==<=25 he needs to pay 5 and if *n*<==<=2 he pays only 1 burle. As mr. Funt is a very opportunistic person he wants to cheat a bit. In particular, he wants to split the initial *n* in several parts *n*1<=+<=*n*2<=+<=...<=+<=*n**k*<==<=*n* (here *k* is arbitrary, even *k*<==<=1 is allowed) and pay the taxes for each part separately. He can't make some part equal to 1 because it will reveal him. So, the condition *n**i*<=≥<=2 should hold for all *i* from 1 to *k*. Ostap Bender wonders, how many money Funt has to pay (i.e. minimal) if he chooses and optimal way to split *n* in parts. Input Specification: The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=2·109) — the total year income of mr. Funt. Output Specification: Print one integer — minimum possible number of burles that mr. Funt has to pay as a tax. Demo Input: ['4\n', '27\n'] Demo Output: ['2\n', '3\n'] Note: none
```python import math n=int(input()) if n<=3: print(1) if n>3 and n%2==0: print(2) if n>3 and n%2!=0: con1=True for i in range(2, int(math.sqrt(n))+1): if n%i==0: con1=False break if con1: print(1) if not con1: n1=n-2 con2=True for i in range(2, int(math.sqrt(n1))+1): if n1%i==0: con2=False break if con2: print(2) if not con2: print(3) ```
3
334
A
Candy Bags
PROGRAMMING
1,000
[ "implementation" ]
null
null
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies. Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order. It is guaranteed that the solution exists at the given limits.
[ "2\n" ]
[ "1 4\n2 3\n" ]
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
500
[ { "input": "2", "output": "1 4\n2 3" }, { "input": "4", "output": "1 16 2 15\n3 14 4 13\n5 12 6 11\n7 10 8 9" }, { "input": "6", "output": "1 36 2 35 3 34\n4 33 5 32 6 31\n7 30 8 29 9 28\n10 27 11 26 12 25\n13 24 14 23 15 22\n16 21 17 20 18 19" }, { "input": "8", "output": "1 64 2 63 3 62 4 61\n5 60 6 59 7 58 8 57\n9 56 10 55 11 54 12 53\n13 52 14 51 15 50 16 49\n17 48 18 47 19 46 20 45\n21 44 22 43 23 42 24 41\n25 40 26 39 27 38 28 37\n29 36 30 35 31 34 32 33" }, { "input": "10", "output": "1 100 2 99 3 98 4 97 5 96\n6 95 7 94 8 93 9 92 10 91\n11 90 12 89 13 88 14 87 15 86\n16 85 17 84 18 83 19 82 20 81\n21 80 22 79 23 78 24 77 25 76\n26 75 27 74 28 73 29 72 30 71\n31 70 32 69 33 68 34 67 35 66\n36 65 37 64 38 63 39 62 40 61\n41 60 42 59 43 58 44 57 45 56\n46 55 47 54 48 53 49 52 50 51" }, { "input": "100", "output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951\n51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 993..." }, { "input": "62", "output": "1 3844 2 3843 3 3842 4 3841 5 3840 6 3839 7 3838 8 3837 9 3836 10 3835 11 3834 12 3833 13 3832 14 3831 15 3830 16 3829 17 3828 18 3827 19 3826 20 3825 21 3824 22 3823 23 3822 24 3821 25 3820 26 3819 27 3818 28 3817 29 3816 30 3815 31 3814\n32 3813 33 3812 34 3811 35 3810 36 3809 37 3808 38 3807 39 3806 40 3805 41 3804 42 3803 43 3802 44 3801 45 3800 46 3799 47 3798 48 3797 49 3796 50 3795 51 3794 52 3793 53 3792 54 3791 55 3790 56 3789 57 3788 58 3787 59 3786 60 3785 61 3784 62 3783\n63 3782 64 3781 65 378..." }, { "input": "66", "output": "1 4356 2 4355 3 4354 4 4353 5 4352 6 4351 7 4350 8 4349 9 4348 10 4347 11 4346 12 4345 13 4344 14 4343 15 4342 16 4341 17 4340 18 4339 19 4338 20 4337 21 4336 22 4335 23 4334 24 4333 25 4332 26 4331 27 4330 28 4329 29 4328 30 4327 31 4326 32 4325 33 4324\n34 4323 35 4322 36 4321 37 4320 38 4319 39 4318 40 4317 41 4316 42 4315 43 4314 44 4313 45 4312 46 4311 47 4310 48 4309 49 4308 50 4307 51 4306 52 4305 53 4304 54 4303 55 4302 56 4301 57 4300 58 4299 59 4298 60 4297 61 4296 62 4295 63 4294 64 4293 65 4292..." }, { "input": "18", "output": "1 324 2 323 3 322 4 321 5 320 6 319 7 318 8 317 9 316\n10 315 11 314 12 313 13 312 14 311 15 310 16 309 17 308 18 307\n19 306 20 305 21 304 22 303 23 302 24 301 25 300 26 299 27 298\n28 297 29 296 30 295 31 294 32 293 33 292 34 291 35 290 36 289\n37 288 38 287 39 286 40 285 41 284 42 283 43 282 44 281 45 280\n46 279 47 278 48 277 49 276 50 275 51 274 52 273 53 272 54 271\n55 270 56 269 57 268 58 267 59 266 60 265 61 264 62 263 63 262\n64 261 65 260 66 259 67 258 68 257 69 256 70 255 71 254 72 253\n73 252 7..." }, { "input": "68", "output": "1 4624 2 4623 3 4622 4 4621 5 4620 6 4619 7 4618 8 4617 9 4616 10 4615 11 4614 12 4613 13 4612 14 4611 15 4610 16 4609 17 4608 18 4607 19 4606 20 4605 21 4604 22 4603 23 4602 24 4601 25 4600 26 4599 27 4598 28 4597 29 4596 30 4595 31 4594 32 4593 33 4592 34 4591\n35 4590 36 4589 37 4588 38 4587 39 4586 40 4585 41 4584 42 4583 43 4582 44 4581 45 4580 46 4579 47 4578 48 4577 49 4576 50 4575 51 4574 52 4573 53 4572 54 4571 55 4570 56 4569 57 4568 58 4567 59 4566 60 4565 61 4564 62 4563 63 4562 64 4561 65 4560..." }, { "input": "86", "output": "1 7396 2 7395 3 7394 4 7393 5 7392 6 7391 7 7390 8 7389 9 7388 10 7387 11 7386 12 7385 13 7384 14 7383 15 7382 16 7381 17 7380 18 7379 19 7378 20 7377 21 7376 22 7375 23 7374 24 7373 25 7372 26 7371 27 7370 28 7369 29 7368 30 7367 31 7366 32 7365 33 7364 34 7363 35 7362 36 7361 37 7360 38 7359 39 7358 40 7357 41 7356 42 7355 43 7354\n44 7353 45 7352 46 7351 47 7350 48 7349 49 7348 50 7347 51 7346 52 7345 53 7344 54 7343 55 7342 56 7341 57 7340 58 7339 59 7338 60 7337 61 7336 62 7335 63 7334 64 7333 65 7332..." }, { "input": "96", "output": "1 9216 2 9215 3 9214 4 9213 5 9212 6 9211 7 9210 8 9209 9 9208 10 9207 11 9206 12 9205 13 9204 14 9203 15 9202 16 9201 17 9200 18 9199 19 9198 20 9197 21 9196 22 9195 23 9194 24 9193 25 9192 26 9191 27 9190 28 9189 29 9188 30 9187 31 9186 32 9185 33 9184 34 9183 35 9182 36 9181 37 9180 38 9179 39 9178 40 9177 41 9176 42 9175 43 9174 44 9173 45 9172 46 9171 47 9170 48 9169\n49 9168 50 9167 51 9166 52 9165 53 9164 54 9163 55 9162 56 9161 57 9160 58 9159 59 9158 60 9157 61 9156 62 9155 63 9154 64 9153 65 9152..." }, { "input": "12", "output": "1 144 2 143 3 142 4 141 5 140 6 139\n7 138 8 137 9 136 10 135 11 134 12 133\n13 132 14 131 15 130 16 129 17 128 18 127\n19 126 20 125 21 124 22 123 23 122 24 121\n25 120 26 119 27 118 28 117 29 116 30 115\n31 114 32 113 33 112 34 111 35 110 36 109\n37 108 38 107 39 106 40 105 41 104 42 103\n43 102 44 101 45 100 46 99 47 98 48 97\n49 96 50 95 51 94 52 93 53 92 54 91\n55 90 56 89 57 88 58 87 59 86 60 85\n61 84 62 83 63 82 64 81 65 80 66 79\n67 78 68 77 69 76 70 75 71 74 72 73" }, { "input": "88", "output": "1 7744 2 7743 3 7742 4 7741 5 7740 6 7739 7 7738 8 7737 9 7736 10 7735 11 7734 12 7733 13 7732 14 7731 15 7730 16 7729 17 7728 18 7727 19 7726 20 7725 21 7724 22 7723 23 7722 24 7721 25 7720 26 7719 27 7718 28 7717 29 7716 30 7715 31 7714 32 7713 33 7712 34 7711 35 7710 36 7709 37 7708 38 7707 39 7706 40 7705 41 7704 42 7703 43 7702 44 7701\n45 7700 46 7699 47 7698 48 7697 49 7696 50 7695 51 7694 52 7693 53 7692 54 7691 55 7690 56 7689 57 7688 58 7687 59 7686 60 7685 61 7684 62 7683 63 7682 64 7681 65 7680..." }, { "input": "28", "output": "1 784 2 783 3 782 4 781 5 780 6 779 7 778 8 777 9 776 10 775 11 774 12 773 13 772 14 771\n15 770 16 769 17 768 18 767 19 766 20 765 21 764 22 763 23 762 24 761 25 760 26 759 27 758 28 757\n29 756 30 755 31 754 32 753 33 752 34 751 35 750 36 749 37 748 38 747 39 746 40 745 41 744 42 743\n43 742 44 741 45 740 46 739 47 738 48 737 49 736 50 735 51 734 52 733 53 732 54 731 55 730 56 729\n57 728 58 727 59 726 60 725 61 724 62 723 63 722 64 721 65 720 66 719 67 718 68 717 69 716 70 715\n71 714 72 713 73 712 74 7..." }, { "input": "80", "output": "1 6400 2 6399 3 6398 4 6397 5 6396 6 6395 7 6394 8 6393 9 6392 10 6391 11 6390 12 6389 13 6388 14 6387 15 6386 16 6385 17 6384 18 6383 19 6382 20 6381 21 6380 22 6379 23 6378 24 6377 25 6376 26 6375 27 6374 28 6373 29 6372 30 6371 31 6370 32 6369 33 6368 34 6367 35 6366 36 6365 37 6364 38 6363 39 6362 40 6361\n41 6360 42 6359 43 6358 44 6357 45 6356 46 6355 47 6354 48 6353 49 6352 50 6351 51 6350 52 6349 53 6348 54 6347 55 6346 56 6345 57 6344 58 6343 59 6342 60 6341 61 6340 62 6339 63 6338 64 6337 65 6336..." }, { "input": "48", "output": "1 2304 2 2303 3 2302 4 2301 5 2300 6 2299 7 2298 8 2297 9 2296 10 2295 11 2294 12 2293 13 2292 14 2291 15 2290 16 2289 17 2288 18 2287 19 2286 20 2285 21 2284 22 2283 23 2282 24 2281\n25 2280 26 2279 27 2278 28 2277 29 2276 30 2275 31 2274 32 2273 33 2272 34 2271 35 2270 36 2269 37 2268 38 2267 39 2266 40 2265 41 2264 42 2263 43 2262 44 2261 45 2260 46 2259 47 2258 48 2257\n49 2256 50 2255 51 2254 52 2253 53 2252 54 2251 55 2250 56 2249 57 2248 58 2247 59 2246 60 2245 61 2244 62 2243 63 2242 64 2241 65 224..." }, { "input": "54", "output": "1 2916 2 2915 3 2914 4 2913 5 2912 6 2911 7 2910 8 2909 9 2908 10 2907 11 2906 12 2905 13 2904 14 2903 15 2902 16 2901 17 2900 18 2899 19 2898 20 2897 21 2896 22 2895 23 2894 24 2893 25 2892 26 2891 27 2890\n28 2889 29 2888 30 2887 31 2886 32 2885 33 2884 34 2883 35 2882 36 2881 37 2880 38 2879 39 2878 40 2877 41 2876 42 2875 43 2874 44 2873 45 2872 46 2871 47 2870 48 2869 49 2868 50 2867 51 2866 52 2865 53 2864 54 2863\n55 2862 56 2861 57 2860 58 2859 59 2858 60 2857 61 2856 62 2855 63 2854 64 2853 65 285..." }, { "input": "58", "output": "1 3364 2 3363 3 3362 4 3361 5 3360 6 3359 7 3358 8 3357 9 3356 10 3355 11 3354 12 3353 13 3352 14 3351 15 3350 16 3349 17 3348 18 3347 19 3346 20 3345 21 3344 22 3343 23 3342 24 3341 25 3340 26 3339 27 3338 28 3337 29 3336\n30 3335 31 3334 32 3333 33 3332 34 3331 35 3330 36 3329 37 3328 38 3327 39 3326 40 3325 41 3324 42 3323 43 3322 44 3321 45 3320 46 3319 47 3318 48 3317 49 3316 50 3315 51 3314 52 3313 53 3312 54 3311 55 3310 56 3309 57 3308 58 3307\n59 3306 60 3305 61 3304 62 3303 63 3302 64 3301 65 330..." }, { "input": "64", "output": "1 4096 2 4095 3 4094 4 4093 5 4092 6 4091 7 4090 8 4089 9 4088 10 4087 11 4086 12 4085 13 4084 14 4083 15 4082 16 4081 17 4080 18 4079 19 4078 20 4077 21 4076 22 4075 23 4074 24 4073 25 4072 26 4071 27 4070 28 4069 29 4068 30 4067 31 4066 32 4065\n33 4064 34 4063 35 4062 36 4061 37 4060 38 4059 39 4058 40 4057 41 4056 42 4055 43 4054 44 4053 45 4052 46 4051 47 4050 48 4049 49 4048 50 4047 51 4046 52 4045 53 4044 54 4043 55 4042 56 4041 57 4040 58 4039 59 4038 60 4037 61 4036 62 4035 63 4034 64 4033\n65 403..." }, { "input": "44", "output": "1 1936 2 1935 3 1934 4 1933 5 1932 6 1931 7 1930 8 1929 9 1928 10 1927 11 1926 12 1925 13 1924 14 1923 15 1922 16 1921 17 1920 18 1919 19 1918 20 1917 21 1916 22 1915\n23 1914 24 1913 25 1912 26 1911 27 1910 28 1909 29 1908 30 1907 31 1906 32 1905 33 1904 34 1903 35 1902 36 1901 37 1900 38 1899 39 1898 40 1897 41 1896 42 1895 43 1894 44 1893\n45 1892 46 1891 47 1890 48 1889 49 1888 50 1887 51 1886 52 1885 53 1884 54 1883 55 1882 56 1881 57 1880 58 1879 59 1878 60 1877 61 1876 62 1875 63 1874 64 1873 65 187..." } ]
1,511,963,477
2,147,483,647
Python 3
OK
TESTS
21
124
5,836,800
n = int(input()) head = 1 ; tail = n*n for _ in range (n): for i in range (n//2): print(head + i,tail - i,end=' ') head += n//2 ; tail -= n//2
Title: Candy Bags Time Limit: None seconds Memory Limit: None megabytes Problem Description: Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies. Help him give *n* bags of candies to each brother so that all brothers got the same number of candies. Input Specification: The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers. Output Specification: Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order. It is guaranteed that the solution exists at the given limits. Demo Input: ['2\n'] Demo Output: ['1 4\n2 3\n'] Note: The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother.
```python n = int(input()) head = 1 ; tail = n*n for _ in range (n): for i in range (n//2): print(head + i,tail - i,end=' ') head += n//2 ; tail -= n//2 ```
3
313
A
Ilya and Bank Account
PROGRAMMING
900
[ "implementation", "number theory" ]
null
null
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account.
In a single line print an integer — the maximum state of the bank account that Ilya can get.
[ "2230\n", "-10\n", "-100003\n" ]
[ "2230\n", "0\n", "-10000\n" ]
In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
500
[ { "input": "2230", "output": "2230" }, { "input": "-10", "output": "0" }, { "input": "-100003", "output": "-10000" }, { "input": "544883178", "output": "544883178" }, { "input": "-847251738", "output": "-84725173" }, { "input": "423654797", "output": "423654797" }, { "input": "-623563697", "output": "-62356367" }, { "input": "645894116", "output": "645894116" }, { "input": "-384381709", "output": "-38438170" }, { "input": "437587210", "output": "437587210" }, { "input": "-297534606", "output": "-29753460" }, { "input": "891773002", "output": "891773002" }, { "input": "-56712976", "output": "-5671296" }, { "input": "963662765", "output": "963662765" }, { "input": "-272656295", "output": "-27265625" }, { "input": "383441522", "output": "383441522" }, { "input": "-477665112", "output": "-47766511" }, { "input": "791725034", "output": "791725034" }, { "input": "-812168727", "output": "-81216872" }, { "input": "528894922", "output": "528894922" }, { "input": "-479977172", "output": "-47997712" }, { "input": "568044564", "output": "568044564" }, { "input": "-392784794", "output": "-39278474" }, { "input": "925596634", "output": "925596634" }, { "input": "-836078769", "output": "-83607876" }, { "input": "71036059", "output": "71036059" }, { "input": "-337396162", "output": "-33739612" }, { "input": "87129297", "output": "87129297" }, { "input": "-648171877", "output": "-64817187" }, { "input": "20218400", "output": "20218400" }, { "input": "10", "output": "10" }, { "input": "1000000000", "output": "1000000000" }, { "input": "-1000000000", "output": "-100000000" }, { "input": "-102", "output": "-10" }, { "input": "-120", "output": "-10" }, { "input": "-20", "output": "0" }, { "input": "-15", "output": "-1" }, { "input": "-5575533", "output": "-557553" }, { "input": "-50", "output": "0" }, { "input": "-31", "output": "-1" }, { "input": "-55", "output": "-5" }, { "input": "-81", "output": "-1" }, { "input": "-99", "output": "-9" }, { "input": "-23", "output": "-2" }, { "input": "-41", "output": "-1" }, { "input": "-24", "output": "-2" }, { "input": "46", "output": "46" } ]
1,684,608,768
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
1
62
0
a = input() if int(a)>0: print(a) else: if int(a[0:-1]) > int(a[0:-2] + a[-1]): print(a[0:-1]) else: print(a[0:-2] + a[-1])
Title: Ilya and Bank Account Time Limit: None seconds Memory Limit: None megabytes Problem Description: Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money. Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance. Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift. Input Specification: The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account. Output Specification: In a single line print an integer — the maximum state of the bank account that Ilya can get. Demo Input: ['2230\n', '-10\n', '-100003\n'] Demo Output: ['2230\n', '0\n', '-10000\n'] Note: In the first test sample Ilya doesn't profit from using the present. In the second test sample you can delete digit 1 and get the state of the account equal to 0.
```python a = input() if int(a)>0: print(a) else: if int(a[0:-1]) > int(a[0:-2] + a[-1]): print(a[0:-1]) else: print(a[0:-2] + a[-1]) ```
0
808
C
Tea Party
PROGRAMMING
1,400
[ "constructive algorithms", "greedy", "sortings" ]
null
null
Polycarp invited all his friends to the tea party to celebrate the holiday. He has *n* cups, one for each of his *n* friends, with volumes *a*1,<=*a*2,<=...,<=*a**n*. His teapot stores *w* milliliters of tea (*w*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*). Polycarp wants to pour tea in cups in such a way that: - Every cup will contain tea for at least half of its volume - Every cup will contain integer number of milliliters of tea - All the tea from the teapot will be poured into cups - All friends will be satisfied. Friend with cup *i* won't be satisfied, if there exists such cup *j* that cup *i* contains less tea than cup *j* but *a**i*<=&gt;<=*a**j*. For each cup output how many milliliters of tea should be poured in it. If it's impossible to pour all the tea and satisfy all conditions then output -1.
The first line contains two integer numbers *n* and *w* (1<=≤<=*n*<=≤<=100, ). The second line contains *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
Output how many milliliters of tea every cup should contain. If there are multiple answers, print any of them. If it's impossible to pour all the tea and satisfy all conditions then output -1.
[ "2 10\n8 7\n", "4 4\n1 1 1 1\n", "3 10\n9 8 10\n" ]
[ "6 4 \n", "1 1 1 1 \n", "-1\n" ]
In the third example you should pour to the first cup at least 5 milliliters, to the second one at least 4, to the third one at least 5. It sums up to 14, which is greater than 10 milliliters available.
0
[ { "input": "2 10\n8 7", "output": "6 4 " }, { "input": "4 4\n1 1 1 1", "output": "1 1 1 1 " }, { "input": "3 10\n9 8 10", "output": "-1" }, { "input": "1 1\n1", "output": "1 " }, { "input": "1 1\n2", "output": "1 " }, { "input": "1 10\n20", "output": "10 " }, { "input": "3 10\n8 4 8", "output": "4 2 4 " }, { "input": "3 100\n37 26 37", "output": "37 26 37 " }, { "input": "3 60\n43 23 24", "output": "36 12 12 " }, { "input": "20 14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "20 8\n1 2 1 2 1 1 1 2 1 1 1 2 1 1 2 1 1 1 2 2", "output": "-1" }, { "input": "50 1113\n25 21 23 37 28 23 19 25 5 12 3 11 46 50 13 50 7 1 8 40 4 6 34 27 11 39 45 31 10 12 48 2 19 37 47 45 30 24 21 42 36 14 31 30 31 50 6 3 33 49", "output": "13 11 12 37 28 12 10 18 3 6 2 6 46 50 7 50 4 1 4 40 2 3 34 27 6 39 45 31 5 6 48 1 10 37 47 45 30 12 11 42 36 7 31 30 31 50 3 2 33 49 " }, { "input": "50 440\n14 69 33 38 83 65 21 66 89 3 93 60 31 16 61 20 42 64 13 1 50 50 74 58 67 61 52 22 69 68 18 33 28 59 4 8 96 32 84 85 87 87 61 89 2 47 15 64 88 18", "output": "-1" }, { "input": "100 640\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91", "output": "-1" }, { "input": "100 82\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "-1" }, { "input": "100 55\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1", "output": "-1" }, { "input": "30 50\n3 1 2 4 1 2 2 4 3 4 4 3 3 3 3 5 3 2 5 4 3 3 5 3 3 5 4 5 3 5", "output": "-1" }, { "input": "40 100\n3 3 3 3 4 1 1 1 1 1 2 2 1 3 1 2 3 2 1 2 2 2 1 4 2 2 3 3 3 2 4 6 4 4 3 2 2 2 4 5", "output": "3 3 3 3 4 1 1 1 1 1 2 2 1 3 1 2 3 2 1 2 2 2 1 4 2 2 3 3 3 2 4 6 4 4 3 2 2 2 4 5 " }, { "input": "100 10000\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100", "output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 " }, { "input": "2 5\n3 4", "output": "2 3 " }, { "input": "2 6\n2 6", "output": "1 5 " }, { "input": "23 855\n5 63 94 57 38 84 77 79 83 36 47 31 60 79 75 48 88 17 46 33 23 15 27", "output": "3 32 94 29 19 84 39 72 83 18 24 16 30 79 38 24 88 9 23 17 12 8 14 " }, { "input": "52 2615\n73 78 70 92 94 74 46 19 55 20 70 3 1 42 68 10 66 80 1 31 65 19 73 74 56 35 53 38 92 35 65 81 6 98 74 51 27 49 76 19 86 76 5 60 14 75 64 99 43 7 36 79", "output": "73 78 70 92 94 74 46 10 55 10 70 2 1 42 68 5 66 80 1 16 65 10 73 74 56 18 53 38 92 30 65 81 3 98 74 51 14 49 76 10 86 76 3 60 7 75 64 99 43 4 36 79 " }, { "input": "11 287\n34 30 69 86 22 53 11 91 62 44 5", "output": "17 15 35 43 11 27 6 77 31 22 3 " }, { "input": "55 1645\n60 53 21 20 87 48 10 21 76 35 52 41 82 86 93 11 93 86 34 15 37 63 57 3 57 57 32 8 55 25 29 38 46 22 13 87 27 35 40 83 5 7 6 18 88 25 4 59 95 62 31 93 98 50 62", "output": "30 27 11 10 82 24 5 11 38 18 26 21 41 43 93 6 93 43 17 8 19 32 29 2 29 29 16 4 28 13 15 19 23 11 7 87 14 18 20 42 3 4 3 9 88 13 2 30 95 31 16 93 98 25 31 " }, { "input": "71 3512\n97 46 76 95 81 96 99 83 10 50 19 18 73 5 41 60 12 73 60 31 21 64 88 61 43 57 61 19 75 35 41 85 12 59 32 47 37 43 35 92 90 47 3 98 21 18 61 79 39 86 74 8 52 33 39 27 93 54 35 38 96 36 83 51 97 10 8 66 75 87 68", "output": "97 46 76 95 81 96 99 83 5 50 10 9 73 3 41 60 6 73 60 16 11 64 88 61 43 57 61 10 75 18 41 85 6 59 16 47 19 43 18 92 90 47 2 98 11 9 61 79 20 86 74 4 52 17 21 14 93 54 18 19 96 18 83 51 97 5 4 66 75 87 68 " }, { "input": "100 2633\n99 50 64 81 75 73 26 31 31 36 95 12 100 2 70 72 78 56 76 23 94 8 91 1 39 82 97 67 64 25 71 90 48 34 31 46 64 37 46 50 99 93 14 56 1 89 95 89 50 52 12 58 43 65 45 88 90 14 38 19 6 15 91 67 43 48 82 20 11 48 33 20 39 52 73 5 25 84 26 54 42 56 10 28 9 63 60 98 30 1 25 74 86 56 85 9 12 94 80 95", "output": "50 25 32 41 38 37 13 16 16 18 48 6 61 1 35 36 39 28 38 12 47 4 46 1 20 41 49 34 32 13 36 45 24 17 16 23 32 19 23 25 50 47 7 28 1 45 48 45 25 26 6 29 22 33 23 44 45 7 19 10 3 8 46 34 22 24 41 10 6 24 17 10 20 26 37 3 13 42 13 27 21 28 5 14 5 32 30 49 15 1 13 37 43 28 43 5 6 47 40 48 " }, { "input": "71 1899\n23 55 58 87 69 85 100 21 19 72 81 68 20 25 29 92 18 74 89 70 53 7 78 57 41 79 64 87 63 76 95 84 1 28 32 1 79 34 77 17 71 61 35 31 62 92 69 99 60 26 2 18 61 9 27 77 82 6 30 65 52 3 51 43 13 77 41 59 19 29 86", "output": "12 28 29 44 35 43 95 11 10 36 41 34 10 13 15 46 9 37 45 35 27 4 39 29 21 40 32 44 32 38 48 42 1 14 16 1 40 17 39 9 36 31 18 16 31 46 35 50 30 13 1 9 31 5 14 39 41 3 15 33 26 2 26 22 7 39 21 30 10 15 43 " }, { "input": "10 21\n3 3 3 3 4 3 3 3 3 3", "output": "2 2 2 2 3 2 2 2 2 2 " } ]
1,495,366,059
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
0
46
0
import math from itertools import * n, w = map(int, input().split()) p = list(map(int, input().split())) q = list(sorted([[p[i], i] for i in range(len(p))], key=lambda l: l[0])) res = sum(math.ceil(q[i][0]/2) for i in range(len(q))) if res > w: print(-1) else: res_list = list(repeat(0, len(p))) for i in range(len(q)): res_list[q[i][1]] = math.ceil(q[i][0]/2) for i in range(len(res_list)): print(res_list[i])
Title: Tea Party Time Limit: None seconds Memory Limit: None megabytes Problem Description: Polycarp invited all his friends to the tea party to celebrate the holiday. He has *n* cups, one for each of his *n* friends, with volumes *a*1,<=*a*2,<=...,<=*a**n*. His teapot stores *w* milliliters of tea (*w*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*). Polycarp wants to pour tea in cups in such a way that: - Every cup will contain tea for at least half of its volume - Every cup will contain integer number of milliliters of tea - All the tea from the teapot will be poured into cups - All friends will be satisfied. Friend with cup *i* won't be satisfied, if there exists such cup *j* that cup *i* contains less tea than cup *j* but *a**i*<=&gt;<=*a**j*. For each cup output how many milliliters of tea should be poured in it. If it's impossible to pour all the tea and satisfy all conditions then output -1. Input Specification: The first line contains two integer numbers *n* and *w* (1<=≤<=*n*<=≤<=100, ). The second line contains *n* numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100). Output Specification: Output how many milliliters of tea every cup should contain. If there are multiple answers, print any of them. If it's impossible to pour all the tea and satisfy all conditions then output -1. Demo Input: ['2 10\n8 7\n', '4 4\n1 1 1 1\n', '3 10\n9 8 10\n'] Demo Output: ['6 4 \n', '1 1 1 1 \n', '-1\n'] Note: In the third example you should pour to the first cup at least 5 milliliters, to the second one at least 4, to the third one at least 5. It sums up to 14, which is greater than 10 milliliters available.
```python import math from itertools import * n, w = map(int, input().split()) p = list(map(int, input().split())) q = list(sorted([[p[i], i] for i in range(len(p))], key=lambda l: l[0])) res = sum(math.ceil(q[i][0]/2) for i in range(len(q))) if res > w: print(-1) else: res_list = list(repeat(0, len(p))) for i in range(len(q)): res_list[q[i][1]] = math.ceil(q[i][0]/2) for i in range(len(res_list)): print(res_list[i]) ```
0
239
A
Two Bags of Potatoes
PROGRAMMING
1,200
[ "greedy", "implementation", "math" ]
null
null
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*. Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once. If there are no such values of *x* print a single integer -1.
[ "10 1 10\n", "10 6 40\n" ]
[ "-1\n", "2 8 14 20 26 \n" ]
none
500
[ { "input": "10 1 10", "output": "-1" }, { "input": "10 6 40", "output": "2 8 14 20 26 " }, { "input": "10 1 20", "output": "1 2 3 4 5 6 7 8 9 10 " }, { "input": "1 10000 1000000000", "output": "9999 19999 29999 39999 49999 59999 69999 79999 89999 99999 109999 119999 129999 139999 149999 159999 169999 179999 189999 199999 209999 219999 229999 239999 249999 259999 269999 279999 289999 299999 309999 319999 329999 339999 349999 359999 369999 379999 389999 399999 409999 419999 429999 439999 449999 459999 469999 479999 489999 499999 509999 519999 529999 539999 549999 559999 569999 579999 589999 599999 609999 619999 629999 639999 649999 659999 669999 679999 689999 699999 709999 719999 729999 739999 7499..." }, { "input": "84817 1 33457", "output": "-1" }, { "input": "21 37 99", "output": "16 53 " }, { "input": "78 7 15", "output": "-1" }, { "input": "74 17 27", "output": "-1" }, { "input": "79 23 43", "output": "-1" }, { "input": "32 33 3", "output": "-1" }, { "input": "55 49 44", "output": "-1" }, { "input": "64 59 404", "output": "54 113 172 231 290 " }, { "input": "61 69 820", "output": "8 77 146 215 284 353 422 491 560 629 698 " }, { "input": "17 28 532", "output": "11 39 67 95 123 151 179 207 235 263 291 319 347 375 403 431 459 487 515 " }, { "input": "46592 52 232", "output": "-1" }, { "input": "1541 58 648", "output": "-1" }, { "input": "15946 76 360", "output": "-1" }, { "input": "30351 86 424", "output": "-1" }, { "input": "1 2 37493", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..." }, { "input": "1 3 27764", "output": "2 5 8 11 14 17 20 23 26 29 32 35 38 41 44 47 50 53 56 59 62 65 68 71 74 77 80 83 86 89 92 95 98 101 104 107 110 113 116 119 122 125 128 131 134 137 140 143 146 149 152 155 158 161 164 167 170 173 176 179 182 185 188 191 194 197 200 203 206 209 212 215 218 221 224 227 230 233 236 239 242 245 248 251 254 257 260 263 266 269 272 275 278 281 284 287 290 293 296 299 302 305 308 311 314 317 320 323 326 329 332 335 338 341 344 347 350 353 356 359 362 365 368 371 374 377 380 383 386 389 392 395 398 401 404 407 410..." }, { "input": "10 4 9174", "output": "2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 102 106 110 114 118 122 126 130 134 138 142 146 150 154 158 162 166 170 174 178 182 186 190 194 198 202 206 210 214 218 222 226 230 234 238 242 246 250 254 258 262 266 270 274 278 282 286 290 294 298 302 306 310 314 318 322 326 330 334 338 342 346 350 354 358 362 366 370 374 378 382 386 390 394 398 402 406 410 414 418 422 426 430 434 438 442 446 450 454 458 462 466 470 474 478 482 486 490 494 498 502 506 510 514 518 522 526 530 534 53..." }, { "input": "33 7 4971", "output": "2 9 16 23 30 37 44 51 58 65 72 79 86 93 100 107 114 121 128 135 142 149 156 163 170 177 184 191 198 205 212 219 226 233 240 247 254 261 268 275 282 289 296 303 310 317 324 331 338 345 352 359 366 373 380 387 394 401 408 415 422 429 436 443 450 457 464 471 478 485 492 499 506 513 520 527 534 541 548 555 562 569 576 583 590 597 604 611 618 625 632 639 646 653 660 667 674 681 688 695 702 709 716 723 730 737 744 751 758 765 772 779 786 793 800 807 814 821 828 835 842 849 856 863 870 877 884 891 898 905 912 919..." }, { "input": "981 1 3387", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "386 1 2747", "output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..." }, { "input": "123 2 50000", "output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..." }, { "input": "3123 100 10000000", "output": "77 177 277 377 477 577 677 777 877 977 1077 1177 1277 1377 1477 1577 1677 1777 1877 1977 2077 2177 2277 2377 2477 2577 2677 2777 2877 2977 3077 3177 3277 3377 3477 3577 3677 3777 3877 3977 4077 4177 4277 4377 4477 4577 4677 4777 4877 4977 5077 5177 5277 5377 5477 5577 5677 5777 5877 5977 6077 6177 6277 6377 6477 6577 6677 6777 6877 6977 7077 7177 7277 7377 7477 7577 7677 7777 7877 7977 8077 8177 8277 8377 8477 8577 8677 8777 8877 8977 9077 9177 9277 9377 9477 9577 9677 9777 9877 9977 10077 10177 10277 1037..." }, { "input": "2 10000 1000000000", "output": "9998 19998 29998 39998 49998 59998 69998 79998 89998 99998 109998 119998 129998 139998 149998 159998 169998 179998 189998 199998 209998 219998 229998 239998 249998 259998 269998 279998 289998 299998 309998 319998 329998 339998 349998 359998 369998 379998 389998 399998 409998 419998 429998 439998 449998 459998 469998 479998 489998 499998 509998 519998 529998 539998 549998 559998 569998 579998 589998 599998 609998 619998 629998 639998 649998 659998 669998 679998 689998 699998 709998 719998 729998 739998 7499..." }, { "input": "3 10000 1000000000", "output": "9997 19997 29997 39997 49997 59997 69997 79997 89997 99997 109997 119997 129997 139997 149997 159997 169997 179997 189997 199997 209997 219997 229997 239997 249997 259997 269997 279997 289997 299997 309997 319997 329997 339997 349997 359997 369997 379997 389997 399997 409997 419997 429997 439997 449997 459997 469997 479997 489997 499997 509997 519997 529997 539997 549997 559997 569997 579997 589997 599997 609997 619997 629997 639997 649997 659997 669997 679997 689997 699997 709997 719997 729997 739997 7499..." }, { "input": "12312223 10000 1000000000", "output": "7777 17777 27777 37777 47777 57777 67777 77777 87777 97777 107777 117777 127777 137777 147777 157777 167777 177777 187777 197777 207777 217777 227777 237777 247777 257777 267777 277777 287777 297777 307777 317777 327777 337777 347777 357777 367777 377777 387777 397777 407777 417777 427777 437777 447777 457777 467777 477777 487777 497777 507777 517777 527777 537777 547777 557777 567777 577777 587777 597777 607777 617777 627777 637777 647777 657777 667777 677777 687777 697777 707777 717777 727777 737777 7477..." }, { "input": "500000000 1000000000 1000000000", "output": "500000000 " }, { "input": "1 1000000000 1000000000", "output": "999999999 " }, { "input": "10 6 11", "output": "-1" }, { "input": "2 100 10", "output": "-1" }, { "input": "1 100000007 1000000000", "output": "100000006 200000013 300000020 400000027 500000034 600000041 700000048 800000055 900000062 " }, { "input": "1 999999999 1000000000", "output": "999999998 " }, { "input": "100000000 1000000000 1000000000", "output": "900000000 " }, { "input": "11 2 12", "output": "1 " }, { "input": "31 10 39", "output": "-1" }, { "input": "48 6 50", "output": "-1" }, { "input": "500000000 500000000 1000000000", "output": "500000000 " }, { "input": "1 1000000000 999999999", "output": "-1" }, { "input": "4 2 10", "output": "2 4 6 " }, { "input": "1000000000 1 1", "output": "-1" }, { "input": "1000000000 1 100000", "output": "-1" }, { "input": "1000000000 1 10", "output": "-1" }, { "input": "10 5 14", "output": "-1" }, { "input": "500000000 499999999 1000000000", "output": "499999998 " }, { "input": "1 999999997 1000000000", "output": "999999996 " } ]
1,642,529,356
2,147,483,647
Python 3
TIME_LIMIT_EXCEEDED
TESTS
3
1,000
0
y, k, n = map(int,input().split()) start = 1 if y < k: start = y flag = False for i in range(start, n+1): if (i + y) <= n: if (i + y) % k == 0: flag = True print(i, end=' ') else: break if not flag: print(-1)
Title: Two Bags of Potatoes Time Limit: None seconds Memory Limit: None megabytes Problem Description: Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*. Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order. Input Specification: The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105). Output Specification: Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once. If there are no such values of *x* print a single integer -1. Demo Input: ['10 1 10\n', '10 6 40\n'] Demo Output: ['-1\n', '2 8 14 20 26 \n'] Note: none
```python y, k, n = map(int,input().split()) start = 1 if y < k: start = y flag = False for i in range(start, n+1): if (i + y) <= n: if (i + y) % k == 0: flag = True print(i, end=' ') else: break if not flag: print(-1) ```
0
766
B
Mahmoud and a Triangle
PROGRAMMING
1,000
[ "constructive algorithms", "geometry", "greedy", "math", "number theory", "sortings" ]
null
null
Mahmoud has *n* line segments, the *i*-th of them has length *a**i*. Ehab challenged him to use exactly 3 line segments to form a non-degenerate triangle. Mahmoud doesn't accept challenges unless he is sure he can win, so he asked you to tell him if he should accept the challenge. Given the lengths of the line segments, check if he can choose exactly 3 of them to form a non-degenerate triangle. Mahmoud should use exactly 3 line segments, he can't concatenate two line segments or change any length. A non-degenerate triangle is a triangle with positive area.
The first line contains single integer *n* (3<=≤<=*n*<=≤<=105) — the number of line segments Mahmoud has. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the lengths of line segments Mahmoud has.
In the only line print "YES" if he can choose exactly three line segments and form a non-degenerate triangle with them, and "NO" otherwise.
[ "5\n1 5 3 2 4\n", "3\n4 1 2\n" ]
[ "YES\n", "NO\n" ]
For the first example, he can use line segments with lengths 2, 4 and 5 to form a non-degenerate triangle.
1,000
[ { "input": "5\n1 5 3 2 4", "output": "YES" }, { "input": "3\n4 1 2", "output": "NO" }, { "input": "30\n197 75 517 39724 7906061 1153471 3 15166 168284 3019844 272293 316 16 24548 42 118 5792 5 9373 1866366 4886214 24 2206 712886 104005 1363 836 64273 440585 3576", "output": "NO" }, { "input": "30\n229017064 335281886 247217656 670601882 743442492 615491486 544941439 911270108 474843964 803323771 177115397 62179276 390270885 754889875 881720571 902691435 154083299 328505383 761264351 182674686 94104683 357622370 573909964 320060691 33548810 247029007 812823597 946798893 813659359 710111761", "output": "YES" }, { "input": "40\n740553458 532562042 138583675 75471987 487348843 476240280 972115023 103690894 546736371 915774563 35356828 819948191 138721993 24257926 761587264 767176616 608310208 78275645 386063134 227581756 672567198 177797611 87579917 941781518 274774331 843623616 981221615 630282032 118843963 749160513 354134861 132333165 405839062 522698334 29698277 541005920 856214146 167344951 398332403 68622974", "output": "YES" }, { "input": "40\n155 1470176 7384 765965701 1075 4 561554 6227772 93 16304522 1744 662 3 292572860 19335 908613 42685804 347058 20 132560 3848974 69067081 58 2819 111752888 408 81925 30 11951 4564 251 26381275 473392832 50628 180819969 2378797 10076746 9 214492 31291", "output": "NO" }, { "input": "3\n1 1000000000 1000000000", "output": "YES" }, { "input": "4\n1 1000000000 1000000000 1000000000", "output": "YES" }, { "input": "3\n1 1000000000 1", "output": "NO" }, { "input": "5\n1 2 3 5 2", "output": "YES" }, { "input": "41\n19 161 4090221 118757367 2 45361275 1562319 596751 140871 97 1844 310910829 10708344 6618115 698 1 87059 33 2527892 12703 73396090 17326460 3 368811 20550 813975131 10 53804 28034805 7847 2992 33254 1139 227930 965568 261 4846 503064297 192153458 57 431", "output": "NO" }, { "input": "42\n4317083 530966905 202811311 104 389267 35 1203 18287479 125344279 21690 859122498 65 859122508 56790 1951 148683 457 1 22 2668100 8283 2 77467028 13405 11302280 47877251 328155592 35095 29589769 240574 4 10 1019123 6985189 629846 5118 169 1648973 91891 741 282 3159", "output": "YES" }, { "input": "43\n729551585 11379 5931704 330557 1653 15529406 729551578 278663905 1 729551584 2683 40656510 29802 147 1400284 2 126260 865419 51 17 172223763 86 1 534861 450887671 32 234 25127103 9597697 48226 7034 389 204294 2265706 65783617 4343 3665990 626 78034 106440137 5 18421 1023", "output": "YES" }, { "input": "44\n719528276 2 235 444692918 24781885 169857576 18164 47558 15316043 9465834 64879816 2234575 1631 853530 8 1001 621 719528259 84 6933 31 1 3615623 719528266 40097928 274835337 1381044 11225 2642 5850203 6 527506 18 104977753 76959 29393 49 4283 141 201482 380 1 124523 326015", "output": "YES" }, { "input": "45\n28237 82 62327732 506757 691225170 5 970 4118 264024506 313192 367 14713577 73933 691225154 6660 599 691225145 3473403 51 427200630 1326718 2146678 100848386 1569 27 163176119 193562 10784 45687 819951 38520653 225 119620 1 3 691225169 691225164 17445 23807072 1 9093493 5620082 2542 139 14", "output": "YES" }, { "input": "44\n165580141 21 34 55 1 89 144 17711 2 377 610 987 2584 13 5 4181 6765 10946 1597 8 28657 3 233 75025 121393 196418 317811 9227465 832040 1346269 2178309 3524578 5702887 1 14930352 102334155 24157817 39088169 63245986 701408733 267914296 433494437 514229 46368", "output": "NO" }, { "input": "3\n1 1000000000 999999999", "output": "NO" }, { "input": "5\n1 1 1 1 1", "output": "YES" }, { "input": "10\n1 10 100 1000 10000 100000 1000000 10000000 100000000 1000000000", "output": "NO" }, { "input": "5\n2 3 4 10 20", "output": "YES" }, { "input": "6\n18 23 40 80 160 161", "output": "YES" }, { "input": "4\n5 6 7 888", "output": "YES" }, { "input": "9\n1 1 2 2 4 5 10 10 20", "output": "YES" }, { "input": "7\n3 150 900 4 500 1500 5", "output": "YES" }, { "input": "3\n2 2 3", "output": "YES" }, { "input": "7\n1 2 100 200 250 1000000 2000000", "output": "YES" }, { "input": "8\n2 3 5 5 5 6 6 13", "output": "YES" }, { "input": "3\n2 3 4", "output": "YES" }, { "input": "6\n1 1 1 4 5 100", "output": "YES" }, { "input": "13\n1 2 3 5 8 13 22 34 55 89 144 233 377", "output": "YES" }, { "input": "4\n2 3 4 8", "output": "YES" }, { "input": "3\n5 6 7", "output": "YES" }, { "input": "5\n1 4 5 6 1000000", "output": "YES" }, { "input": "4\n5 6 7 20", "output": "YES" }, { "input": "6\n1 1 1 1 1 65", "output": "YES" }, { "input": "4\n3 4 5 100", "output": "YES" }, { "input": "3\n2 4 5", "output": "YES" }, { "input": "7\n1 1 1 1 1 10 1000", "output": "YES" }, { "input": "4\n1 1 2 3", "output": "NO" }, { "input": "11\n1 2 5 6 7 8 9 17 18 19 100", "output": "YES" }, { "input": "4\n5 16 20 200", "output": "YES" }, { "input": "5\n17 6 3 3 1", "output": "YES" }, { "input": "3\n1 1 1", "output": "YES" }, { "input": "6\n1 1 1 2 3 5", "output": "YES" }, { "input": "4\n2 4 6 6", "output": "YES" }, { "input": "9\n1 2 4 4 4 4 7 8 20", "output": "YES" }, { "input": "9\n1 1 2 5 5 5 10 10 20", "output": "YES" }, { "input": "7\n3 150 600 4 1700 6000 5", "output": "YES" }, { "input": "5\n5761 20966 27841 28800 29399", "output": "YES" }, { "input": "9\n1 2 3 6 7 10 11 12 24", "output": "YES" }, { "input": "4\n1 2 1 1", "output": "YES" }, { "input": "5\n1 1 2 3 4", "output": "YES" } ]
1,669,395,366
2,147,483,647
Python 3
WRONG_ANSWER
TESTS
2
46
0
n = int(input()) a = list(map(int, input().split())) a = sorted(a, reverse=True) s = 0 for i in range(n): kol = 0 if s >= 1: break for j in range(n): if kol >= 2: print('YES') s += 1 break if a[i] - a[j] > 0: kol += 1 else: print('NO')
Title: Mahmoud and a Triangle Time Limit: None seconds Memory Limit: None megabytes Problem Description: Mahmoud has *n* line segments, the *i*-th of them has length *a**i*. Ehab challenged him to use exactly 3 line segments to form a non-degenerate triangle. Mahmoud doesn't accept challenges unless he is sure he can win, so he asked you to tell him if he should accept the challenge. Given the lengths of the line segments, check if he can choose exactly 3 of them to form a non-degenerate triangle. Mahmoud should use exactly 3 line segments, he can't concatenate two line segments or change any length. A non-degenerate triangle is a triangle with positive area. Input Specification: The first line contains single integer *n* (3<=≤<=*n*<=≤<=105) — the number of line segments Mahmoud has. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the lengths of line segments Mahmoud has. Output Specification: In the only line print "YES" if he can choose exactly three line segments and form a non-degenerate triangle with them, and "NO" otherwise. Demo Input: ['5\n1 5 3 2 4\n', '3\n4 1 2\n'] Demo Output: ['YES\n', 'NO\n'] Note: For the first example, he can use line segments with lengths 2, 4 and 5 to form a non-degenerate triangle.
```python n = int(input()) a = list(map(int, input().split())) a = sorted(a, reverse=True) s = 0 for i in range(n): kol = 0 if s >= 1: break for j in range(n): if kol >= 2: print('YES') s += 1 break if a[i] - a[j] > 0: kol += 1 else: print('NO') ```
0
815
A
Karen and Game
PROGRAMMING
1,700
[ "brute force", "greedy", "implementation" ]
null
null
On the way to school, Karen became fixated on the puzzle game on her phone! The game is played as follows. In each level, you have a grid with *n* rows and *m* columns. Each cell originally contains the number 0. One move consists of choosing one row or column, and adding 1 to all of the cells in that row or column. To win the level, after all the moves, the number in the cell at the *i*-th row and *j*-th column should be equal to *g**i*,<=*j*. Karen is stuck on one level, and wants to know a way to beat this level using the minimum number of moves. Please, help her with this task!
The first line of input contains two integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of rows and the number of columns in the grid, respectively. The next *n* lines each contain *m* integers. In particular, the *j*-th integer in the *i*-th of these rows contains *g**i*,<=*j* (0<=≤<=*g**i*,<=*j*<=≤<=500).
If there is an error and it is actually not possible to beat the level, output a single integer -1. Otherwise, on the first line, output a single integer *k*, the minimum number of moves necessary to beat the level. The next *k* lines should each contain one of the following, describing the moves in the order they must be done: - row *x*, (1<=≤<=*x*<=≤<=*n*) describing a move of the form "choose the *x*-th row". - col *x*, (1<=≤<=*x*<=≤<=*m*) describing a move of the form "choose the *x*-th column". If there are multiple optimal solutions, output any one of them.
[ "3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1\n", "3 3\n0 0 0\n0 1 0\n0 0 0\n", "3 3\n1 1 1\n1 1 1\n1 1 1\n" ]
[ "4\nrow 1\nrow 1\ncol 4\nrow 3\n", "-1\n", "3\nrow 1\nrow 2\nrow 3\n" ]
In the first test case, Karen has a grid with 3 rows and 5 columns. She can perform the following 4 moves to beat the level: In the second test case, Karen has a grid with 3 rows and 3 columns. It is clear that it is impossible to beat the level; performing any move will create three 1s on the grid, but it is required to only have one 1 in the center. In the third test case, Karen has a grid with 3 rows and 3 columns. She can perform the following 3 moves to beat the level: Note that this is not the only solution; another solution, among others, is col 1, col 2, col 3.
500
[ { "input": "3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1", "output": "4\nrow 1\nrow 1\ncol 4\nrow 3" }, { "input": "3 3\n0 0 0\n0 1 0\n0 0 0", "output": "-1" }, { "input": "3 3\n1 1 1\n1 1 1\n1 1 1", "output": "3\nrow 1\nrow 2\nrow 3" }, { "input": "3 5\n2 4 2 2 3\n0 2 0 0 1\n1 3 1 1 2", "output": "6\nrow 1\nrow 1\ncol 2\ncol 2\ncol 5\nrow 3" }, { "input": "3 5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1", "output": "-1" }, { "input": "9 10\n14 5 6 4 8 9 4 14 14 13\n13 4 5 3 7 8 3 13 13 12\n16 7 8 6 10 11 6 16 16 15\n10 1 2 0 4 5 0 10 10 9\n11 2 3 1 5 6 1 11 11 10\n10 1 2 0 4 5 0 10 10 9\n12 3 4 2 6 7 2 12 12 11\n13 4 5 3 7 8 3 13 13 12\n13 4 5 3 7 8 3 13 13 12", "output": "73\nrow 1\nrow 1\nrow 1\nrow 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 2\ncol 3\ncol 3\ncol 5\ncol 5\ncol 5\ncol 5\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\nrow 2\nrow 2\nrow 2\nrow 3\nrow 3\nrow 3\nrow 3\nrow 3\nrow 3\nrow 5\nrow 7\nrow 7\nrow 8\nrow 8\nrow 8\nrow 9\nr..." }, { "input": "10 10\n30 30 30 33 30 33 30 33 30 33\n431 431 431 434 431 434 431 434 431 434\n19 19 19 22 19 22 19 22 19 22\n24 24 24 27 24 27 24 27 24 27\n5 5 5 8 5 8 5 8 5 8\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3", "output": "521\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\ncol 4\ncol 4\ncol 4\ncol 6\ncol 6\ncol 6\ncol 8\ncol 8\ncol 8\ncol 10\ncol 10\ncol 10\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\n..." }, { "input": "1 1\n0", "output": "0" }, { "input": "1 1\n500", "output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..." }, { "input": "10 10\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1", "output": "9\nrow 1\nrow 2\nrow 3\nrow 4\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10" }, { "input": "10 10\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1", "output": "9\ncol 1\ncol 2\ncol 3\ncol 4\ncol 5\ncol 6\ncol 8\ncol 9\ncol 10" }, { "input": "10 11\n8 7 10 15 5 13 12 9 14 11 6\n6 5 8 13 3 11 10 7 12 9 4\n10 9 12 17 7 15 14 11 16 13 8\n9 8 11 16 6 14 13 10 15 12 7\n12 11 14 19 9 17 16 13 18 15 10\n14 13 16 21 11 19 18 15 20 17 12\n7 6 9 14 4 12 11 8 13 10 5\n5 4 7 12 2 10 9 6 11 8 3\n11 10 13 18 8 16 15 12 17 14 9\n13 12 15 20 10 18 17 14 19 16 11", "output": "120\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 1\nrow 1\ncol 1\ncol 1\ncol 1\ncol 2\ncol 2\ncol 3\ncol 3\ncol 3\ncol 3\ncol 3\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 8\ncol 8\ncol 8\ncol 8\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 10\n..." }, { "input": "5 3\n2 2 2\n2 2 2\n2 2 2\n1 1 1\n2 2 2", "output": "7\ncol 1\ncol 2\ncol 3\nrow 1\nrow 2\nrow 3\nrow 5" }, { "input": "3 5\n2 2 2 1 2\n2 2 2 1 2\n2 2 2 1 2", "output": "7\nrow 1\nrow 2\nrow 3\ncol 1\ncol 2\ncol 3\ncol 5" }, { "input": "1 100\n396 314 350 362 287 349 266 289 297 305 235 226 256 385 302 304 253 192 298 238 360 366 163 340 247 395 318 260 252 281 178 188 252 379 212 187 354 232 225 159 290 335 387 234 383 215 356 182 323 280 195 209 263 215 322 262 334 157 189 214 195 386 220 209 177 193 368 174 270 329 388 237 260 343 230 173 254 371 327 266 193 178 161 209 335 310 323 323 353 172 368 307 329 234 363 264 334 266 305 209", "output": "11960\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\n..." }, { "input": "100 1\n173\n164\n99\n114\n255\n223\n280\n235\n207\n190\n136\n204\n206\n282\n253\n335\n267\n184\n288\n299\n263\n243\n341\n111\n278\n111\n214\n133\n125\n245\n99\n144\n232\n203\n131\n204\n117\n315\n269\n206\n262\n125\n212\n95\n220\n243\n141\n163\n311\n171\n222\n266\n141\n314\n329\n138\n187\n342\n272\n181\n300\n261\n339\n110\n194\n187\n183\n129\n151\n187\n129\n185\n322\n167\n99\n340\n285\n99\n176\n175\n272\n126\n220\n164\n237\n214\n96\n162\n129\n141\n144\n135\n172\n191\n155\n333\n186\n324\n237\n318", "output": "11282\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\n..." }, { "input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0", "output": "0" }, { "input": "100 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0", "output": "0" }, { "input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1", "output": "1\nrow 1" }, { "input": "100 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "1\ncol 1" }, { "input": "1 100\n500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500", "output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..." }, { "input": "100 1\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500", "output": "500\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\nco..." }, { "input": "2 1\n1\n1", "output": "1\ncol 1" }, { "input": "4 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "3\ncol 1\ncol 2\ncol 3" }, { "input": "2 1\n2\n2", "output": "2\ncol 1\ncol 1" }, { "input": "3 2\n1 1\n1 1\n1 1", "output": "2\ncol 1\ncol 2" }, { "input": "2 1\n1\n2", "output": "2\ncol 1\nrow 2" }, { "input": "2 3\n1 1 1\n1 1 1", "output": "2\nrow 1\nrow 2" }, { "input": "1 2\n1 1", "output": "1\nrow 1" }, { "input": "5 1\n1\n1\n1\n1\n1", "output": "1\ncol 1" }, { "input": "10 3\n101 201 301\n102 202 302\n103 203 303\n104 204 304\n105 205 305\n106 206 306\n107 207 307\n108 208 308\n109 209 309\n111 211 311", "output": "649\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\nco..." }, { "input": "2 1\n10\n10", "output": "10\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1" }, { "input": "4 3\n2 2 2\n2 2 2\n2 2 2\n2 2 2", "output": "6\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3" }, { "input": "3 1\n1\n1\n1", "output": "1\ncol 1" }, { "input": "8 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2", "output": "4\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "1 2\n2 2", "output": "2\nrow 1\nrow 1" }, { "input": "3 2\n2 3\n2 3\n2 3", "output": "5\ncol 1\ncol 2\ncol 1\ncol 2\ncol 2" }, { "input": "2 1\n3\n3", "output": "3\ncol 1\ncol 1\ncol 1" }, { "input": "6 2\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "2\ncol 1\ncol 2" }, { "input": "4 1\n1\n1\n1\n1", "output": "1\ncol 1" }, { "input": "2 5\n1 1 1 1 1\n1 1 1 1 1", "output": "2\nrow 1\nrow 2" }, { "input": "3 1\n500\n500\n500", "output": "500\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\nco..." }, { "input": "5 2\n1 1\n2 2\n2 2\n2 2\n2 2", "output": "6\ncol 1\ncol 2\nrow 2\nrow 3\nrow 4\nrow 5" }, { "input": "4 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3", "output": "9\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3" }, { "input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1", "output": "2\ncol 1\ncol 2" }, { "input": "1 4\n1 1 1 1", "output": "1\nrow 1" }, { "input": "3 1\n2\n3\n2", "output": "3\ncol 1\ncol 1\nrow 2" }, { "input": "1 5\n1 1 1 1 1", "output": "1\nrow 1" }, { "input": "2 4\n3 1 1 1\n3 1 1 1", "output": "4\nrow 1\nrow 2\ncol 1\ncol 1" }, { "input": "3 3\n1 1 1\n0 1 0\n0 0 0", "output": "-1" }, { "input": "3 2\n2 2\n1 1\n2 2", "output": "4\ncol 1\ncol 2\nrow 1\nrow 3" }, { "input": "2 1\n9\n9", "output": "9\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1" }, { "input": "1 7\n3 3 3 3 3 3 3", "output": "3\nrow 1\nrow 1\nrow 1" }, { "input": "5 2\n3 3\n3 3\n3 3\n3 3\n3 3", "output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "10 11\n250 198 192 182 85 239 295 91 318 216 249\n290 238 232 222 125 279 335 131 358 256 289\n409 357 351 341 244 398 454 250 477 375 408\n362 310 304 294 197 351 407 203 430 328 361\n352 300 294 284 187 341 397 193 420 318 351\n409 357 351 341 244 398 454 250 477 375 408\n209 157 151 141 44 198 254 50 277 175 208\n313 261 255 245 148 302 358 154 381 279 312\n171 119 113 103 6 160 216 12 239 137 170\n275 223 217 207 110 264 320 116 343 241 274", "output": "2770\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..." }, { "input": "7 1\n1\n1\n1\n1\n1\n1\n1", "output": "1\ncol 1" }, { "input": "5 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "3\ncol 1\ncol 2\ncol 3" }, { "input": "5 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3", "output": "9\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3" }, { "input": "2 1\n4\n5", "output": "5\ncol 1\ncol 1\ncol 1\ncol 1\nrow 2" }, { "input": "4 2\n3 3\n3 3\n3 3\n3 3", "output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "6 3\n2 2 2\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "4\ncol 1\ncol 2\ncol 3\nrow 1" }, { "input": "5 1\n1\n2\n3\n4\n5", "output": "11\ncol 1\nrow 2\nrow 3\nrow 3\nrow 4\nrow 4\nrow 4\nrow 5\nrow 5\nrow 5\nrow 5" }, { "input": "2 1\n1\n3", "output": "3\ncol 1\nrow 2\nrow 2" }, { "input": "3 2\n1 500\n1 500\n1 500", "output": "501\ncol 1\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\nco..." }, { "input": "10 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1", "output": "1\ncol 1" }, { "input": "6 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2", "output": "4\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "3 5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1", "output": "3\nrow 1\nrow 2\nrow 3" }, { "input": "2 3\n2 1 2\n2 1 2", "output": "4\nrow 1\nrow 2\ncol 1\ncol 3" }, { "input": "5 2\n2 2\n2 2\n2 2\n2 2\n2 2", "output": "4\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "1 2\n1 3", "output": "3\nrow 1\ncol 2\ncol 2" }, { "input": "4 3\n2 2 2\n1 1 1\n1 1 1\n1 1 1", "output": "4\ncol 1\ncol 2\ncol 3\nrow 1" }, { "input": "3 2\n1 1\n2 2\n3 3", "output": "5\ncol 1\ncol 2\nrow 2\nrow 3\nrow 3" }, { "input": "4 2\n1 1\n1 1\n1 1\n1 1", "output": "2\ncol 1\ncol 2" }, { "input": "3 4\n1 1 1 1\n1 1 1 1\n1 1 1 1", "output": "3\nrow 1\nrow 2\nrow 3" }, { "input": "2 1\n2\n3", "output": "3\ncol 1\ncol 1\nrow 2" }, { "input": "5 3\n2 2 2\n2 2 2\n2 2 2\n2 2 2\n2 2 2", "output": "6\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3" }, { "input": "3 2\n1 0\n2 1\n2 1", "output": "3\ncol 1\nrow 2\nrow 3" }, { "input": "3 2\n1 2\n2 3\n3 4", "output": "6\ncol 1\ncol 2\ncol 2\nrow 2\nrow 3\nrow 3" }, { "input": "3 3\n1 1 1\n1 2 1\n1 1 1", "output": "-1" }, { "input": "4 3\n2 1 1\n2 1 1\n2 1 1\n2 1 1", "output": "4\ncol 1\ncol 2\ncol 3\ncol 1" }, { "input": "4 1\n3\n3\n3\n3", "output": "3\ncol 1\ncol 1\ncol 1" }, { "input": "1 3\n2 3 2", "output": "3\nrow 1\nrow 1\ncol 2" }, { "input": "1 2\n1 2", "output": "2\nrow 1\ncol 2" }, { "input": "3 2\n2 2\n2 2\n2 2", "output": "4\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "1 3\n1 1 1", "output": "1\nrow 1" }, { "input": "6 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1", "output": "3\ncol 1\ncol 2\ncol 3" }, { "input": "3 1\n2\n2\n2", "output": "2\ncol 1\ncol 1" }, { "input": "3 1\n3\n3\n3", "output": "3\ncol 1\ncol 1\ncol 1" }, { "input": "3 2\n2 2\n1 1\n1 1", "output": "3\ncol 1\ncol 2\nrow 1" }, { "input": "5 3\n1 1 2\n1 1 2\n1 1 2\n1 1 2\n1 1 2", "output": "4\ncol 1\ncol 2\ncol 3\ncol 3" }, { "input": "1 2\n2 3", "output": "3\nrow 1\nrow 1\ncol 2" }, { "input": "5 1\n2\n2\n2\n2\n2", "output": "2\ncol 1\ncol 1" }, { "input": "3 2\n1 1\n2 2\n2 2", "output": "4\ncol 1\ncol 2\nrow 2\nrow 3" }, { "input": "3 3\n1 1 1\n2 3 3\n4 4 4", "output": "-1" }, { "input": "2 1\n5\n2", "output": "5\ncol 1\ncol 1\nrow 1\nrow 1\nrow 1" }, { "input": "4 2\n2 2\n2 2\n2 2\n2 2", "output": "4\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "3 2\n5 10\n5 10\n5 10", "output": "15\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2" }, { "input": "4 3\n3 4 3\n5 6 5\n3 4 3\n3 4 3", "output": "12\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 2\nrow 2\nrow 2" }, { "input": "4 2\n1 1\n1 1\n1 1\n2 2", "output": "3\ncol 1\ncol 2\nrow 4" }, { "input": "2 3\n1 1 1\n500 500 500", "output": "501\nrow 1\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nro..." }, { "input": "4 1\n4\n4\n4\n4", "output": "4\ncol 1\ncol 1\ncol 1\ncol 1" }, { "input": "3 2\n1 1\n1 1\n2 2", "output": "3\ncol 1\ncol 2\nrow 3" }, { "input": "2 3\n2 2 2\n2 2 2", "output": "4\nrow 1\nrow 2\nrow 1\nrow 2" }, { "input": "3 2\n3 3\n3 3\n3 3", "output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2" }, { "input": "2 3\n10 10 10\n5 5 5", "output": "15\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1" }, { "input": "5 2\n1 2\n1 2\n1 2\n1 2\n1 2", "output": "3\ncol 1\ncol 2\ncol 2" }, { "input": "1 2\n500 500", "output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..." }, { "input": "2 1\n5\n5", "output": "5\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1" } ]
1,691,785,891
2,147,483,647
PyPy 3-64
OK
TESTS
177
186
14,540,800
import sys input = lambda: sys.stdin.readline().rstrip() import math from heapq import heappush , heappop from collections import defaultdict,deque,Counter from bisect import * N,M = map(int, input().split()) AA = [] for _ in range(N): AA.append(list(map(int, input().split()))) #print(A) def deal1(A,N,M): B = [] for a in A: B.append(a[::]) A = B ans = [] for i in range(N): t = min(A[i]) for _ in range(t): ans.append(('row',i+1)) for j in range(M): A[i][j]-=t for j in range(M): t = float('inf') for i in range(N): t = min(t, A[i][j]) for _ in range(t): ans.append(('col',j+1)) for i in range(N): A[i][j]-=t for i in range(N): for j in range(M): if A[i][j]!=0: exit(print(-1)) return ans def deal2(A,N,M): B = [] for a in A: B.append(a[::]) A = B ans = [] for j in range(M): t = float('inf') for i in range(N): t = min(t, A[i][j]) for _ in range(t): ans.append(('col',j+1)) for i in range(N): A[i][j]-=t for i in range(N): t = min(A[i]) for _ in range(t): ans.append(('row',i+1)) for j in range(M): A[i][j]-=t for i in range(N): for j in range(M): if A[i][j]!=0: exit(print(-1)) return ans ans = deal1(AA,N,M) a2 = deal2(AA,N,M) if len(ans)>len(a2): ans = a2 print(len(ans)) for a,b in ans: print(a,b)
Title: Karen and Game Time Limit: None seconds Memory Limit: None megabytes Problem Description: On the way to school, Karen became fixated on the puzzle game on her phone! The game is played as follows. In each level, you have a grid with *n* rows and *m* columns. Each cell originally contains the number 0. One move consists of choosing one row or column, and adding 1 to all of the cells in that row or column. To win the level, after all the moves, the number in the cell at the *i*-th row and *j*-th column should be equal to *g**i*,<=*j*. Karen is stuck on one level, and wants to know a way to beat this level using the minimum number of moves. Please, help her with this task! Input Specification: The first line of input contains two integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of rows and the number of columns in the grid, respectively. The next *n* lines each contain *m* integers. In particular, the *j*-th integer in the *i*-th of these rows contains *g**i*,<=*j* (0<=≤<=*g**i*,<=*j*<=≤<=500). Output Specification: If there is an error and it is actually not possible to beat the level, output a single integer -1. Otherwise, on the first line, output a single integer *k*, the minimum number of moves necessary to beat the level. The next *k* lines should each contain one of the following, describing the moves in the order they must be done: - row *x*, (1<=≤<=*x*<=≤<=*n*) describing a move of the form "choose the *x*-th row". - col *x*, (1<=≤<=*x*<=≤<=*m*) describing a move of the form "choose the *x*-th column". If there are multiple optimal solutions, output any one of them. Demo Input: ['3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1\n', '3 3\n0 0 0\n0 1 0\n0 0 0\n', '3 3\n1 1 1\n1 1 1\n1 1 1\n'] Demo Output: ['4\nrow 1\nrow 1\ncol 4\nrow 3\n', '-1\n', '3\nrow 1\nrow 2\nrow 3\n'] Note: In the first test case, Karen has a grid with 3 rows and 5 columns. She can perform the following 4 moves to beat the level: In the second test case, Karen has a grid with 3 rows and 3 columns. It is clear that it is impossible to beat the level; performing any move will create three 1s on the grid, but it is required to only have one 1 in the center. In the third test case, Karen has a grid with 3 rows and 3 columns. She can perform the following 3 moves to beat the level: Note that this is not the only solution; another solution, among others, is col 1, col 2, col 3.
```python import sys input = lambda: sys.stdin.readline().rstrip() import math from heapq import heappush , heappop from collections import defaultdict,deque,Counter from bisect import * N,M = map(int, input().split()) AA = [] for _ in range(N): AA.append(list(map(int, input().split()))) #print(A) def deal1(A,N,M): B = [] for a in A: B.append(a[::]) A = B ans = [] for i in range(N): t = min(A[i]) for _ in range(t): ans.append(('row',i+1)) for j in range(M): A[i][j]-=t for j in range(M): t = float('inf') for i in range(N): t = min(t, A[i][j]) for _ in range(t): ans.append(('col',j+1)) for i in range(N): A[i][j]-=t for i in range(N): for j in range(M): if A[i][j]!=0: exit(print(-1)) return ans def deal2(A,N,M): B = [] for a in A: B.append(a[::]) A = B ans = [] for j in range(M): t = float('inf') for i in range(N): t = min(t, A[i][j]) for _ in range(t): ans.append(('col',j+1)) for i in range(N): A[i][j]-=t for i in range(N): t = min(A[i]) for _ in range(t): ans.append(('row',i+1)) for j in range(M): A[i][j]-=t for i in range(N): for j in range(M): if A[i][j]!=0: exit(print(-1)) return ans ans = deal1(AA,N,M) a2 = deal2(AA,N,M) if len(ans)>len(a2): ans = a2 print(len(ans)) for a,b in ans: print(a,b) ```
3