contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
106
|
B
|
Choosing Laptop
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] |
B. Choosing Laptop
|
2
|
256
|
Vasya is choosing a laptop. The shop has *n* laptops to all tastes.
Vasya is interested in the following properties: processor speed, ram and hdd. Vasya is a programmer and not a gamer which is why he is not interested in all other properties.
If all three properties of a laptop are strictly less than those properties of some other laptop, then the first laptop is considered outdated by Vasya. Among all laptops Vasya does not consider outdated, he chooses the cheapest one.
There are very many laptops, which is why Vasya decided to write a program that chooses the suitable laptop. However, Vasya doesn't have his own laptop yet and he asks you to help him.
|
The first line contains number *n* (1<=≤<=*n*<=≤<=100).
Then follow *n* lines. Each describes a laptop as *speed* *ram* *hdd* *cost*. Besides,
- *speed*, *ram*, *hdd* and *cost* are integers - 1000<=≤<=*speed*<=≤<=4200 is the processor's speed in megahertz - 256<=≤<=*ram*<=≤<=4096 the RAM volume in megabytes - 1<=≤<=*hdd*<=≤<=500 is the HDD in gigabytes - 100<=≤<=*cost*<=≤<=1000 is price in tugriks
All laptops have different prices.
|
Print a single number — the number of a laptop Vasya will choose. The laptops are numbered with positive integers from 1 to *n* in the order in which they are given in the input data.
|
[
"5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n"
] |
[
"4"
] |
In the third sample Vasya considers the first and fifth laptops outdated as all of their properties cannot match those of the third laptop. The fourth one is the cheapest among the laptops that are left. Thus, Vasya chooses the fourth laptop.
| 1,000
|
[
{
"input": "5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150",
"output": "4"
},
{
"input": "2\n1500 500 50 755\n1600 600 80 700",
"output": "2"
},
{
"input": "2\n1500 512 50 567\n1600 400 70 789",
"output": "1"
},
{
"input": "4\n1000 300 5 700\n1100 400 10 600\n1200 500 15 500\n1300 600 20 400",
"output": "4"
},
{
"input": "10\n2123 389 397 747\n2705 3497 413 241\n3640 984 470 250\n3013 2004 276 905\n3658 3213 353 602\n1428 626 188 523\n2435 1140 459 824\n2927 2586 237 860\n2361 4004 386 719\n2863 2429 476 310",
"output": "2"
},
{
"input": "25\n2123 389 397 747\n2705 3497 413 241\n3640 984 470 250\n3013 2004 276 905\n3658 3213 353 602\n1428 626 188 523\n2435 1140 459 824\n2927 2586 237 860\n2361 4004 386 719\n2863 2429 476 310\n3447 3875 1 306\n3950 1901 31 526\n4130 1886 152 535\n1951 1840 122 814\n1798 3722 474 106\n2305 3979 82 971\n3656 3148 349 992\n1062 1648 320 491\n3113 3706 302 542\n3545 1317 184 853\n1277 2153 95 492\n2189 3495 427 655\n4014 3030 22 963\n1455 3840 155 485\n2760 717 309 891",
"output": "15"
},
{
"input": "1\n1200 512 300 700",
"output": "1"
},
{
"input": "1\n4200 4096 500 1000",
"output": "1"
},
{
"input": "1\n1000 256 1 100",
"output": "1"
},
{
"input": "2\n2000 500 200 100\n3000 600 100 200",
"output": "1"
},
{
"input": "2\n2000 500 200 200\n3000 600 100 100",
"output": "2"
},
{
"input": "2\n2000 600 100 100\n3000 500 200 200",
"output": "1"
},
{
"input": "2\n2000 700 100 200\n3000 500 200 100",
"output": "2"
},
{
"input": "2\n3000 500 100 100\n1500 600 200 200",
"output": "1"
},
{
"input": "2\n3000 500 100 300\n1500 600 200 200",
"output": "2"
},
{
"input": "3\n3467 1566 191 888\n3047 3917 3 849\n1795 1251 97 281",
"output": "2"
},
{
"input": "4\n3835 1035 5 848\n2222 3172 190 370\n2634 2698 437 742\n1748 3112 159 546",
"output": "2"
},
{
"input": "5\n3511 981 276 808\n3317 2320 354 878\n3089 702 20 732\n1088 2913 327 756\n3837 691 173 933",
"output": "4"
},
{
"input": "6\n1185 894 287 455\n2465 3317 102 240\n2390 2353 81 615\n2884 603 170 826\n3202 2070 320 184\n3074 3776 497 466",
"output": "5"
},
{
"input": "7\n3987 1611 470 720\n1254 4048 226 626\n1747 630 25 996\n2336 2170 402 123\n1902 3952 337 663\n1416 271 77 499\n1802 1399 419 929",
"output": "4"
},
{
"input": "10\n3888 1084 420 278\n2033 277 304 447\n1774 514 61 663\n2055 3437 67 144\n1237 1590 145 599\n3648 663 244 525\n3691 2276 332 504\n1496 2655 324 313\n2462 1930 13 644\n1811 331 390 284",
"output": "4"
},
{
"input": "13\n3684 543 70 227\n3953 1650 151 681\n2452 655 102 946\n3003 990 121 411\n2896 1936 158 155\n1972 717 366 754\n3989 2237 32 521\n2738 2140 445 965\n2884 1772 251 369\n2240 741 465 209\n4073 2812 494 414\n3392 955 425 133\n4028 717 90 123",
"output": "11"
},
{
"input": "17\n3868 2323 290 182\n1253 3599 38 217\n2372 354 332 897\n1286 649 332 495\n1642 1643 301 216\n1578 792 140 299\n3329 3039 359 525\n1362 2006 172 183\n1058 3961 423 591\n3196 914 484 675\n3032 3752 217 954\n2391 2853 171 579\n4102 3170 349 516\n1218 1661 451 354\n3375 1997 196 404\n1030 918 198 893\n2546 2029 399 647",
"output": "14"
},
{
"input": "22\n1601 1091 249 107\n2918 3830 312 767\n4140 409 393 202\n3485 2409 446 291\n2787 530 272 147\n2303 3400 265 206\n2164 1088 143 667\n1575 2439 278 863\n2874 699 369 568\n4017 1625 368 641\n3446 916 53 509\n3627 3229 328 256\n1004 2525 109 670\n2369 3299 57 351\n4147 3038 73 309\n3510 3391 390 470\n3308 3139 268 736\n3733 1054 98 809\n3967 2992 408 873\n2104 3191 83 687\n2223 2910 209 563\n1406 2428 147 673",
"output": "3"
},
{
"input": "27\n1689 1927 40 270\n3833 2570 167 134\n2580 3589 390 300\n1898 2587 407 316\n1841 2772 411 187\n1296 288 407 506\n1215 263 236 307\n2737 1427 84 992\n1107 1879 284 866\n3311 2507 475 147\n2951 2214 209 375\n1352 2582 110 324\n2082 747 289 521\n2226 1617 209 108\n2253 1993 109 835\n2866 2360 29 206\n1431 3581 185 918\n3800 1167 463 943\n4136 1156 266 490\n3511 1396 478 169\n3498 1419 493 792\n2660 2165 204 172\n3509 2358 178 469\n1568 3564 276 319\n3871 2660 472 366\n3569 2829 146 761\n1365 2943 460 611",
"output": "10"
},
{
"input": "2\n1000 2000 300 120\n1000 2000 300 130",
"output": "1"
},
{
"input": "10\n2883 1110 230 501\n2662 821 163 215\n2776 1131 276 870\n2776 1131 276 596\n2776 1131 276 981\n2662 821 163 892\n2662 821 163 997\n2883 1110 230 132\n2776 1131 276 317\n2883 1110 230 481",
"output": "8"
},
{
"input": "23\n1578 3681 380 163\n2640 3990 180 576\n3278 2311 131 386\n3900 513 443 873\n1230 1143 267 313\n2640 3990 180 501\n1230 1143 267 428\n1578 3681 380 199\n1578 3681 380 490\n3900 513 443 980\n3900 513 443 882\n3278 2311 131 951\n3278 2311 131 863\n2640 3990 180 916\n3278 2311 131 406\n3278 2311 131 455\n3278 2311 131 239\n1230 1143 267 439\n3900 513 443 438\n3900 513 443 514\n3278 2311 131 526\n1578 3681 380 123\n1578 3681 380 263",
"output": "22"
},
{
"input": "6\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n1000 256 1 100",
"output": "4"
},
{
"input": "2\n1000 256 1 100\n1000 256 1 101",
"output": "1"
},
{
"input": "2\n1500 500 300 1000\n1500 500 300 900",
"output": "2"
},
{
"input": "4\n1000 256 1 500\n1000 256 1 400\n1000 256 1 300\n1000 256 1 200",
"output": "4"
},
{
"input": "3\n1500 1024 300 150\n1200 512 150 100\n1000 256 50 200",
"output": "1"
}
] | 1,638,078,677
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 92
| 0
|
class laptop:
def __init__(self, speed, ram, hdd, cost):
self.speed = speed
self.ram = ram
self.hdd = hdd
self.cost = cost
def solve(laptops, t):
check = [0]*t
for i in range(0, t):
for j in range(0, t):
if (i != j):
if ((laptops[i].speed < laptops[j].speed) and (laptops[i].ram < laptops[j].ram) and (laptops[i].hdd < laptops[j].hdd)):
check[i] = 1
res = {}
for i in range(0, t):
if check[i] == 1:
lap = {i: laptops[i].cost}
res.update(lap)
return min(res, key=res.get)
def main():
t = int(input())
laptops = [laptop]*t
for i in range(0, t):
s, r, h, c = map(int, input().split(" "))
laptops[i] = laptop(s, r, h, c)
print(solve(laptops, t))
if __name__ == '__main__':
main()
|
Title: Choosing Laptop
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is choosing a laptop. The shop has *n* laptops to all tastes.
Vasya is interested in the following properties: processor speed, ram and hdd. Vasya is a programmer and not a gamer which is why he is not interested in all other properties.
If all three properties of a laptop are strictly less than those properties of some other laptop, then the first laptop is considered outdated by Vasya. Among all laptops Vasya does not consider outdated, he chooses the cheapest one.
There are very many laptops, which is why Vasya decided to write a program that chooses the suitable laptop. However, Vasya doesn't have his own laptop yet and he asks you to help him.
Input Specification:
The first line contains number *n* (1<=≤<=*n*<=≤<=100).
Then follow *n* lines. Each describes a laptop as *speed* *ram* *hdd* *cost*. Besides,
- *speed*, *ram*, *hdd* and *cost* are integers - 1000<=≤<=*speed*<=≤<=4200 is the processor's speed in megahertz - 256<=≤<=*ram*<=≤<=4096 the RAM volume in megabytes - 1<=≤<=*hdd*<=≤<=500 is the HDD in gigabytes - 100<=≤<=*cost*<=≤<=1000 is price in tugriks
All laptops have different prices.
Output Specification:
Print a single number — the number of a laptop Vasya will choose. The laptops are numbered with positive integers from 1 to *n* in the order in which they are given in the input data.
Demo Input:
['5\n2100 512 150 200\n2000 2048 240 350\n2300 1024 200 320\n2500 2048 80 300\n2000 512 180 150\n']
Demo Output:
['4']
Note:
In the third sample Vasya considers the first and fifth laptops outdated as all of their properties cannot match those of the third laptop. The fourth one is the cheapest among the laptops that are left. Thus, Vasya chooses the fourth laptop.
|
```python
class laptop:
def __init__(self, speed, ram, hdd, cost):
self.speed = speed
self.ram = ram
self.hdd = hdd
self.cost = cost
def solve(laptops, t):
check = [0]*t
for i in range(0, t):
for j in range(0, t):
if (i != j):
if ((laptops[i].speed < laptops[j].speed) and (laptops[i].ram < laptops[j].ram) and (laptops[i].hdd < laptops[j].hdd)):
check[i] = 1
res = {}
for i in range(0, t):
if check[i] == 1:
lap = {i: laptops[i].cost}
res.update(lap)
return min(res, key=res.get)
def main():
t = int(input())
laptops = [laptop]*t
for i in range(0, t):
s, r, h, c = map(int, input().split(" "))
laptops[i] = laptop(s, r, h, c)
print(solve(laptops, t))
if __name__ == '__main__':
main()
```
| 0
|
119
|
A
|
Epic Game
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
|
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
|
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
|
[
"3 5 9\n",
"1 1 100\n"
] |
[
"0",
"1"
] |
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
| 500
|
[
{
"input": "3 5 9",
"output": "0"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "23 12 16",
"output": "1"
},
{
"input": "95 26 29",
"output": "1"
},
{
"input": "73 32 99",
"output": "1"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "41 12 65",
"output": "1"
},
{
"input": "13 61 100",
"output": "1"
},
{
"input": "100 100 10",
"output": "0"
},
{
"input": "12 24 26",
"output": "1"
},
{
"input": "73 21 96",
"output": "1"
},
{
"input": "17 22 81",
"output": "1"
},
{
"input": "14 88 97",
"output": "1"
},
{
"input": "42 81 17",
"output": "0"
},
{
"input": "34 36 19",
"output": "1"
},
{
"input": "21 87 12",
"output": "1"
},
{
"input": "97 92 98",
"output": "1"
},
{
"input": "49 25 62",
"output": "1"
},
{
"input": "29 17 44",
"output": "1"
},
{
"input": "10 1 10",
"output": "0"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "100 100 1",
"output": "0"
},
{
"input": "11 99 55",
"output": "0"
},
{
"input": "8 13 21",
"output": "0"
},
{
"input": "34 55 89",
"output": "0"
},
{
"input": "21 34 55",
"output": "1"
},
{
"input": "13 21 34",
"output": "1"
},
{
"input": "34 21 55",
"output": "0"
},
{
"input": "10 20 84",
"output": "1"
},
{
"input": "4 2 5",
"output": "0"
},
{
"input": "3 2 3",
"output": "0"
},
{
"input": "31 23 1",
"output": "0"
},
{
"input": "100 100 100",
"output": "0"
},
{
"input": "100 1 100",
"output": "0"
},
{
"input": "1 100 100",
"output": "1"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "17 23 100",
"output": "1"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "1 1 2",
"output": "1"
},
{
"input": "2 1 1",
"output": "0"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "2 1 2",
"output": "0"
},
{
"input": "10 10 3",
"output": "1"
},
{
"input": "2 2 1",
"output": "0"
},
{
"input": "9 5 1",
"output": "0"
}
] | 1,591,504,325
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 216
| 307,200
|
a,b,n=map(int,input().split())
def gcd(a,b,n,c):
if c==0:
m=min(a,n)
else:
m=min(b,n)
while True:
if c==0:
if a%m==0 and n%m==0:
return n-m
else:
m-=1
else:
if b%m==0 and n%m==0:
return n-m
else:
m-=1
i=0
while n!=0:
if i%2==0:
c=0
else:
c=1
n=gcd(a,b,n,c)
i+=1
print(c)
|
Title: Epic Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
Input Specification:
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
Output Specification:
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
Demo Input:
['3 5 9\n', '1 1 100\n']
Demo Output:
['0', '1']
Note:
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
|
```python
a,b,n=map(int,input().split())
def gcd(a,b,n,c):
if c==0:
m=min(a,n)
else:
m=min(b,n)
while True:
if c==0:
if a%m==0 and n%m==0:
return n-m
else:
m-=1
else:
if b%m==0 and n%m==0:
return n-m
else:
m-=1
i=0
while n!=0:
if i%2==0:
c=0
else:
c=1
n=gcd(a,b,n,c)
i+=1
print(c)
```
| 3
|
|
265
|
A
|
Colorful Stones (Simplified Edition)
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
|
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
|
Print the final 1-based position of Liss in a single line.
|
[
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] |
[
"2\n",
"3\n",
"15\n"
] |
none
| 500
|
[
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,629,456,111
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 154
| 20,172,800
|
a=str(input())
b=str(input())
ans=0
for i in range(len(b)-1):
if a[ans]==b[i] and ans <len(a):
ans+=1
print(ans+1)
|
Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none
|
```python
a=str(input())
b=str(input())
ans=0
for i in range(len(b)-1):
if a[ans]==b[i] and ans <len(a):
ans+=1
print(ans+1)
```
| 0
|
|
6
|
C
|
Alice, Bob and Chocolate
|
PROGRAMMING
| 1,200
|
[
"greedy",
"two pointers"
] |
C. Alice, Bob and Chocolate
|
2
|
64
|
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
|
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
|
[
"5\n2 9 8 2 7\n"
] |
[
"2 3\n"
] |
none
| 0
|
[
{
"input": "5\n2 9 8 2 7",
"output": "2 3"
},
{
"input": "1\n1",
"output": "1 0"
},
{
"input": "2\n1 1",
"output": "1 1"
},
{
"input": "3\n1 1 1",
"output": "2 1"
},
{
"input": "4\n1 1 1 1",
"output": "2 2"
},
{
"input": "1\n6",
"output": "1 0"
},
{
"input": "2\n8 2",
"output": "1 1"
},
{
"input": "3\n6 8 4",
"output": "1 2"
},
{
"input": "4\n4 3 2 8",
"output": "3 1"
},
{
"input": "5\n1 9 8 2 7",
"output": "2 3"
},
{
"input": "6\n1 4 7 3 2 1",
"output": "3 3"
},
{
"input": "11\n7 9 1 8 7 1 7 1 4 8 1",
"output": "4 7"
},
{
"input": "12\n4 2 7 1 9 5 6 2 7 8 5 7",
"output": "7 5"
},
{
"input": "13\n9 9 9 9 9 9 9 9 9 9 9 9 9",
"output": "7 6"
}
] | 1,695,973,516
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 60
| 0
|
class AliceBob:
def __init__(self, alice, bob):
self.alice = alice
self.bob = bob
n = int(input())
ts = [int(t) for t in input().split()]
if n == 1:
print("1 0")
exit()
idx = AliceBob(0, len(ts) - 1)
score = AliceBob(0, 0)
while idx.alice <= idx.bob:
if score.alice <= score.bob:
score.alice += ts[idx.alice]
idx.alice += 1
else:
score.bob += ts[idx.bob]
idx.bob += 1
print(idx.alice + 1, len(ts) - idx.bob)
|
Title: Alice, Bob and Chocolate
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
Output Specification:
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
Demo Input:
['5\n2 9 8 2 7\n']
Demo Output:
['2 3\n']
Note:
none
|
```python
class AliceBob:
def __init__(self, alice, bob):
self.alice = alice
self.bob = bob
n = int(input())
ts = [int(t) for t in input().split()]
if n == 1:
print("1 0")
exit()
idx = AliceBob(0, len(ts) - 1)
score = AliceBob(0, 0)
while idx.alice <= idx.bob:
if score.alice <= score.bob:
score.alice += ts[idx.alice]
idx.alice += 1
else:
score.bob += ts[idx.bob]
idx.bob += 1
print(idx.alice + 1, len(ts) - idx.bob)
```
| -1
|
202
|
A
|
LLPS
|
PROGRAMMING
| 800
|
[
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null |
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
|
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
|
Print the lexicographically largest palindromic subsequence of string *s*.
|
[
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] |
[
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] |
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
| 500
|
[
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,668,343,818
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 54
| 124
| 0
|
input_string = input()
input_list = list(input_string)
input_list.sort(reverse=True)
high_value = input_list[0]
count = 0
for v in input_list:
if v == high_value:
count = count + 1
print(high_value*count)
|
Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
|
```python
input_string = input()
input_list = list(input_string)
input_list.sort(reverse=True)
high_value = input_list[0]
count = 0
for v in input_list:
if v == high_value:
count = count + 1
print(high_value*count)
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,675,763,211
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 15
| 46
| 0
|
# LUOGU_RID: 101646672
x1, x2, x3 = map(int, input().split())
print(min(abs(x1 - x3) + abs(x2 - x3), abs(x1 - x2) + abs(x2 - x3)))
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
# LUOGU_RID: 101646672
x1, x2, x3 = map(int, input().split())
print(min(abs(x1 - x3) + abs(x2 - x3), abs(x1 - x2) + abs(x2 - x3)))
```
| 0
|
|
363
|
B
|
Fence
|
PROGRAMMING
| 1,100
|
[
"brute force",
"dp"
] | null | null |
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
|
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
|
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
|
[
"7 3\n1 2 6 1 1 7 1\n"
] |
[
"3\n"
] |
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
| 1,000
|
[
{
"input": "7 3\n1 2 6 1 1 7 1",
"output": "3"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "2 1\n10 20",
"output": "1"
},
{
"input": "10 5\n1 2 3 1 2 2 3 1 4 5",
"output": "1"
},
{
"input": "10 2\n3 1 4 1 4 6 2 1 4 6",
"output": "7"
},
{
"input": "2 2\n20 10",
"output": "1"
},
{
"input": "2 1\n20 1",
"output": "2"
},
{
"input": "3 1\n1 2 3",
"output": "1"
},
{
"input": "3 1\n2 1 3",
"output": "2"
},
{
"input": "3 1\n3 2 1",
"output": "3"
},
{
"input": "3 2\n1 2 3",
"output": "1"
},
{
"input": "3 2\n3 2 1",
"output": "2"
},
{
"input": "3 3\n1 2 3",
"output": "1"
},
{
"input": "4 2\n9 8 11 7",
"output": "1"
},
{
"input": "4 2\n10 1 2 3",
"output": "2"
},
{
"input": "6 3\n56 56 56 2 1 2",
"output": "4"
},
{
"input": "8 3\n1 1 1 1 2 60 90 1",
"output": "1"
},
{
"input": "4 1\n1 5 2 2",
"output": "1"
},
{
"input": "4 2\n4 6 7 4",
"output": "1"
},
{
"input": "10 4\n1 1 1 4 4 4 4 4 4 3",
"output": "1"
},
{
"input": "6 3\n1 2 1 3 1 1",
"output": "1"
},
{
"input": "5 2\n100 100 100 1 1",
"output": "4"
}
] | 1,696,701,343
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 31
| 0
|
n_fences, piano_w = map(int, input().split())
fences = [int(task) for task in input().split()]
fences_height = sum(fences[:3])
index = 0
for i in range(2, n_fences):
fence, fence2, fence3 = fences[i], fences[i-1], fences[i-2]
sum_fences = fence + fence2 + fence3
if sum_fences < fences_height:
fences_height = sum_fences
index = i-1
print(index)
|
Title: Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
Input Specification:
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
Output Specification:
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
Demo Input:
['7 3\n1 2 6 1 1 7 1\n']
Demo Output:
['3\n']
Note:
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
|
```python
n_fences, piano_w = map(int, input().split())
fences = [int(task) for task in input().split()]
fences_height = sum(fences[:3])
index = 0
for i in range(2, n_fences):
fence, fence2, fence3 = fences[i], fences[i-1], fences[i-2]
sum_fences = fence + fence2 + fence3
if sum_fences < fences_height:
fences_height = sum_fences
index = i-1
print(index)
```
| 0
|
|
791
|
A
|
Bear and Big Brother
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
|
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
|
[
"4 7\n",
"4 9\n",
"1 1\n"
] |
[
"2\n",
"3\n",
"1\n"
] |
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
| 500
|
[
{
"input": "4 7",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "4"
},
{
"input": "1 6",
"output": "5"
},
{
"input": "1 7",
"output": "5"
},
{
"input": "1 8",
"output": "6"
},
{
"input": "1 9",
"output": "6"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "2 4",
"output": "2"
},
{
"input": "2 5",
"output": "3"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "4"
},
{
"input": "2 8",
"output": "4"
},
{
"input": "2 9",
"output": "4"
},
{
"input": "2 10",
"output": "4"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "3 4",
"output": "1"
},
{
"input": "3 5",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "3"
},
{
"input": "3 8",
"output": "3"
},
{
"input": "3 9",
"output": "3"
},
{
"input": "3 10",
"output": "3"
},
{
"input": "4 4",
"output": "1"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "4 10",
"output": "3"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "1"
},
{
"input": "5 7",
"output": "1"
},
{
"input": "5 8",
"output": "2"
},
{
"input": "5 9",
"output": "2"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "6 9",
"output": "2"
},
{
"input": "6 10",
"output": "2"
},
{
"input": "7 7",
"output": "1"
},
{
"input": "7 8",
"output": "1"
},
{
"input": "7 9",
"output": "1"
},
{
"input": "7 10",
"output": "1"
},
{
"input": "8 8",
"output": "1"
},
{
"input": "8 9",
"output": "1"
},
{
"input": "8 10",
"output": "1"
},
{
"input": "9 9",
"output": "1"
},
{
"input": "9 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "1 2",
"output": "2"
}
] | 1,695,305,562
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 62
| 46
| 0
|
k=list(map(int,input().split(' ')))
i=0
while k[0]<=k[1]:
k[0]=k[0]*3
k[1]=k[1]*2
i=i+1
print(i)
|
Title: Bear and Big Brother
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
Output Specification:
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
Demo Input:
['4 7\n', '4 9\n', '1 1\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
|
```python
k=list(map(int,input().split(' ')))
i=0
while k[0]<=k[1]:
k[0]=k[0]*3
k[1]=k[1]*2
i=i+1
print(i)
```
| 3
|
|
869
|
A
|
The Artful Expedient
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] | null | null |
Rock... Paper!
After Karen have found the deterministic winning (losing?) strategy for rock-paper-scissors, her brother, Koyomi, comes up with a new game as a substitute. The game works as follows.
A positive integer *n* is decided first. Both Koyomi and Karen independently choose *n* distinct positive integers, denoted by *x*1,<=*x*2,<=...,<=*x**n* and *y*1,<=*y*2,<=...,<=*y**n* respectively. They reveal their sequences, and repeat until all of 2*n* integers become distinct, which is the only final state to be kept and considered.
Then they count the number of ordered pairs (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) such that the value *x**i* xor *y**j* equals to one of the 2*n* integers. Here xor means the [bitwise exclusive or](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) operation on two integers, and is denoted by operators ^ and/or xor in most programming languages.
Karen claims a win if the number of such pairs is even, and Koyomi does otherwise. And you're here to help determine the winner of their latest game.
|
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=2<=000) — the length of both sequences.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=2·106) — the integers finally chosen by Koyomi.
The third line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (1<=≤<=*y**i*<=≤<=2·106) — the integers finally chosen by Karen.
Input guarantees that the given 2*n* integers are pairwise distinct, that is, no pair (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) exists such that one of the following holds: *x**i*<==<=*y**j*; *i*<=≠<=*j* and *x**i*<==<=*x**j*; *i*<=≠<=*j* and *y**i*<==<=*y**j*.
|
Output one line — the name of the winner, that is, "Koyomi" or "Karen" (without quotes). Please be aware of the capitalization.
|
[
"3\n1 2 3\n4 5 6\n",
"5\n2 4 6 8 10\n9 7 5 3 1\n"
] |
[
"Karen\n",
"Karen\n"
] |
In the first example, there are 6 pairs satisfying the constraint: (1, 1), (1, 2), (2, 1), (2, 3), (3, 2) and (3, 3). Thus, Karen wins since 6 is an even number.
In the second example, there are 16 such pairs, and Karen wins again.
| 500
|
[
{
"input": "3\n1 2 3\n4 5 6",
"output": "Karen"
},
{
"input": "5\n2 4 6 8 10\n9 7 5 3 1",
"output": "Karen"
},
{
"input": "1\n1\n2000000",
"output": "Karen"
},
{
"input": "2\n97153 2000000\n1999998 254",
"output": "Karen"
},
{
"input": "15\n31 30 29 28 27 26 25 24 23 22 21 20 19 18 17\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15",
"output": "Karen"
},
{
"input": "30\n79656 68607 871714 1858841 237684 1177337 532141 161161 1111201 527235 323345 1979059 665353 507265 1290761 610606 1238375 743262 106355 1167830 180315 1233029 816465 752968 782570 1499881 1328457 1867240 13948 1302782\n322597 1868510 1958236 1348157 765908 1023636 874300 537124 631783 414906 886318 1931572 1381013 992451 1305644 1525745 716087 83173 303248 1572710 43084 333341 992413 267806 70390 644521 1014900 497068 178940 1920268",
"output": "Karen"
},
{
"input": "30\n1143673 436496 1214486 1315862 148404 724601 1430740 1433008 1654610 1635673 614673 1713408 1270999 1697 1463796 50027 525482 1659078 688200 842647 518551 877506 1017082 1807856 3280 759698 1208220 470180 829800 1960886\n1312613 1965095 967255 1289012 1950383 582960 856825 49684 808824 319418 1968270 190821 344545 211332 1219388 1773751 1876402 132626 541448 1584672 24276 1053225 1823073 1858232 1209173 1035991 1956373 1237148 1973608 848873",
"output": "Karen"
},
{
"input": "1\n2\n3",
"output": "Karen"
},
{
"input": "1\n1048576\n1020000",
"output": "Karen"
},
{
"input": "3\n9 33 69\n71 74 100",
"output": "Karen"
},
{
"input": "3\n1 2 3\n9 5 6",
"output": "Karen"
},
{
"input": "3\n1 7 8\n9 10 20",
"output": "Karen"
},
{
"input": "3\n1 3 2\n4 5 8",
"output": "Karen"
},
{
"input": "3\n2 1 100\n3 4 9",
"output": "Karen"
},
{
"input": "3\n3 1 100\n2 1000 100000",
"output": "Karen"
},
{
"input": "3\n1 2 5\n3 4 6",
"output": "Karen"
},
{
"input": "3\n3 1 8\n2 4 17",
"output": "Karen"
},
{
"input": "3\n1 5 6\n7 8 3",
"output": "Karen"
},
{
"input": "1\n1\n3",
"output": "Karen"
},
{
"input": "3\n1 3 10\n2 4 20",
"output": "Karen"
},
{
"input": "3\n7 8 10\n15 9 11",
"output": "Karen"
},
{
"input": "3\n5 6 8\n3 100 9",
"output": "Karen"
},
{
"input": "3\n1 2 3\n4 5 8",
"output": "Karen"
},
{
"input": "3\n1 2 19\n3 7 30",
"output": "Karen"
},
{
"input": "3\n1 2 3\n6 7 8",
"output": "Karen"
},
{
"input": "3\n1 4 55\n2 3 9",
"output": "Karen"
},
{
"input": "3\n1 100 200\n5 4 500",
"output": "Karen"
},
{
"input": "1\n6\n7",
"output": "Karen"
},
{
"input": "3\n1 3 5\n2 4 13",
"output": "Karen"
},
{
"input": "3\n3 1 100\n2 1000 10000",
"output": "Karen"
},
{
"input": "3\n1 3 9\n2 4 40",
"output": "Karen"
},
{
"input": "2\n1 199999\n1935807 2000000",
"output": "Karen"
},
{
"input": "3\n1 3 8\n2 4 24",
"output": "Karen"
},
{
"input": "2\n4 1\n7 3",
"output": "Karen"
},
{
"input": "3\n1 2 4\n3 7 8",
"output": "Karen"
},
{
"input": "3\n1 6 10000\n2 3 100000",
"output": "Karen"
}
] | 1,516,759,484
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 280
| 11,878,400
|
import os
import turtle
a=1
b=1
c=1
d=1
print("Karen")
|
Title: The Artful Expedient
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Rock... Paper!
After Karen have found the deterministic winning (losing?) strategy for rock-paper-scissors, her brother, Koyomi, comes up with a new game as a substitute. The game works as follows.
A positive integer *n* is decided first. Both Koyomi and Karen independently choose *n* distinct positive integers, denoted by *x*1,<=*x*2,<=...,<=*x**n* and *y*1,<=*y*2,<=...,<=*y**n* respectively. They reveal their sequences, and repeat until all of 2*n* integers become distinct, which is the only final state to be kept and considered.
Then they count the number of ordered pairs (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) such that the value *x**i* xor *y**j* equals to one of the 2*n* integers. Here xor means the [bitwise exclusive or](https://en.wikipedia.org/wiki/Bitwise_operation#XOR) operation on two integers, and is denoted by operators ^ and/or xor in most programming languages.
Karen claims a win if the number of such pairs is even, and Koyomi does otherwise. And you're here to help determine the winner of their latest game.
Input Specification:
The first line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=2<=000) — the length of both sequences.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=2·106) — the integers finally chosen by Koyomi.
The third line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (1<=≤<=*y**i*<=≤<=2·106) — the integers finally chosen by Karen.
Input guarantees that the given 2*n* integers are pairwise distinct, that is, no pair (*i*,<=*j*) (1<=≤<=*i*,<=*j*<=≤<=*n*) exists such that one of the following holds: *x**i*<==<=*y**j*; *i*<=≠<=*j* and *x**i*<==<=*x**j*; *i*<=≠<=*j* and *y**i*<==<=*y**j*.
Output Specification:
Output one line — the name of the winner, that is, "Koyomi" or "Karen" (without quotes). Please be aware of the capitalization.
Demo Input:
['3\n1 2 3\n4 5 6\n', '5\n2 4 6 8 10\n9 7 5 3 1\n']
Demo Output:
['Karen\n', 'Karen\n']
Note:
In the first example, there are 6 pairs satisfying the constraint: (1, 1), (1, 2), (2, 1), (2, 3), (3, 2) and (3, 3). Thus, Karen wins since 6 is an even number.
In the second example, there are 16 such pairs, and Karen wins again.
|
```python
import os
import turtle
a=1
b=1
c=1
d=1
print("Karen")
```
| 3
|
|
128
|
B
|
String
|
PROGRAMMING
| 2,100
|
[
"brute force",
"constructive algorithms",
"hashing",
"implementation",
"string suffix structures",
"strings"
] | null | null |
One day in the IT lesson Anna and Maria learned about the lexicographic order.
String *x* is lexicographically less than string *y*, if either *x* is a prefix of *y* (and *x*<=≠<=*y*), or there exists such *i* (1<=≤<=*i*<=≤<=*min*(|*x*|,<=|*y*|)), that *x**i*<=<<=*y**i*, and for any *j* (1<=≤<=*j*<=<<=*i*) *x**j*<==<=*y**j*. Here |*a*| denotes the length of the string *a*. The lexicographic comparison of strings is implemented by operator < in modern programming languages.
The teacher gave Anna and Maria homework. She gave them a string of length *n*. They should write out all substrings of the given string, including the whole initial string, and the equal substrings (for example, one should write out the following substrings from the string "aab": "a", "a", "aa", "ab", "aab", "b"). The resulting strings should be sorted in the lexicographical order. The cunning teacher doesn't want to check all these strings. That's why she said to find only the *k*-th string from the list. Help Anna and Maria do the homework.
|
The first line contains a non-empty string that only consists of small Latin letters ("a"-"z"), whose length does not exceed 105. The second line contains the only integer *k* (1<=≤<=*k*<=≤<=105).
|
Print the string Anna and Maria need — the *k*-th (in the lexicographical order) substring of the given string. If the total number of substrings is less than *k*, print a string saying "No such line." (without the quotes).
|
[
"aa\n2\n",
"abc\n5\n",
"abab\n7\n"
] |
[
"a\n",
"bc\n",
"b\n"
] |
In the second sample before string "bc" follow strings "a", "ab", "abc", "b".
| 1,500
|
[
{
"input": "aa\n2",
"output": "a"
},
{
"input": "abc\n5",
"output": "bc"
},
{
"input": "abab\n7",
"output": "b"
},
{
"input": "codeforces\n1",
"output": "c"
},
{
"input": "cccc\n8",
"output": "ccc"
},
{
"input": "abcdefghijklmnopqrstuvwxyz\n27",
"output": "b"
},
{
"input": "cba\n6",
"output": "cba"
},
{
"input": "z\n100000",
"output": "No such line."
},
{
"input": "kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk\n17416",
"output": "kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk"
},
{
"input": "uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu\n32912",
"output": "uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu"
},
{
"input": "kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk\n84480",
"output": "No such line."
},
{
"input": "llllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllll\n83252",
"output": "No such line."
},
{
"input": "yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy\n18883",
"output": "yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyy"
},
{
"input": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh\n14594",
"output": "hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb\n87315",
"output": "No such line."
},
{
"input": "qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq\n27016",
"output": "qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqq"
},
{
"input": "ssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss\n9184",
"output": "ssssssssssssssssssssssssssss"
},
{
"input": "ssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss\n99590",
"output": "No such line."
},
{
"input": "aaaaaaaaaa\n90",
"output": "No such line."
}
] | 1,462,797,868
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7
| 2,000
| 5,120,000
|
def smaller(a,b):
l = min(len(a),len(b))
for i in range(l):
if ord(a[i])<ord(b[i]):
return True
if ord(a[i])>ord(b[i]):
return False
else:
if len(a)<=len(b):
return True
if len(a)>len(b):
return False
s = str(input())
k = int(input())
n = len(s)
if k>(n*(n+1))//2:
print('No such line.')
else:
answer = []
ite = 0
for i in range(n):
for j in range(i+1,n+1):
l = s[i:j]
ite += 1
for t in range(len(answer)):
if smaller(l,answer[t]):
answer.insert(t,l)
break
else:
answer.append(l)
answer = answer[0:k]
print(answer[k-1])
|
Title: String
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day in the IT lesson Anna and Maria learned about the lexicographic order.
String *x* is lexicographically less than string *y*, if either *x* is a prefix of *y* (and *x*<=≠<=*y*), or there exists such *i* (1<=≤<=*i*<=≤<=*min*(|*x*|,<=|*y*|)), that *x**i*<=<<=*y**i*, and for any *j* (1<=≤<=*j*<=<<=*i*) *x**j*<==<=*y**j*. Here |*a*| denotes the length of the string *a*. The lexicographic comparison of strings is implemented by operator < in modern programming languages.
The teacher gave Anna and Maria homework. She gave them a string of length *n*. They should write out all substrings of the given string, including the whole initial string, and the equal substrings (for example, one should write out the following substrings from the string "aab": "a", "a", "aa", "ab", "aab", "b"). The resulting strings should be sorted in the lexicographical order. The cunning teacher doesn't want to check all these strings. That's why she said to find only the *k*-th string from the list. Help Anna and Maria do the homework.
Input Specification:
The first line contains a non-empty string that only consists of small Latin letters ("a"-"z"), whose length does not exceed 105. The second line contains the only integer *k* (1<=≤<=*k*<=≤<=105).
Output Specification:
Print the string Anna and Maria need — the *k*-th (in the lexicographical order) substring of the given string. If the total number of substrings is less than *k*, print a string saying "No such line." (without the quotes).
Demo Input:
['aa\n2\n', 'abc\n5\n', 'abab\n7\n']
Demo Output:
['a\n', 'bc\n', 'b\n']
Note:
In the second sample before string "bc" follow strings "a", "ab", "abc", "b".
|
```python
def smaller(a,b):
l = min(len(a),len(b))
for i in range(l):
if ord(a[i])<ord(b[i]):
return True
if ord(a[i])>ord(b[i]):
return False
else:
if len(a)<=len(b):
return True
if len(a)>len(b):
return False
s = str(input())
k = int(input())
n = len(s)
if k>(n*(n+1))//2:
print('No such line.')
else:
answer = []
ite = 0
for i in range(n):
for j in range(i+1,n+1):
l = s[i:j]
ite += 1
for t in range(len(answer)):
if smaller(l,answer[t]):
answer.insert(t,l)
break
else:
answer.append(l)
answer = answer[0:k]
print(answer[k-1])
```
| 0
|
|
920
|
E
|
Connected Components?
|
PROGRAMMING
| 2,100
|
[
"data structures",
"dfs and similar",
"dsu",
"graphs"
] | null | null |
You are given an undirected graph consisting of *n* vertices and edges. Instead of giving you the edges that exist in the graph, we give you *m* unordered pairs (*x*,<=*y*) such that there is no edge between *x* and *y*, and if some pair of vertices is not listed in the input, then there is an edge between these vertices.
You have to find the number of connected components in the graph and the size of each component. A connected component is a set of vertices *X* such that for every two vertices from this set there exists at least one path in the graph connecting these vertices, but adding any other vertex to *X* violates this rule.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=200000, ).
Then *m* lines follow, each containing a pair of integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*, *x*<=≠<=*y*) denoting that there is no edge between *x* and *y*. Each pair is listed at most once; (*x*,<=*y*) and (*y*,<=*x*) are considered the same (so they are never listed in the same test). If some pair of vertices is not listed in the input, then there exists an edge between those vertices.
|
Firstly print *k* — the number of connected components in this graph.
Then print *k* integers — the sizes of components. You should output these integers in non-descending order.
|
[
"5 5\n1 2\n3 4\n3 2\n4 2\n2 5\n"
] |
[
"2\n1 4 "
] |
none
| 0
|
[
{
"input": "5 5\n1 2\n3 4\n3 2\n4 2\n2 5",
"output": "2\n1 4 "
},
{
"input": "8 15\n2 1\n4 5\n2 4\n3 4\n2 5\n3 5\n2 6\n3 6\n5 6\n4 6\n2 7\n3 8\n2 8\n3 7\n6 7",
"output": "1\n8 "
},
{
"input": "12 58\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 10\n1 11\n1 12\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n3 4\n3 5\n3 6\n3 7\n3 8\n3 9\n3 10\n3 11\n3 12\n4 5\n4 6\n4 8\n4 11\n4 12\n5 6\n5 7\n5 8\n5 9\n5 10\n5 11\n6 7\n6 8\n6 9\n6 10\n6 11\n6 12\n7 8\n7 9\n7 10\n7 11\n7 12\n8 9\n8 10\n8 11\n9 10\n9 11\n9 12\n10 12",
"output": "4\n1 1 1 9 "
},
{
"input": "5 7\n1 2\n2 3\n3 4\n1 5\n2 5\n3 5\n4 5",
"output": "2\n1 4 "
},
{
"input": "6 10\n1 2\n1 3\n1 4\n1 6\n2 3\n2 4\n2 5\n3 5\n3 6\n4 6",
"output": "1\n6 "
},
{
"input": "8 23\n1 2\n1 4\n1 6\n1 8\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n3 4\n3 5\n3 6\n3 7\n3 8\n4 5\n4 6\n4 7\n5 6\n5 7\n5 8\n6 8\n7 8",
"output": "3\n1 2 5 "
},
{
"input": "4 3\n2 1\n3 1\n4 2",
"output": "1\n4 "
},
{
"input": "6 9\n1 2\n1 4\n1 5\n2 3\n2 5\n2 6\n3 5\n4 6\n5 6",
"output": "1\n6 "
},
{
"input": "2 0",
"output": "1\n2 "
},
{
"input": "8 18\n1 4\n1 6\n1 7\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n3 4\n3 8\n4 7\n5 6\n5 7\n5 8\n6 7\n6 8\n7 8",
"output": "1\n8 "
},
{
"input": "4 3\n1 2\n3 1\n4 3",
"output": "1\n4 "
},
{
"input": "8 23\n2 7\n7 5\n8 6\n8 2\n6 3\n3 5\n8 1\n8 4\n8 3\n3 4\n1 2\n2 6\n5 2\n6 4\n7 6\n6 5\n7 8\n7 1\n5 4\n3 7\n1 4\n3 1\n3 2",
"output": "3\n1 3 4 "
},
{
"input": "4 4\n2 1\n3 1\n1 4\n3 2",
"output": "2\n1 3 "
},
{
"input": "2 1\n1 2",
"output": "2\n1 1 "
},
{
"input": "4 3\n1 3\n1 4\n2 3",
"output": "1\n4 "
},
{
"input": "3 1\n2 3",
"output": "1\n3 "
},
{
"input": "5 4\n1 4\n2 3\n4 3\n4 2",
"output": "1\n5 "
},
{
"input": "10 36\n7 8\n7 9\n2 3\n2 4\n2 5\n9 10\n2 7\n2 8\n2 9\n2 10\n4 5\n4 6\n4 7\n4 8\n4 10\n6 7\n6 9\n6 10\n1 2\n1 3\n1 4\n8 9\n1 5\n8 10\n1 7\n1 8\n1 9\n1 10\n3 4\n3 6\n3 7\n3 9\n5 6\n5 7\n5 9\n5 10",
"output": "2\n2 8 "
},
{
"input": "10 34\n7 10\n2 3\n2 4\n2 5\n9 10\n2 7\n2 8\n2 10\n4 5\n4 6\n4 7\n4 8\n4 9\n6 7\n6 8\n6 9\n6 10\n1 2\n1 3\n1 5\n8 9\n1 6\n1 7\n1 8\n1 9\n1 10\n3 4\n3 5\n3 6\n3 8\n3 10\n5 6\n5 9\n5 10",
"output": "1\n10 "
},
{
"input": "12 56\n9 5\n2 6\n9 8\n5 4\n1 11\n1 6\n4 1\n1 10\n10 3\n8 4\n5 1\n9 1\n5 10\n2 7\n11 5\n6 11\n5 8\n7 6\n3 2\n12 7\n8 6\n12 3\n1 2\n8 1\n2 11\n10 12\n4 6\n5 12\n2 4\n10 2\n7 3\n12 11\n7 10\n7 1\n9 2\n11 9\n9 10\n8 7\n11 3\n7 9\n5 7\n4 12\n3 5\n12 2\n4 10\n9 12\n5 2\n9 4\n11 8\n8 2\n3 6\n4 11\n8 10\n6 10\n3 9\n3 4",
"output": "3\n1 4 7 "
},
{
"input": "11 49\n10 3\n6 4\n11 3\n7 6\n10 6\n6 1\n4 3\n10 2\n4 5\n9 2\n10 1\n5 7\n1 5\n9 7\n2 11\n8 6\n3 9\n2 5\n9 5\n6 5\n1 4\n11 9\n1 7\n8 10\n3 6\n3 7\n11 5\n6 9\n4 10\n8 7\n4 9\n8 2\n4 2\n8 11\n7 4\n9 10\n8 1\n10 7\n3 2\n5 8\n8 9\n1 3\n2 7\n10 11\n5 3\n10 5\n4 11\n1 11\n8 3",
"output": "5\n1 1 1 2 6 "
}
] | 1,676,324,052
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 1
| 1,092
| 13,824,000
|
n,m=map(int,input().split())
e=[]
for i in range(m):
a,b=map(int, input().split())
e.append((a,b))
arr=[i for i in range(n+1)]
rank=[1 for i in arr]
def find(a,arr):
if arr[a]==a:
return a
return find(arr[a],arr)
def union(a,b):
pa,pb=find(a,arr), find(b,arr)
if rank[pa]>rank[pb]:
arr[pb]=pa
rank[pa]+=rank[pb]
else:
arr[pa]=pb
rank[pb]+=rank[pa]
for i in e:
union(i[0], i[1])
comps=set(arr[1:])
print(len(comps))
c={}
for i in arr[1:]:
if i not in c:
c[i]=0
c[i]+=1
a=list(map(str, sorted(c.values())))
print(' '.join(a))
|
Title: Connected Components?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an undirected graph consisting of *n* vertices and edges. Instead of giving you the edges that exist in the graph, we give you *m* unordered pairs (*x*,<=*y*) such that there is no edge between *x* and *y*, and if some pair of vertices is not listed in the input, then there is an edge between these vertices.
You have to find the number of connected components in the graph and the size of each component. A connected component is a set of vertices *X* such that for every two vertices from this set there exists at least one path in the graph connecting these vertices, but adding any other vertex to *X* violates this rule.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=200000, ).
Then *m* lines follow, each containing a pair of integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*, *x*<=≠<=*y*) denoting that there is no edge between *x* and *y*. Each pair is listed at most once; (*x*,<=*y*) and (*y*,<=*x*) are considered the same (so they are never listed in the same test). If some pair of vertices is not listed in the input, then there exists an edge between those vertices.
Output Specification:
Firstly print *k* — the number of connected components in this graph.
Then print *k* integers — the sizes of components. You should output these integers in non-descending order.
Demo Input:
['5 5\n1 2\n3 4\n3 2\n4 2\n2 5\n']
Demo Output:
['2\n1 4 ']
Note:
none
|
```python
n,m=map(int,input().split())
e=[]
for i in range(m):
a,b=map(int, input().split())
e.append((a,b))
arr=[i for i in range(n+1)]
rank=[1 for i in arr]
def find(a,arr):
if arr[a]==a:
return a
return find(arr[a],arr)
def union(a,b):
pa,pb=find(a,arr), find(b,arr)
if rank[pa]>rank[pb]:
arr[pb]=pa
rank[pa]+=rank[pb]
else:
arr[pa]=pb
rank[pb]+=rank[pa]
for i in e:
union(i[0], i[1])
comps=set(arr[1:])
print(len(comps))
c={}
for i in arr[1:]:
if i not in c:
c[i]=0
c[i]+=1
a=list(map(str, sorted(c.values())))
print(' '.join(a))
```
| 0
|
|
166
|
A
|
Rank List
|
PROGRAMMING
| 1,100
|
[
"binary search",
"implementation",
"sortings"
] | null | null |
Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place.
You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=><=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=<<=*t**b*.
It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place.
Your task is to count what number of teams from the given list shared the *k*-th place.
|
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=≤<=*p**i*,<=*t**i*<=≤<=50) — the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces.
|
In the only line print the sought number of teams that got the *k*-th place in the final results' table.
|
[
"7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n",
"5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n"
] |
[
"3\n",
"4\n"
] |
The final results' table for the first sample is:
- 1-3 places — 4 solved problems, the penalty time equals 10 - 4 place — 3 solved problems, the penalty time equals 20 - 5-6 places — 2 solved problems, the penalty time equals 1 - 7 place — 1 solved problem, the penalty time equals 10
The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams.
The final table for the second sample is:
- 1 place — 5 solved problems, the penalty time equals 3 - 2-5 places — 3 solved problems, the penalty time equals 1
The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams.
| 500
|
[
{
"input": "7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10",
"output": "3"
},
{
"input": "5 4\n3 1\n3 1\n5 3\n3 1\n3 1",
"output": "4"
},
{
"input": "5 1\n2 2\n1 1\n1 1\n1 1\n2 2",
"output": "2"
},
{
"input": "6 3\n2 2\n3 1\n2 2\n4 5\n2 2\n4 5",
"output": "1"
},
{
"input": "5 5\n3 1\n10 2\n2 2\n1 10\n10 2",
"output": "1"
},
{
"input": "3 2\n3 3\n3 3\n3 3",
"output": "3"
},
{
"input": "4 3\n10 3\n6 10\n5 2\n5 2",
"output": "2"
},
{
"input": "5 3\n10 10\n10 10\n1 1\n10 10\n4 3",
"output": "3"
},
{
"input": "3 1\n2 1\n1 1\n1 2",
"output": "1"
},
{
"input": "1 1\n28 28",
"output": "1"
},
{
"input": "2 2\n1 2\n1 2",
"output": "2"
},
{
"input": "5 3\n2 3\n4 2\n5 3\n2 4\n3 5",
"output": "1"
},
{
"input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8",
"output": "1"
},
{
"input": "50 6\n11 20\n18 13\n1 13\n3 11\n4 17\n15 10\n15 8\n9 16\n11 17\n16 3\n3 20\n14 13\n12 15\n9 10\n14 2\n12 12\n13 17\n6 10\n20 9\n2 8\n13 7\n7 20\n15 3\n1 20\n2 13\n2 5\n14 7\n10 13\n15 12\n15 5\n17 6\n9 11\n18 5\n10 1\n15 14\n3 16\n6 12\n4 1\n14 9\n7 14\n8 17\n17 13\n4 6\n19 16\n5 6\n3 15\n4 19\n15 20\n2 10\n20 10",
"output": "1"
},
{
"input": "50 12\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "50"
},
{
"input": "50 28\n2 2\n1 1\n2 1\n1 2\n1 1\n1 1\n1 1\n2 2\n2 2\n2 2\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n2 2\n2 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 1\n1 1\n2 2\n2 1\n2 1\n2 2\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n2 1\n1 1\n2 2\n2 2\n2 2\n2 2",
"output": "13"
},
{
"input": "50 40\n2 3\n3 1\n2 1\n2 1\n2 1\n3 1\n1 1\n1 2\n2 3\n1 3\n1 3\n2 1\n3 1\n1 1\n3 1\n3 1\n2 2\n1 1\n3 3\n3 1\n3 2\n2 3\n3 3\n3 1\n1 3\n2 3\n2 1\n3 2\n3 3\n3 1\n2 1\n2 2\n1 3\n3 3\n1 1\n3 2\n1 2\n2 3\n2 1\n2 2\n3 2\n1 3\n3 1\n1 1\n3 3\n2 3\n2 1\n2 3\n2 3\n1 2",
"output": "5"
},
{
"input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3",
"output": "1"
},
{
"input": "50 32\n6 6\n4 2\n5 5\n1 1\n2 4\n6 5\n2 3\n6 5\n2 3\n6 3\n1 4\n1 6\n3 3\n2 4\n3 2\n6 2\n4 1\n3 3\n3 1\n5 5\n1 2\n2 1\n5 4\n3 1\n4 4\n5 6\n4 1\n2 5\n3 1\n4 6\n2 3\n1 1\n6 5\n2 6\n3 3\n2 6\n2 3\n2 6\n3 4\n2 6\n4 5\n5 4\n1 6\n3 2\n5 1\n4 1\n4 6\n4 2\n1 2\n5 2",
"output": "1"
},
{
"input": "50 48\n5 1\n6 4\n3 2\n2 1\n4 7\n3 6\n7 1\n7 5\n6 5\n5 6\n4 7\n5 7\n5 7\n5 5\n7 3\n3 5\n4 3\n5 4\n6 2\n1 6\n6 3\n6 5\n5 2\n4 2\n3 1\n1 1\n5 6\n1 3\n6 5\n3 7\n1 5\n7 5\n6 5\n3 6\n2 7\n5 3\n5 3\n4 7\n5 2\n6 5\n5 7\n7 1\n2 3\n5 5\n2 6\n4 1\n6 2\n6 5\n3 3\n1 6",
"output": "1"
},
{
"input": "50 8\n5 3\n7 3\n4 3\n7 4\n2 2\n4 4\n5 4\n1 1\n7 7\n4 8\n1 1\n6 3\n1 5\n7 3\n6 5\n4 5\n8 6\n3 6\n2 1\n3 2\n2 5\n7 6\n5 8\n1 3\n5 5\n8 4\n4 5\n4 4\n8 8\n7 2\n7 2\n3 6\n2 8\n8 3\n3 2\n4 5\n8 1\n3 2\n8 7\n6 3\n2 3\n5 1\n3 4\n7 2\n6 3\n7 3\n3 3\n6 4\n2 2\n5 1",
"output": "3"
},
{
"input": "20 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "20"
},
{
"input": "20 20\n1 2\n2 2\n1 1\n2 1\n2 2\n1 1\n1 1\n2 1\n1 1\n1 2\n2 2\n1 2\n1 2\n2 2\n2 2\n1 2\n2 1\n2 1\n1 2\n2 2",
"output": "6"
},
{
"input": "30 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "30"
},
{
"input": "30 22\n2 1\n1 2\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n2 2\n1 2\n2 2\n1 2\n1 2\n2 1\n1 2\n2 2\n2 2\n1 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 2\n2 2\n1 2\n2 2\n2 1\n1 1",
"output": "13"
},
{
"input": "30 22\n1 1\n1 3\n2 3\n3 1\n2 3\n3 1\n1 2\n3 3\n2 1\n2 1\n2 2\n3 1\n3 2\n2 3\n3 1\n1 3\n2 3\n3 1\n1 2\n1 2\n2 3\n2 1\n3 3\n3 2\n1 3\n3 3\n3 3\n3 3\n3 3\n3 1",
"output": "5"
},
{
"input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3",
"output": "1"
},
{
"input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8",
"output": "1"
},
{
"input": "50 22\n29 15\n18 10\n6 23\n38 28\n34 40\n40 1\n16 26\n22 33\n14 30\n26 7\n15 16\n22 40\n14 15\n6 28\n32 27\n33 3\n38 22\n40 17\n16 27\n21 27\n34 26\n5 15\n34 9\n38 23\n7 36\n17 6\n19 37\n40 1\n10 28\n9 14\n8 31\n40 8\n14 2\n24 16\n38 33\n3 37\n2 9\n21 21\n40 26\n28 33\n24 31\n10 12\n27 27\n17 4\n38 5\n21 31\n5 12\n29 7\n39 12\n26 14",
"output": "1"
},
{
"input": "50 14\n4 20\n37 50\n46 19\n20 25\n47 10\n6 34\n12 41\n47 9\n22 28\n41 34\n47 40\n12 42\n9 4\n15 15\n27 8\n38 9\n4 17\n8 13\n47 7\n9 38\n30 48\n50 7\n41 34\n23 11\n16 37\n2 32\n18 46\n37 48\n47 41\n13 9\n24 50\n46 14\n33 49\n9 50\n35 30\n49 44\n42 49\n39 15\n33 42\n3 18\n44 15\n44 28\n9 17\n16 4\n10 36\n4 22\n47 17\n24 12\n2 31\n6 30",
"output": "2"
},
{
"input": "2 1\n50 50\n50 50",
"output": "2"
},
{
"input": "2 2\n50 50\n50 50",
"output": "2"
},
{
"input": "2 1\n50 50\n50 49",
"output": "1"
},
{
"input": "2 2\n50 50\n50 49",
"output": "1"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50",
"output": "50"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n49 50",
"output": "1"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 49",
"output": "49"
},
{
"input": "10 1\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4",
"output": "1"
},
{
"input": "4 3\n1 1\n1 2\n2 1\n2 2",
"output": "1"
},
{
"input": "4 2\n1 2\n1 3\n1 5\n1 2",
"output": "2"
},
{
"input": "6 1\n4 3\n4 2\n5 1\n5 2\n5 3\n5 3",
"output": "1"
},
{
"input": "5 3\n2 1\n1 3\n1 2\n1 1\n1 1",
"output": "2"
},
{
"input": "3 1\n1 1\n1 2\n1 3",
"output": "1"
},
{
"input": "10 10\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4",
"output": "4"
},
{
"input": "5 1\n5 5\n5 6\n5 7\n5 8\n5 5",
"output": "2"
},
{
"input": "4 1\n1 1\n1 1\n1 2\n1 3",
"output": "2"
}
] | 1,615,912,699
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 124
| 0
|
n, k = map(int, input().split())
li = []
for i in range(n):
a, b = map(int, input().split())
li.append((-a, b))
li.sort()
print(li.count(li[k - 1]))
|
Title: Rank List
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place.
You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=><=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=<<=*t**b*.
It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place.
Your task is to count what number of teams from the given list shared the *k*-th place.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=≤<=*p**i*,<=*t**i*<=≤<=50) — the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces.
Output Specification:
In the only line print the sought number of teams that got the *k*-th place in the final results' table.
Demo Input:
['7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n', '5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n']
Demo Output:
['3\n', '4\n']
Note:
The final results' table for the first sample is:
- 1-3 places — 4 solved problems, the penalty time equals 10 - 4 place — 3 solved problems, the penalty time equals 20 - 5-6 places — 2 solved problems, the penalty time equals 1 - 7 place — 1 solved problem, the penalty time equals 10
The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams.
The final table for the second sample is:
- 1 place — 5 solved problems, the penalty time equals 3 - 2-5 places — 3 solved problems, the penalty time equals 1
The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams.
|
```python
n, k = map(int, input().split())
li = []
for i in range(n):
a, b = map(int, input().split())
li.append((-a, b))
li.sort()
print(li.count(li[k - 1]))
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,673,797,278
| 2,147,483,647
|
PyPy 3-64
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 6
| 2,000
| 1,433,600
|
n =2
a =[]
s=0
for i in range (n):
m =input()
for j in m:
a.append(j)
l = int(len(a)/2)
k = len(a)
while(k >l):
for i in range(l):
if a[i] ==a[k-1]:
s +=1
k-=1
#SO SANH KI TU 1-8 2-7 3-6
if s == l:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
n =2
a =[]
s=0
for i in range (n):
m =input()
for j in m:
a.append(j)
l = int(len(a)/2)
k = len(a)
while(k >l):
for i in range(l):
if a[i] ==a[k-1]:
s +=1
k-=1
#SO SANH KI TU 1-8 2-7 3-6
if s == l:
print("YES")
else:
print("NO")
```
| 0
|
32
|
B
|
Borze
|
PROGRAMMING
| 800
|
[
"expression parsing",
"implementation"
] |
B. Borze
|
2
|
256
|
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
|
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
|
Output the decoded ternary number. It can have leading zeroes.
|
[
".-.--\n",
"--.\n",
"-..-.--\n"
] |
[
"012",
"20",
"1012"
] |
none
| 1,000
|
[
{
"input": ".-.--",
"output": "012"
},
{
"input": "--.",
"output": "20"
},
{
"input": "-..-.--",
"output": "1012"
},
{
"input": "---..",
"output": "210"
},
{
"input": "..--.---..",
"output": "0020210"
},
{
"input": "-.....----.",
"output": "10000220"
},
{
"input": ".",
"output": "0"
},
{
"input": "-.",
"output": "1"
},
{
"input": "--",
"output": "2"
},
{
"input": "..",
"output": "00"
},
{
"input": "--.",
"output": "20"
},
{
"input": ".--.",
"output": "020"
},
{
"input": ".-.-..",
"output": "0110"
},
{
"input": "----.-.",
"output": "2201"
},
{
"input": "-..--.-.",
"output": "10201"
},
{
"input": "..--..--.",
"output": "0020020"
},
{
"input": "-.-.---.--..-..-.-.-..-..-.--.",
"output": "112120010111010120"
},
{
"input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.",
"output": "21112220010101011012011011221011"
},
{
"input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------",
"output": "11020111110111222212021020002022111100201121222020012022110010222"
},
{
"input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..",
"output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110"
},
{
"input": ".-..-.-.---.-----.--.---...-.--.-.-....-..",
"output": "01011212212021001201100010"
},
{
"input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..",
"output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210"
},
{
"input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.",
"output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220"
},
{
"input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----",
"output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122"
},
{
"input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..",
"output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110"
},
{
"input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.",
"output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020"
},
{
"input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..",
"output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200"
},
{
"input": "-.---...----...--.--...-.--.----",
"output": "121002200020200012022"
},
{
"input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.",
"output": "202020212012111010201021100001021221200011222112012201012220"
}
] | 1,590,539,226
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 186
| 0
|
def solve():
s = input()
st = s.split(".")
#print(st)
for i in st:
if i == "":
print(0,end="")
elif i == "-":
print(1,end="")
else:
print(2,end='')
solve()
|
Title: Borze
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
Input Specification:
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output Specification:
Output the decoded ternary number. It can have leading zeroes.
Demo Input:
['.-.--\n', '--.\n', '-..-.--\n']
Demo Output:
['012', '20', '1012']
Note:
none
|
```python
def solve():
s = input()
st = s.split(".")
#print(st)
for i in st:
if i == "":
print(0,end="")
elif i == "-":
print(1,end="")
else:
print(2,end='')
solve()
```
| 0
|
378
|
A
|
Playing with Dice
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
|
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
|
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
|
[
"2 5\n",
"2 4\n"
] |
[
"3 0 3\n",
"2 1 3\n"
] |
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
| 500
|
[
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,685,106,805
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 38
| 46
| 0
|
a,b=map(int,input().split())
A=0
B=0
D=0
for i in range(1,7):
if abs(a-i)>abs(b-i):
A+=1
elif abs(a-i)<abs(b-i):
B+=1
else:
D+=1
print(B,D,A)
|
Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
|
```python
a,b=map(int,input().split())
A=0
B=0
D=0
for i in range(1,7):
if abs(a-i)>abs(b-i):
A+=1
elif abs(a-i)<abs(b-i):
B+=1
else:
D+=1
print(B,D,A)
```
| 3
|
|
509
|
A
|
Maximum in Table
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
|
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
|
Print a single line containing a positive integer *m* — the maximum value in the table.
|
[
"1\n",
"5\n"
] |
[
"1",
"70"
] |
In the second test the rows of the table look as follows:
| 0
|
[
{
"input": "1",
"output": "1"
},
{
"input": "5",
"output": "70"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "6"
},
{
"input": "4",
"output": "20"
},
{
"input": "6",
"output": "252"
},
{
"input": "7",
"output": "924"
},
{
"input": "9",
"output": "12870"
},
{
"input": "10",
"output": "48620"
},
{
"input": "8",
"output": "3432"
}
] | 1,623,151,053
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 10
| 171
| 5,529,600
|
def recursive_sum(i, j):
if i == 1 or j == 1:
return 1
else:
return recursive_sum(i - 1, j) + recursive_sum(i, j - 1)
if __name__ == '__main__':
n = int(input())
print(recursive_sum(n, n))
|
Title: Maximum in Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An *n*<=×<=*n* table *a* is defined as follows:
- The first row and the first column contain ones, that is: *a**i*,<=1<==<=*a*1,<=*i*<==<=1 for all *i*<==<=1,<=2,<=...,<=*n*. - Each of the remaining numbers in the table is equal to the sum of the number above it and the number to the left of it. In other words, the remaining elements are defined by the formula *a**i*,<=*j*<==<=*a**i*<=-<=1,<=*j*<=+<=*a**i*,<=*j*<=-<=1.
These conditions define all the values in the table.
You are given a number *n*. You need to determine the maximum value in the *n*<=×<=*n* table defined by the rules above.
Input Specification:
The only line of input contains a positive integer *n* (1<=≤<=*n*<=≤<=10) — the number of rows and columns of the table.
Output Specification:
Print a single line containing a positive integer *m* — the maximum value in the table.
Demo Input:
['1\n', '5\n']
Demo Output:
['1', '70']
Note:
In the second test the rows of the table look as follows:
|
```python
def recursive_sum(i, j):
if i == 1 or j == 1:
return 1
else:
return recursive_sum(i - 1, j) + recursive_sum(i, j - 1)
if __name__ == '__main__':
n = int(input())
print(recursive_sum(n, n))
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,676,923,416
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 31
| 0
|
n , m , a = map(int, input().split())
x= n // a
if n % a >0 :
x+= 1
y = n // m
if m % a > 0 :
y += 1
print(y*x)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
n , m , a = map(int, input().split())
x= n // a
if n % a >0 :
x+= 1
y = n // m
if m % a > 0 :
y += 1
print(y*x)
```
| 0
|
148
|
A
|
Insomnia cure
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
|
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
|
Output the number of damaged dragons.
|
[
"1\n2\n3\n4\n12\n",
"2\n3\n4\n5\n24\n"
] |
[
"12\n",
"17\n"
] |
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
| 1,000
|
[
{
"input": "1\n2\n3\n4\n12",
"output": "12"
},
{
"input": "2\n3\n4\n5\n24",
"output": "17"
},
{
"input": "1\n1\n1\n1\n100000",
"output": "100000"
},
{
"input": "10\n9\n8\n7\n6",
"output": "0"
},
{
"input": "8\n4\n4\n3\n65437",
"output": "32718"
},
{
"input": "8\n4\n1\n10\n59392",
"output": "59392"
},
{
"input": "4\n1\n8\n7\n44835",
"output": "44835"
},
{
"input": "6\n1\n7\n2\n62982",
"output": "62982"
},
{
"input": "2\n7\n4\n9\n56937",
"output": "35246"
},
{
"input": "2\n9\n8\n1\n75083",
"output": "75083"
},
{
"input": "8\n7\n7\n6\n69038",
"output": "24656"
},
{
"input": "4\n4\n2\n3\n54481",
"output": "36320"
},
{
"input": "6\n4\n9\n8\n72628",
"output": "28244"
},
{
"input": "9\n7\n8\n10\n42357",
"output": "16540"
},
{
"input": "5\n6\n4\n3\n60504",
"output": "36302"
},
{
"input": "7\n2\n3\n8\n21754",
"output": "15539"
},
{
"input": "1\n2\n10\n4\n39901",
"output": "39901"
},
{
"input": "3\n4\n7\n1\n58048",
"output": "58048"
},
{
"input": "9\n10\n4\n6\n52003",
"output": "21956"
},
{
"input": "5\n10\n9\n3\n70149",
"output": "32736"
},
{
"input": "5\n5\n5\n10\n55592",
"output": "11118"
},
{
"input": "1\n5\n2\n6\n49547",
"output": "49547"
},
{
"input": "3\n7\n7\n7\n84046",
"output": "36019"
},
{
"input": "10\n2\n1\n8\n63537",
"output": "63537"
},
{
"input": "7\n2\n10\n5\n81684",
"output": "53678"
},
{
"input": "7\n1\n6\n8\n99831",
"output": "99831"
},
{
"input": "3\n9\n3\n3\n61082",
"output": "20360"
},
{
"input": "5\n5\n8\n9\n79228",
"output": "29931"
},
{
"input": "1\n5\n5\n6\n89535",
"output": "89535"
},
{
"input": "5\n5\n2\n1\n7682",
"output": "7682"
},
{
"input": "7\n4\n8\n8\n25829",
"output": "9224"
},
{
"input": "3\n4\n3\n3\n87079",
"output": "43539"
},
{
"input": "5\n8\n4\n9\n5226",
"output": "2438"
},
{
"input": "4\n9\n6\n6\n1070",
"output": "415"
},
{
"input": "10\n10\n10\n10\n100000",
"output": "10000"
},
{
"input": "1\n1\n1\n1\n1",
"output": "1"
},
{
"input": "10\n10\n10\n10\n1",
"output": "0"
},
{
"input": "10\n10\n1\n10\n10",
"output": "10"
},
{
"input": "10\n10\n1\n10\n100",
"output": "100"
},
{
"input": "2\n2\n2\n2\n1",
"output": "0"
}
] | 1,688,315,186
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 102,400
|
k = int(input())
l = int(input())
m = int(input())
n = int(input())
f = int(input())
def gcd(a,b):
if a == 0:
return b
else:
return gcd(b%a,a)
def lcm(c,d):
prod = c*d
return prod/gcd(c,d)
list1 = [k, l , m, n]
list1.sort()
Injured = 0
InjuredVamp = []
IVamp = []
IVamp4 = []
IVamp5 = []
if list1[0] == 1:
print(d)
else:
if list1[0] == 2:
InjuredVamp.append(2)
for i in list1:
if i%2 != 0:
InjuredVamp.append(i)
d = InjuredVamp.copy()
k = InjuredVamp.copy()
for i in list1:
if i == 3:
for g in k:
z = InjuredVamp.copy()
if g%3 == 0:
InjuredVamp.pop(z.index(g))
InjuredVamp.append(3)
k = InjuredVamp.copy()
d = InjuredVamp.copy()
if i == 4:
for g in k:
z = InjuredVamp.copy()
if g == 8:
InjuredVamp.pop(z.index(g))
k = InjuredVamp.copy()
d = InjuredVamp.copy()
if i == 5:
for g in k:
z = InjuredVamp.copy()
if g == 10:
InjuredVamp.pop(z.index(g))
k = InjuredVamp.copy()
d = InjuredVamp.copy()
try:
a = InjuredVamp[0]
except:
InjuredVamp = list1
InjuredVamp.sort()
for i in InjuredVamp:
if len(InjuredVamp)==3:
try:
l = InjuredVamp[InjuredVamp.index(i)+1]
IVamp5.append(lcm(i,l))
except:
l = InjuredVamp[0]
IVamp5.append(lcm(i,l))
if len(InjuredVamp) == 4:
try:
l = InjuredVamp[InjuredVamp.index(i)+1]
q = InjuredVamp[InjuredVamp.index(i)+2]
IVamp5.append(lcm(i,l))
IVamp5.append(lcm(i,q))
except:
try:
l = InjuredVamp[InjuredVamp.index(i)+1]
q = InjuredVamp[0]
IVamp5.append(lcm(i,l))
IVamp5.append(lcm(i,q))
except:
l = InjuredVamp[0]
q = InjuredVamp[1]
IVamp5.append(lcm(i,l))
IVamp5.append(lcm(i,q))
IVamp5.sort()
# IVamp5 = list(set(IVamp5))
for i in IVamp5:
IVamp4.append(f//i)
for i in InjuredVamp:
Injured = Injured + f//i
for i in IVamp4:
Injured = Injured - i
print(int(Injured))
|
Title: Insomnia cure
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input Specification:
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output Specification:
Output the number of damaged dragons.
Demo Input:
['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n']
Demo Output:
['12\n', '17\n']
Note:
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
|
```python
k = int(input())
l = int(input())
m = int(input())
n = int(input())
f = int(input())
def gcd(a,b):
if a == 0:
return b
else:
return gcd(b%a,a)
def lcm(c,d):
prod = c*d
return prod/gcd(c,d)
list1 = [k, l , m, n]
list1.sort()
Injured = 0
InjuredVamp = []
IVamp = []
IVamp4 = []
IVamp5 = []
if list1[0] == 1:
print(d)
else:
if list1[0] == 2:
InjuredVamp.append(2)
for i in list1:
if i%2 != 0:
InjuredVamp.append(i)
d = InjuredVamp.copy()
k = InjuredVamp.copy()
for i in list1:
if i == 3:
for g in k:
z = InjuredVamp.copy()
if g%3 == 0:
InjuredVamp.pop(z.index(g))
InjuredVamp.append(3)
k = InjuredVamp.copy()
d = InjuredVamp.copy()
if i == 4:
for g in k:
z = InjuredVamp.copy()
if g == 8:
InjuredVamp.pop(z.index(g))
k = InjuredVamp.copy()
d = InjuredVamp.copy()
if i == 5:
for g in k:
z = InjuredVamp.copy()
if g == 10:
InjuredVamp.pop(z.index(g))
k = InjuredVamp.copy()
d = InjuredVamp.copy()
try:
a = InjuredVamp[0]
except:
InjuredVamp = list1
InjuredVamp.sort()
for i in InjuredVamp:
if len(InjuredVamp)==3:
try:
l = InjuredVamp[InjuredVamp.index(i)+1]
IVamp5.append(lcm(i,l))
except:
l = InjuredVamp[0]
IVamp5.append(lcm(i,l))
if len(InjuredVamp) == 4:
try:
l = InjuredVamp[InjuredVamp.index(i)+1]
q = InjuredVamp[InjuredVamp.index(i)+2]
IVamp5.append(lcm(i,l))
IVamp5.append(lcm(i,q))
except:
try:
l = InjuredVamp[InjuredVamp.index(i)+1]
q = InjuredVamp[0]
IVamp5.append(lcm(i,l))
IVamp5.append(lcm(i,q))
except:
l = InjuredVamp[0]
q = InjuredVamp[1]
IVamp5.append(lcm(i,l))
IVamp5.append(lcm(i,q))
IVamp5.sort()
# IVamp5 = list(set(IVamp5))
for i in IVamp5:
IVamp4.append(f//i)
for i in InjuredVamp:
Injured = Injured + f//i
for i in IVamp4:
Injured = Injured - i
print(int(Injured))
```
| -1
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,618,549,043
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 0
|
str=input()
upper=0
lower=0
for i in range(len(str)):
#to lower case letter
if(ord(str[i])>=97 and ord(str[i])<=122):
lower+=1
#to upper case letter
elif(ord(str[i])>=65 and ord(str[i])<=90):
upper+=1
if lower>=upper:
print(str.lower())
else:
print(str.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
str=input()
upper=0
lower=0
for i in range(len(str)):
#to lower case letter
if(ord(str[i])>=97 and ord(str[i])<=122):
lower+=1
#to upper case letter
elif(ord(str[i])>=65 and ord(str[i])<=90):
upper+=1
if lower>=upper:
print(str.lower())
else:
print(str.upper())
```
| 3.969
|
888
|
C
|
K-Dominant Character
|
PROGRAMMING
| 1,400
|
[
"binary search",
"implementation",
"two pointers"
] | null | null |
You are given a string *s* consisting of lowercase Latin letters. Character *c* is called *k*-dominant iff each substring of *s* with length at least *k* contains this character *c*.
You have to find minimum *k* such that there exists at least one *k*-dominant character.
|
The first line contains string *s* consisting of lowercase Latin letters (1<=≤<=|*s*|<=≤<=100000).
|
Print one number — the minimum value of *k* such that there exists at least one *k*-dominant character.
|
[
"abacaba\n",
"zzzzz\n",
"abcde\n"
] |
[
"2\n",
"1\n",
"3\n"
] |
none
| 0
|
[
{
"input": "abacaba",
"output": "2"
},
{
"input": "zzzzz",
"output": "1"
},
{
"input": "abcde",
"output": "3"
},
{
"input": "bcaccacaaabaacaabaaabcbbcbcaacacbcbaaaacccacbbcbaabcbacaacbabacacacaccbbccbcbacbbbbccccabcabaaab",
"output": "8"
},
{
"input": "daabcdabbabbacacbaacabacbcaabaacac",
"output": "4"
},
{
"input": "abghim",
"output": "4"
},
{
"input": "gfliflgfhhdkceacdljgkegmdlhcgkcmlelmbbbmdddgdeeljjhgbbffmemmmkhebgkhadkdajabcjkcgbkgbaeacdedlkklfech",
"output": "17"
},
{
"input": "a",
"output": "1"
},
{
"input": "aaabbb",
"output": "4"
},
{
"input": "ab",
"output": "2"
},
{
"input": "abbb",
"output": "2"
},
{
"input": "ob",
"output": "2"
},
{
"input": "abccba",
"output": "3"
},
{
"input": "saaaaaaaas",
"output": "2"
},
{
"input": "axxx",
"output": "2"
},
{
"input": "abcba",
"output": "2"
},
{
"input": "abb",
"output": "2"
},
{
"input": "abcdea",
"output": "4"
},
{
"input": "axcbb",
"output": "3"
},
{
"input": "tmivvdcbbfrfogjviirrximhttoskopwrcmkcborcxvr",
"output": "13"
},
{
"input": "dlchmmuateksgldkckljrovmeuniobjrelqjpnjljlvhpqrjsfklliqpufplgaelevmlcnodbllquubobecem",
"output": "15"
},
{
"input": "zx",
"output": "2"
},
{
"input": "zxz",
"output": "2"
},
{
"input": "bbhdgaefbhf",
"output": "6"
},
{
"input": "xx",
"output": "1"
},
{
"input": "zxx",
"output": "2"
},
{
"input": "cbcada",
"output": "4"
},
{
"input": "z",
"output": "1"
},
{
"input": "aab",
"output": "2"
},
{
"input": "jficc",
"output": "3"
},
{
"input": "cceeaabfba",
"output": "5"
},
{
"input": "jk",
"output": "2"
},
{
"input": "lzeznbwu",
"output": "5"
},
{
"input": "rr",
"output": "1"
}
] | 1,511,242,995
| 5,295
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 2,000
| 102,400
|
s = input()
f=0
k=1
p=[]
while f==0:
i=0
c=0
while i<len(s)-k:
if c==0:
for j in range(i,i+k):
p.append(s[j])
else:
for j in p:
if s[i:i+k].find(j)==-1:
p.remove(j)
c+=1
i+=1
if len(p)!=0 :
f=1
else:
k+=1
print(k)
|
Title: K-Dominant Character
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting of lowercase Latin letters. Character *c* is called *k*-dominant iff each substring of *s* with length at least *k* contains this character *c*.
You have to find minimum *k* such that there exists at least one *k*-dominant character.
Input Specification:
The first line contains string *s* consisting of lowercase Latin letters (1<=≤<=|*s*|<=≤<=100000).
Output Specification:
Print one number — the minimum value of *k* such that there exists at least one *k*-dominant character.
Demo Input:
['abacaba\n', 'zzzzz\n', 'abcde\n']
Demo Output:
['2\n', '1\n', '3\n']
Note:
none
|
```python
s = input()
f=0
k=1
p=[]
while f==0:
i=0
c=0
while i<len(s)-k:
if c==0:
for j in range(i,i+k):
p.append(s[j])
else:
for j in p:
if s[i:i+k].find(j)==-1:
p.remove(j)
c+=1
i+=1
if len(p)!=0 :
f=1
else:
k+=1
print(k)
```
| 0
|
|
447
|
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000
|
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,587,554,870
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 24
| 140
| 0
|
def s_till(n):
return n*(n+1)//2
z = str(input())
k = int(input())
va = list(map(int,input().split()))
c_va = {chr(97+h):i for h,i in enumerate(va) }
ans = 0
for ind, i in enumerate(z):
ans+=(ind+1)*c_va[i]
to_mult = s_till(k+len(z)) - s_till(len(z))
ans+=to_mult*max(c_va.values())
print(ans)
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
def s_till(n):
return n*(n+1)//2
z = str(input())
k = int(input())
va = list(map(int,input().split()))
c_va = {chr(97+h):i for h,i in enumerate(va) }
ans = 0
for ind, i in enumerate(z):
ans+=(ind+1)*c_va[i]
to_mult = s_till(k+len(z)) - s_till(len(z))
ans+=to_mult*max(c_va.values())
print(ans)
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,597,843,843
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 40
| 140
| 0
|
str1 = "hello"
str2 = input()
m = len(str1)
n = len(str2)
j = 0
i = 0
while j<m and i<n:
if str1[j] == str2[i]:
j = j+1
i = i + 1
if (j==m):
print("YES\n")
else:
print("NO\n")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
str1 = "hello"
str2 = input()
m = len(str1)
n = len(str2)
j = 0
i = 0
while j<m and i<n:
if str1[j] == str2[i]:
j = j+1
i = i + 1
if (j==m):
print("YES\n")
else:
print("NO\n")
```
| 3.93
|
965
|
A
|
Paper Airplanes
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
|
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
|
Print a single integer — the minimum number of packs they should buy.
|
[
"5 3 2 3\n",
"5 3 100 1\n"
] |
[
"4\n",
"5\n"
] |
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
| 500
|
[
{
"input": "5 3 2 3",
"output": "4"
},
{
"input": "5 3 100 1",
"output": "5"
},
{
"input": "10000 10000 1 1",
"output": "100000000"
},
{
"input": "1 1 10000 10000",
"output": "1"
},
{
"input": "300 300 21 23",
"output": "196"
},
{
"input": "300 2 37 51",
"output": "6"
},
{
"input": "2 400 23 57",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "10000 10000 3 2",
"output": "16670000"
},
{
"input": "1 2 1 2",
"output": "1"
},
{
"input": "1 1 2 2",
"output": "1"
},
{
"input": "1 1 10 10",
"output": "1"
},
{
"input": "5324 5439 32 13",
"output": "69622"
},
{
"input": "9000 1 2432 1",
"output": "9000"
},
{
"input": "230 1234 9124 23",
"output": "10"
},
{
"input": "11 1 1 1",
"output": "11"
},
{
"input": "6246 8489 1227 9",
"output": "4858"
},
{
"input": "9 20 5 7",
"output": "6"
}
] | 1,525,606,944
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 18
| 93
| 7,065,600
|
from math import ceil
k, n, s, p = [int(i) for i in input().split(" ")]
print(ceil(k*ceil(n/s)/p))
|
Title: Paper Airplanes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
To make a paper airplane, one has to use a rectangular piece of paper. From a sheet of standard size you can make $s$ airplanes.
A group of $k$ people decided to make $n$ airplanes each. They are going to buy several packs of paper, each of them containing $p$ sheets, and then distribute the sheets between the people. Each person should have enough sheets to make $n$ airplanes. How many packs should they buy?
Input Specification:
The only line contains four integers $k$, $n$, $s$, $p$ ($1 \le k, n, s, p \le 10^4$) — the number of people, the number of airplanes each should make, the number of airplanes that can be made using one sheet and the number of sheets in one pack, respectively.
Output Specification:
Print a single integer — the minimum number of packs they should buy.
Demo Input:
['5 3 2 3\n', '5 3 100 1\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample they have to buy $4$ packs of paper: there will be $12$ sheets in total, and giving $2$ sheets to each person is enough to suit everyone's needs.
In the second sample they have to buy a pack for each person as they can't share sheets.
|
```python
from math import ceil
k, n, s, p = [int(i) for i in input().split(" ")]
print(ceil(k*ceil(n/s)/p))
```
| 3
|
|
527
|
A
|
Playing with Paper
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
|
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
|
Print a single integer — the number of ships that Vasya will make.
|
[
"2 1\n",
"10 7\n",
"1000000000000 1\n"
] |
[
"2\n",
"6\n",
"1000000000000\n"
] |
Pictures to the first and second sample test.
| 500
|
[
{
"input": "2 1",
"output": "2"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "1000000000000 1",
"output": "1000000000000"
},
{
"input": "3 1",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "3 2",
"output": "3"
},
{
"input": "4 2",
"output": "2"
},
{
"input": "1000 700",
"output": "6"
},
{
"input": "959986566087 524054155168",
"output": "90"
},
{
"input": "4 3",
"output": "4"
},
{
"input": "7 6",
"output": "7"
},
{
"input": "1000 999",
"output": "1000"
},
{
"input": "1000 998",
"output": "500"
},
{
"input": "1000 997",
"output": "336"
},
{
"input": "42 1",
"output": "42"
},
{
"input": "1000 1",
"output": "1000"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "13 8",
"output": "6"
},
{
"input": "987 610",
"output": "15"
},
{
"input": "442 42",
"output": "22"
},
{
"input": "754 466",
"output": "13"
},
{
"input": "1000000000000 999999999999",
"output": "1000000000000"
},
{
"input": "1000000000000 999999999998",
"output": "500000000000"
},
{
"input": "941 14",
"output": "74"
},
{
"input": "998 2",
"output": "499"
},
{
"input": "1000 42",
"output": "32"
},
{
"input": "1000 17",
"output": "66"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "4"
},
{
"input": "5 3",
"output": "4"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "293 210",
"output": "17"
},
{
"input": "787878787878 424242424242",
"output": "8"
},
{
"input": "956722026041 591286729879",
"output": "58"
},
{
"input": "956722026041 365435296162",
"output": "58"
},
{
"input": "628625247282 464807889701",
"output": "102"
},
{
"input": "695928431619 424778620208",
"output": "167"
},
{
"input": "1000000000000 42",
"output": "23809523821"
},
{
"input": "987654345678 23",
"output": "42941493300"
},
{
"input": "10000000001 2",
"output": "5000000002"
},
{
"input": "1000000000000 2",
"output": "500000000000"
},
{
"input": "1000000000000 3",
"output": "333333333336"
},
{
"input": "100000000000 3",
"output": "33333333336"
},
{
"input": "100000000000 23",
"output": "4347826109"
},
{
"input": "999999999997 7",
"output": "142857142861"
},
{
"input": "8589934592 4294967296",
"output": "2"
}
] | 1,606,035,358
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 46
| 108
| 0
|
raw = str(input()).split()
a = int(raw[0])
b = int(raw[1])
c = 0
while(a != 0 and b != 0):
if (a > b):
c += int(a/b)
a = a % b
else:
c += int(b/a)
b = b % a
print(c)
|
Title: Playing with Paper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya was sitting on a not so interesting Maths lesson and making an origami from a rectangular *a* mm <=×<= *b* mm sheet of paper (*a*<=><=*b*). Usually the first step in making an origami is making a square piece of paper from the rectangular sheet by folding the sheet along the bisector of the right angle, and cutting the excess part.
After making a paper ship from the square piece, Vasya looked on the remaining (*a*<=-<=*b*) mm <=×<= *b* mm strip of paper. He got the idea to use this strip of paper in the same way to make an origami, and then use the remainder (if it exists) and so on. At the moment when he is left with a square piece of paper, he will make the last ship from it and stop.
Can you determine how many ships Vasya will make during the lesson?
Input Specification:
The first line of the input contains two integers *a*, *b* (1<=≤<=*b*<=<<=*a*<=≤<=1012) — the sizes of the original sheet of paper.
Output Specification:
Print a single integer — the number of ships that Vasya will make.
Demo Input:
['2 1\n', '10 7\n', '1000000000000 1\n']
Demo Output:
['2\n', '6\n', '1000000000000\n']
Note:
Pictures to the first and second sample test.
|
```python
raw = str(input()).split()
a = int(raw[0])
b = int(raw[1])
c = 0
while(a != 0 and b != 0):
if (a > b):
c += int(a/b)
a = a % b
else:
c += int(b/a)
b = b % a
print(c)
```
| 3
|
|
954
|
A
|
Diagonal Walking
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Mikhail walks on a 2D plane. He can go either up or right. You are given a sequence of Mikhail's moves. He thinks that this sequence is too long and he wants to make it as short as possible.
In the given sequence moving up is described by character U and moving right is described by character R. Mikhail can replace any pair of consecutive moves RU or UR with a diagonal move (described as character D). After that, he can go on and do some other replacements, until there is no pair of consecutive moves RU or UR left.
Your problem is to print the minimum possible length of the sequence of moves after the replacements.
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence. The second line contains the sequence consisting of *n* characters U and R.
|
Print the minimum possible length of the sequence of moves after all replacements are done.
|
[
"5\nRUURU\n",
"17\nUUURRRRRUUURURUUU\n"
] |
[
"3\n",
"13\n"
] |
In the first test the shortened sequence of moves may be DUD (its length is 3).
In the second test the shortened sequence of moves can be UUDRRRDUDDUUU (its length is 13).
| 0
|
[
{
"input": "5\nRUURU",
"output": "3"
},
{
"input": "17\nUUURRRRRUUURURUUU",
"output": "13"
},
{
"input": "100\nUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU",
"output": "100"
},
{
"input": "100\nRRURRUUUURURRRURRRRURRRRRRURRUURRRUUURUURURRURUURUURRUURUURRURURUUUUURUUUUUURRUUURRRURRURRRUURRUUUUR",
"output": "67"
},
{
"input": "100\nUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUURUUUUUUUUUUUUUUUUUUUUU",
"output": "99"
},
{
"input": "3\nRUR",
"output": "2"
},
{
"input": "1\nR",
"output": "1"
},
{
"input": "5\nRURUU",
"output": "3"
},
{
"input": "1\nU",
"output": "1"
},
{
"input": "2\nUR",
"output": "1"
},
{
"input": "23\nUUUUUUUUUUUUUUUUUUUUUUU",
"output": "23"
}
] | 1,637,577,005
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 11
| 46
| 0
|
n=int(input())
s=input()+""
i=0
x=0
while i<(len(s)-1):
if s[i]=='U'and s[i+1]=='R' or s[i]=='R'and s[i+1]=='U' :
x=x+1
i=i+2
else:
i=i+1
print(len(s)-x)
|
Title: Diagonal Walking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mikhail walks on a 2D plane. He can go either up or right. You are given a sequence of Mikhail's moves. He thinks that this sequence is too long and he wants to make it as short as possible.
In the given sequence moving up is described by character U and moving right is described by character R. Mikhail can replace any pair of consecutive moves RU or UR with a diagonal move (described as character D). After that, he can go on and do some other replacements, until there is no pair of consecutive moves RU or UR left.
Your problem is to print the minimum possible length of the sequence of moves after the replacements.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence. The second line contains the sequence consisting of *n* characters U and R.
Output Specification:
Print the minimum possible length of the sequence of moves after all replacements are done.
Demo Input:
['5\nRUURU\n', '17\nUUURRRRRUUURURUUU\n']
Demo Output:
['3\n', '13\n']
Note:
In the first test the shortened sequence of moves may be DUD (its length is 3).
In the second test the shortened sequence of moves can be UUDRRRDUDDUUU (its length is 13).
|
```python
n=int(input())
s=input()+""
i=0
x=0
while i<(len(s)-1):
if s[i]=='U'and s[i+1]=='R' or s[i]=='R'and s[i+1]=='U' :
x=x+1
i=i+2
else:
i=i+1
print(len(s)-x)
```
| 3
|
|
760
|
A
|
Petr and a calendar
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
|
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
|
Print single integer: the number of columns the table should have.
|
[
"1 7\n",
"1 1\n",
"11 6\n"
] |
[
"6\n",
"5\n",
"5\n"
] |
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
| 500
|
[
{
"input": "1 7",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "1 2",
"output": "5"
},
{
"input": "1 3",
"output": "5"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "6"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "2 4",
"output": "5"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "3 1",
"output": "5"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "5"
},
{
"input": "3 4",
"output": "5"
},
{
"input": "3 5",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "3 7",
"output": "6"
},
{
"input": "4 1",
"output": "5"
},
{
"input": "4 2",
"output": "5"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "4 5",
"output": "5"
},
{
"input": "4 6",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "5"
},
{
"input": "5 3",
"output": "5"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "5 5",
"output": "5"
},
{
"input": "5 6",
"output": "6"
},
{
"input": "5 7",
"output": "6"
},
{
"input": "6 1",
"output": "5"
},
{
"input": "6 2",
"output": "5"
},
{
"input": "6 3",
"output": "5"
},
{
"input": "6 4",
"output": "5"
},
{
"input": "6 5",
"output": "5"
},
{
"input": "6 6",
"output": "5"
},
{
"input": "6 7",
"output": "6"
},
{
"input": "7 1",
"output": "5"
},
{
"input": "7 2",
"output": "5"
},
{
"input": "7 3",
"output": "5"
},
{
"input": "7 4",
"output": "5"
},
{
"input": "7 5",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "8 1",
"output": "5"
},
{
"input": "8 2",
"output": "5"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "5"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "8 7",
"output": "6"
},
{
"input": "9 1",
"output": "5"
},
{
"input": "9 2",
"output": "5"
},
{
"input": "9 3",
"output": "5"
},
{
"input": "9 4",
"output": "5"
},
{
"input": "9 5",
"output": "5"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "10 1",
"output": "5"
},
{
"input": "10 2",
"output": "5"
},
{
"input": "10 3",
"output": "5"
},
{
"input": "10 4",
"output": "5"
},
{
"input": "10 5",
"output": "5"
},
{
"input": "10 6",
"output": "6"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "11 1",
"output": "5"
},
{
"input": "11 2",
"output": "5"
},
{
"input": "11 3",
"output": "5"
},
{
"input": "11 4",
"output": "5"
},
{
"input": "11 5",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "12 1",
"output": "5"
},
{
"input": "12 2",
"output": "5"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "12 4",
"output": "5"
},
{
"input": "12 5",
"output": "5"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 7",
"output": "6"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "6 6",
"output": "5"
}
] | 1,548,923,590
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 104
| 109
| 0
|
X = list(map(int , input().split()))
if X[0] in [1,3,5,7,8,10,12]:
print(5 if X[1]<=5 else 6)
exit()
if X[0] in [11,9,6,4]:
print(5 if X[1]<=6 else 6)
exit()
print(4 if X[1]==1 else 5)
|
Title: Petr and a calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
Input Specification:
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
Output Specification:
Print single integer: the number of columns the table should have.
Demo Input:
['1 7\n', '1 1\n', '11 6\n']
Demo Output:
['6\n', '5\n', '5\n']
Note:
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
|
```python
X = list(map(int , input().split()))
if X[0] in [1,3,5,7,8,10,12]:
print(5 if X[1]<=5 else 6)
exit()
if X[0] in [11,9,6,4]:
print(5 if X[1]<=6 else 6)
exit()
print(4 if X[1]==1 else 5)
```
| 3
|
|
508
|
A
|
Pasha and Pixels
|
PROGRAMMING
| 1,100
|
[
"brute force"
] | null | null |
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
|
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
|
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
|
[
"2 2 4\n1 1\n1 2\n2 1\n2 2\n",
"2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n",
"5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n"
] |
[
"4\n",
"5\n",
"0\n"
] |
none
| 500
|
[
{
"input": "2 2 4\n1 1\n1 2\n2 1\n2 2",
"output": "4"
},
{
"input": "2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1",
"output": "5"
},
{
"input": "5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2",
"output": "0"
},
{
"input": "3 3 11\n2 1\n3 1\n1 1\n1 3\n1 2\n2 3\n3 3\n3 2\n2 2\n1 3\n3 3",
"output": "9"
},
{
"input": "2 2 5\n1 1\n2 1\n2 1\n1 2\n2 2",
"output": "5"
},
{
"input": "518 518 10\n37 97\n47 278\n17 467\n158 66\n483 351\n83 123\n285 219\n513 187\n380 75\n304 352",
"output": "0"
},
{
"input": "1 1 5\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "0"
},
{
"input": "1 5 5\n1 1\n1 2\n1 3\n1 4\n1 5",
"output": "0"
},
{
"input": "5 1 5\n1 1\n2 1\n3 1\n4 1\n5 1",
"output": "0"
},
{
"input": "1 1 1\n1 1",
"output": "0"
},
{
"input": "10 10 4\n5 9\n6 9\n6 10\n5 10",
"output": "4"
},
{
"input": "1000 1000 4\n999 999\n999 1000\n1000 999\n1000 1000",
"output": "4"
},
{
"input": "2 3 5\n2 3\n1 3\n1 2\n1 1\n2 2",
"output": "5"
},
{
"input": "1000 1000 4\n1000 1000\n999 999\n1000 999\n999 1000",
"output": "4"
}
] | 1,668,072,641
| 2,147,483,647
|
PyPy 3-64
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 15
| 2,000
| 11,366,400
|
n,m,k = map(int,input().split())
matrix = [[1]*m for _ in range(n)]
state = [[4]*(m-1) for _ in range(n-1)]
point = True
ans = 0
for s in range(k):
if point == True:
i,j = map(int,input().split()) # matrix[i-1][j-1] = 0
if matrix[i-1][j-1] == 0:
continue
else:
matrix[i-1][j-1] = 0
if 1 < i < n and 1 < j < m: #inside
state[i-1][j-1] -= 1
state[i-2][j-1] -= 1
state[i-1][j-2] -= 1
state[i-2][j-2] -= 1
elif (i == 1 and j == 1) or (i == 1 and j == m) or (i == n and j == 1) or(i == n and j == m):
if i == 1 and j == 1:
state[0][0] -= 1
if i == 1 and j == m:
state[0][-1] -= 1
if i == n and j == 1:
state[-1][0] -= 1
if i == n and j == m:
state[-1][-1] -= 1
elif i == 1:
state[i-1][j-1] -= 1
state[i-1][j-2] -= 1
elif j == 1:
state[i-1][j-1] -= 1
state[i-2][j-1] -= 1
elif i == n:
state[i-2][j-1] -= 1
state[i-2][j-2] -= 1
else:
state[i-1][j-2] -= 1
state[i-2][j-2] -= 1
tniop = True
for _ in state:
if 0 in _ and tniop == True:
ans = s + 1
point = False
tniop = False
else:
i,j = map(int,input().split())
continue
print(ans)
|
Title: Pasha and Pixels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
Input Specification:
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
Output Specification:
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
Demo Input:
['2 2 4\n1 1\n1 2\n2 1\n2 2\n', '2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n', '5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n']
Demo Output:
['4\n', '5\n', '0\n']
Note:
none
|
```python
n,m,k = map(int,input().split())
matrix = [[1]*m for _ in range(n)]
state = [[4]*(m-1) for _ in range(n-1)]
point = True
ans = 0
for s in range(k):
if point == True:
i,j = map(int,input().split()) # matrix[i-1][j-1] = 0
if matrix[i-1][j-1] == 0:
continue
else:
matrix[i-1][j-1] = 0
if 1 < i < n and 1 < j < m: #inside
state[i-1][j-1] -= 1
state[i-2][j-1] -= 1
state[i-1][j-2] -= 1
state[i-2][j-2] -= 1
elif (i == 1 and j == 1) or (i == 1 and j == m) or (i == n and j == 1) or(i == n and j == m):
if i == 1 and j == 1:
state[0][0] -= 1
if i == 1 and j == m:
state[0][-1] -= 1
if i == n and j == 1:
state[-1][0] -= 1
if i == n and j == m:
state[-1][-1] -= 1
elif i == 1:
state[i-1][j-1] -= 1
state[i-1][j-2] -= 1
elif j == 1:
state[i-1][j-1] -= 1
state[i-2][j-1] -= 1
elif i == n:
state[i-2][j-1] -= 1
state[i-2][j-2] -= 1
else:
state[i-1][j-2] -= 1
state[i-2][j-2] -= 1
tniop = True
for _ in state:
if 0 in _ and tniop == True:
ans = s + 1
point = False
tniop = False
else:
i,j = map(int,input().split())
continue
print(ans)
```
| 0
|
|
112
|
A
|
Petya and Strings
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Petya and Strings
|
2
|
256
|
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
|
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
|
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
|
[
"aaaa\naaaA\n",
"abs\nAbz\n",
"abcdefg\nAbCdEfF\n"
] |
[
"0\n",
"-1\n",
"1\n"
] |
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
| 500
|
[
{
"input": "aaaa\naaaA",
"output": "0"
},
{
"input": "abs\nAbz",
"output": "-1"
},
{
"input": "abcdefg\nAbCdEfF",
"output": "1"
},
{
"input": "asadasdasd\nasdwasdawd",
"output": "-1"
},
{
"input": "aslkjlkasdd\nasdlkjdajwi",
"output": "1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp",
"output": "0"
},
{
"input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH",
"output": "-1"
},
{
"input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt",
"output": "1"
},
{
"input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL",
"output": "1"
},
{
"input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo",
"output": "1"
},
{
"input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja",
"output": "-1"
},
{
"input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy",
"output": "1"
},
{
"input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR",
"output": "1"
},
{
"input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd",
"output": "1"
},
{
"input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI",
"output": "-1"
},
{
"input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC",
"output": "-1"
},
{
"input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl",
"output": "-1"
},
{
"input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo",
"output": "-1"
},
{
"input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV",
"output": "-1"
},
{
"input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ",
"output": "-1"
},
{
"input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK",
"output": "-1"
},
{
"input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys",
"output": "1"
},
{
"input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy",
"output": "-1"
},
{
"input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK",
"output": "-1"
},
{
"input": "UG\nak",
"output": "1"
},
{
"input": "JZR\nVae",
"output": "-1"
},
{
"input": "a\nZ",
"output": "-1"
},
{
"input": "rk\nkv",
"output": "1"
},
{
"input": "RvuT\nbJzE",
"output": "1"
},
{
"input": "PPS\nydq",
"output": "-1"
},
{
"input": "q\nq",
"output": "0"
},
{
"input": "peOw\nIgSJ",
"output": "1"
},
{
"input": "PyK\noKN",
"output": "1"
},
{
"input": "O\ni",
"output": "1"
},
{
"input": "NmGY\npDlP",
"output": "-1"
},
{
"input": "nG\nZf",
"output": "-1"
},
{
"input": "m\na",
"output": "1"
},
{
"input": "MWyB\nWZEV",
"output": "-1"
},
{
"input": "Gre\nfxc",
"output": "1"
},
{
"input": "Ooq\nwap",
"output": "-1"
},
{
"input": "XId\nlbB",
"output": "1"
},
{
"input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF",
"output": "0"
},
{
"input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD",
"output": "0"
},
{
"input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA",
"output": "0"
},
{
"input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ",
"output": "0"
},
{
"input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG",
"output": "0"
},
{
"input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ",
"output": "0"
},
{
"input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ",
"output": "0"
},
{
"input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi",
"output": "0"
},
{
"input": "abac\nadaa",
"output": "-1"
},
{
"input": "Bbc\nabc",
"output": "1"
},
{
"input": "aaaba\naaaab",
"output": "1"
}
] | 1,695,803,740
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 53
| 92
| 5,632,000
|
# -*- coding: utf-8 -*-
"""
Created on Wed Sep 27 16:29:38 2023
@author: 王天齐
"""
a1=input().lower()
a2=input().lower()
if a1 > a2:
print('1')
elif a1 == a2:
print('0')
else:
print('-1')
|
Title: Petya and Strings
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
Input Specification:
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
Output Specification:
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
Demo Input:
['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n']
Demo Output:
['0\n', '-1\n', '1\n']
Note:
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
|
```python
# -*- coding: utf-8 -*-
"""
Created on Wed Sep 27 16:29:38 2023
@author: 王天齐
"""
a1=input().lower()
a2=input().lower()
if a1 > a2:
print('1')
elif a1 == a2:
print('0')
else:
print('-1')
```
| 3.96651
|
177
|
B1
|
Rectangular Game
|
PROGRAMMING
| 1,000
|
[
"number theory"
] | null | null |
The Smart Beaver from ABBYY decided to have a day off. But doing nothing the whole day turned out to be too boring, and he decided to play a game with pebbles. Initially, the Beaver has *n* pebbles. He arranges them in *a* equal rows, each row has *b* pebbles (*a*<=><=1). Note that the Beaver must use all the pebbles he has, i. e. *n*<==<=*a*·*b*.
Once the Smart Beaver has arranged the pebbles, he takes back any of the resulting rows (that is, *b* pebbles) and discards all other pebbles. Then he arranges all his pebbles again (possibly choosing other values of *a* and *b*) and takes back one row, and so on. The game continues until at some point the Beaver ends up with exactly one pebble.
The game process can be represented as a finite sequence of integers *c*1,<=...,<=*c**k*, where:
- *c*1<==<=*n* - *c**i*<=+<=1 is the number of pebbles that the Beaver ends up with after the *i*-th move, that is, the number of pebbles in a row after some arrangement of *c**i* pebbles (1<=≤<=*i*<=<<=*k*). Note that *c**i*<=><=*c**i*<=+<=1. - *c**k*<==<=1
The result of the game is the sum of numbers *c**i*. You are given *n*. Find the maximum possible result of the game.
|
The single line of the input contains a single integer *n* — the initial number of pebbles the Smart Beaver has.
The input limitations for getting 30 points are:
- 2<=≤<=*n*<=≤<=50
The input limitations for getting 100 points are:
- 2<=≤<=*n*<=≤<=109
|
Print a single number — the maximum possible result of the game.
|
[
"10\n",
"8\n"
] |
[
"16\n",
"15\n"
] |
Consider the first example (*c*<sub class="lower-index">1</sub> = 10). The possible options for the game development are:
- Arrange the pebbles in 10 rows, one pebble per row. Then *c*<sub class="lower-index">2</sub> = 1, and the game ends after the first move with the result of 11. - Arrange the pebbles in 5 rows, two pebbles per row. Then *c*<sub class="lower-index">2</sub> = 2, and the game continues. During the second move we have two pebbles which can be arranged in a unique way (remember that you are not allowed to put all the pebbles in the same row!) — 2 rows, one pebble per row. *c*<sub class="lower-index">3</sub> = 1, and the game ends with the result of 13. - Finally, arrange the pebbles in two rows, five pebbles per row. The same logic leads us to *c*<sub class="lower-index">2</sub> = 5, *c*<sub class="lower-index">3</sub> = 1, and the game ends with the result of 16 — the maximum possible result.
| 30
|
[
{
"input": "10",
"output": "16"
},
{
"input": "8",
"output": "15"
},
{
"input": "4",
"output": "7"
},
{
"input": "36",
"output": "67"
},
{
"input": "32",
"output": "63"
},
{
"input": "46",
"output": "70"
},
{
"input": "6",
"output": "10"
},
{
"input": "13",
"output": "14"
},
{
"input": "9",
"output": "13"
},
{
"input": "18",
"output": "31"
},
{
"input": "20",
"output": "36"
},
{
"input": "37",
"output": "38"
},
{
"input": "42",
"output": "71"
},
{
"input": "50",
"output": "81"
},
{
"input": "48",
"output": "94"
},
{
"input": "33",
"output": "45"
},
{
"input": "49",
"output": "57"
},
{
"input": "34",
"output": "52"
},
{
"input": "35",
"output": "43"
},
{
"input": "37",
"output": "38"
},
{
"input": "39",
"output": "53"
},
{
"input": "42",
"output": "71"
},
{
"input": "14",
"output": "22"
},
{
"input": "2",
"output": "3"
},
{
"input": "3",
"output": "4"
},
{
"input": "5",
"output": "6"
}
] | 1,671,756,273
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS1
| 7
| 92
| 0
|
n= int(input())
count=n
def is_prime(max):
flag=True
if max<=2:
flag=True
else:
for i in range(2,(max//2)+1):
if max%i==0:
flag=False
break
return flag
while True:
max=1
for i in range(2,(n//2)+1):
if n%i==0:
current=i
if current>max:
max=current
if not is_prime(max):
count+=max
else:
print(count+max+1)
exit()
n=max
|
Title: Rectangular Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Smart Beaver from ABBYY decided to have a day off. But doing nothing the whole day turned out to be too boring, and he decided to play a game with pebbles. Initially, the Beaver has *n* pebbles. He arranges them in *a* equal rows, each row has *b* pebbles (*a*<=><=1). Note that the Beaver must use all the pebbles he has, i. e. *n*<==<=*a*·*b*.
Once the Smart Beaver has arranged the pebbles, he takes back any of the resulting rows (that is, *b* pebbles) and discards all other pebbles. Then he arranges all his pebbles again (possibly choosing other values of *a* and *b*) and takes back one row, and so on. The game continues until at some point the Beaver ends up with exactly one pebble.
The game process can be represented as a finite sequence of integers *c*1,<=...,<=*c**k*, where:
- *c*1<==<=*n* - *c**i*<=+<=1 is the number of pebbles that the Beaver ends up with after the *i*-th move, that is, the number of pebbles in a row after some arrangement of *c**i* pebbles (1<=≤<=*i*<=<<=*k*). Note that *c**i*<=><=*c**i*<=+<=1. - *c**k*<==<=1
The result of the game is the sum of numbers *c**i*. You are given *n*. Find the maximum possible result of the game.
Input Specification:
The single line of the input contains a single integer *n* — the initial number of pebbles the Smart Beaver has.
The input limitations for getting 30 points are:
- 2<=≤<=*n*<=≤<=50
The input limitations for getting 100 points are:
- 2<=≤<=*n*<=≤<=109
Output Specification:
Print a single number — the maximum possible result of the game.
Demo Input:
['10\n', '8\n']
Demo Output:
['16\n', '15\n']
Note:
Consider the first example (*c*<sub class="lower-index">1</sub> = 10). The possible options for the game development are:
- Arrange the pebbles in 10 rows, one pebble per row. Then *c*<sub class="lower-index">2</sub> = 1, and the game ends after the first move with the result of 11. - Arrange the pebbles in 5 rows, two pebbles per row. Then *c*<sub class="lower-index">2</sub> = 2, and the game continues. During the second move we have two pebbles which can be arranged in a unique way (remember that you are not allowed to put all the pebbles in the same row!) — 2 rows, one pebble per row. *c*<sub class="lower-index">3</sub> = 1, and the game ends with the result of 13. - Finally, arrange the pebbles in two rows, five pebbles per row. The same logic leads us to *c*<sub class="lower-index">2</sub> = 5, *c*<sub class="lower-index">3</sub> = 1, and the game ends with the result of 16 — the maximum possible result.
|
```python
n= int(input())
count=n
def is_prime(max):
flag=True
if max<=2:
flag=True
else:
for i in range(2,(max//2)+1):
if max%i==0:
flag=False
break
return flag
while True:
max=1
for i in range(2,(n//2)+1):
if n%i==0:
current=i
if current>max:
max=current
if not is_prime(max):
count+=max
else:
print(count+max+1)
exit()
n=max
```
| 0
|
|
92
|
A
|
Chips
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] |
A. Chips
|
2
|
256
|
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
|
Print the number of chips the presenter ended up with.
|
[
"4 11\n",
"17 107\n",
"3 8\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
| 500
|
[
{
"input": "4 11",
"output": "0"
},
{
"input": "17 107",
"output": "2"
},
{
"input": "3 8",
"output": "1"
},
{
"input": "46 7262",
"output": "35"
},
{
"input": "32 6864",
"output": "0"
},
{
"input": "36 6218",
"output": "14"
},
{
"input": "25 9712",
"output": "11"
},
{
"input": "9 7601",
"output": "5"
},
{
"input": "1 9058",
"output": "0"
},
{
"input": "29 7772",
"output": "26"
},
{
"input": "45 9465",
"output": "14"
},
{
"input": "46 866",
"output": "5"
},
{
"input": "29 1241",
"output": "20"
},
{
"input": "17 4248",
"output": "12"
},
{
"input": "20 8082",
"output": "11"
},
{
"input": "50 9555",
"output": "0"
},
{
"input": "4 7455",
"output": "2"
},
{
"input": "36 880",
"output": "4"
},
{
"input": "24 7440",
"output": "9"
},
{
"input": "44 7888",
"output": "12"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "50 10000",
"output": "40"
},
{
"input": "1 10000",
"output": "0"
},
{
"input": "50 1",
"output": "0"
},
{
"input": "50 50",
"output": "5"
}
] | 1,552,413,897
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 218
| 0
|
'''
Amirhossein Alimirzaei
Telegram : @HajLorenzo
Instagram : amirhossein_alimirzaei
University of Bojnourd'''
x=list(map(int,input().split()))
i=1
while(x[1]>=i):
x[1]-=i
if i==x[0]:
i=1
else:
i+=1
print(x[1])
|
Title: Chips
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
Output Specification:
Print the number of chips the presenter ended up with.
Demo Input:
['4 11\n', '17 107\n', '3 8\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
|
```python
'''
Amirhossein Alimirzaei
Telegram : @HajLorenzo
Instagram : amirhossein_alimirzaei
University of Bojnourd'''
x=list(map(int,input().split()))
i=1
while(x[1]>=i):
x[1]-=i
if i==x[0]:
i=1
else:
i+=1
print(x[1])
```
| 3.9455
|
23
|
A
|
You're Given a String...
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy"
] |
A. You're Given a String...
|
2
|
256
|
You're given a string of lower-case Latin letters. Your task is to find the length of its longest substring that can be met in the string at least twice. These occurrences can overlap (see sample test 2).
|
The first input line contains the string. It's guaranteed, that the string is non-empty, consists of lower-case Latin letters, and its length doesn't exceed 100.
|
Output one number — length of the longest substring that can be met in the string at least twice.
|
[
"abcd\n",
"ababa\n",
"zzz\n"
] |
[
"0",
"3",
"2"
] |
none
| 0
|
[
{
"input": "abcd",
"output": "0"
},
{
"input": "ababa",
"output": "3"
},
{
"input": "zzz",
"output": "2"
},
{
"input": "kmmm",
"output": "2"
},
{
"input": "wzznz",
"output": "1"
},
{
"input": "qlzazaaqll",
"output": "2"
},
{
"input": "lzggglgpep",
"output": "2"
},
{
"input": "iegdlraaidefgegiagrdfhihe",
"output": "2"
},
{
"input": "esxpqmdrtidgtkxojuxyrcwxlycywtzbjzpxvbngnlepgzcaeg",
"output": "1"
},
{
"input": "garvpaimjdjiivamusjdwfcaoswuhxyyxvrxzajoyihggvuxumaadycfphrzbprraicvjjlsdhojihaw",
"output": "2"
},
{
"input": "ckvfndqgkmhcyojaqgdkenmbexufryhqejdhctxujmtrwkpbqxufxamgoeigzfyzbhevpbkvviwntdhqscvkmphnkkljizndnbjt",
"output": "3"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "99"
},
{
"input": "ikiikiikikiiikkkkkikkkkiiiiikkiiikkiikiikkkkikkkikikkikiiikkikikiiikikkkiiikkkikkikkikkkkiiikkiiiiii",
"output": "10"
},
{
"input": "ovovhoovvhohhhvhhvhhvhovoohovhhoooooovohvooooohvvoooohvvovhhvhovhhvoovhvhvoovovvhooovhhooovohvhhovhv",
"output": "8"
},
{
"input": "ccwckkkycccccckwckwkwkwkkkkyycykcccycyckwywcckwykcycykkkwcycwwcykcwkwkwwykwkwcykywwwyyykckkyycckwcwk",
"output": "5"
},
{
"input": "ttketfkefktfztezzkzfkkeetkkfktftzktezekkeezkeeetteeteefetefkzzzetekfftkeffzkktffzkzzeftfeezfefzffeef",
"output": "4"
},
{
"input": "rtharczpfznrgdnkltchafduydgbgkdjqrmjqyfmpwjwphrtsjbmswkanjlprbnduaqbcjqxlxmkspkhkcnzbqwxonzxxdmoigti",
"output": "2"
},
{
"input": "fplrkfklvwdeiynbjgaypekambmbjfnoknlhczhkdmljicookdywdgpnlnqlpunnkebnikgcgcjefeqhknvlynmvjcegvcdgvvdb",
"output": "2"
},
{
"input": "txbciieycswqpniwvzipwlottivvnfsysgzvzxwbctcchfpvlbcjikdofhpvsknptpjdbxemtmjcimetkemdbettqnbvzzbdyxxb",
"output": "2"
},
{
"input": "fmubmfwefikoxtqvmaavwjxmoqltapexkqxcsztpezfcltqavuicefxovuswmqimuikoppgqpiapqutkczgcvxzutavkujxvpklv",
"output": "3"
},
{
"input": "ipsrjylhpkjvlzncfixipstwcicxqygqcfrawpzzvckoveyqhathglblhpkjvlzncfixipfajaqobtzvthmhgbuawoxoknirclxg",
"output": "15"
},
{
"input": "kcnjsntjzcbgzjscrsrjkrbytqsrptzspzctjrorsyggrtkcnjsntjzcbgzjscrsrjyqbrtpcgqirsrrjbbbrnyqstnrozcoztt",
"output": "20"
},
{
"input": "unhcfnrhsqetuerjqcetrhlsqgfnqfntvkgxsscquolxxroqgtchffyccetrhlsqgfnqfntvkgxsscquolxxroqgtchffhfqvx",
"output": "37"
},
{
"input": "kkcckkccckkcckcccckcckkkkcckkkkckkkcckckkkkkckkkkkcckkccckkcckcccckcckkkkcckkkkckkkcckckkkkkckckckkc",
"output": "46"
},
{
"input": "mlhsyijxeydqxhtkmpdeqwzogjvxahmssyhfhqessbxzvydbrxdmlhsyijxeydqxhtkmpdeqwzogjvxahmssyhfhqessbxzvydik",
"output": "47"
},
{
"input": "abcdefghijklmnopqrstuvwxyz",
"output": "0"
},
{
"input": "tttttbttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttmttttttt",
"output": "85"
},
{
"input": "ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffbfffffffffffffffffffffffffffffffffffff",
"output": "61"
},
{
"input": "cccccccccccccccccccccccwcccccccccccccccccccccuccccccccccccccnccccccccccccccccccccccccccccccccccccccc",
"output": "38"
},
{
"input": "ffffffffffffffffffffffffffufffgfffffffffffffffffffffffffffffffffffffffgffffffftffffffgffffffffffffff",
"output": "38"
},
{
"input": "rrrrrrrrrrrrrrrrrrrlhbrrrrrrrrurrrrrrrfrrqrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrewrrrrrrryrrxrrrrrrrrrrr",
"output": "33"
},
{
"input": "vyvvvvvvvvzvvvvvzvvvwvvvvrvvvvvvvvvvvvvvvrvvvvvvvvvpkvvpvgvvvvvvvvvvvvvgvvvvvvvvvvvvvvvvvvysvvvbvvvv",
"output": "17"
},
{
"input": "cbubbbbbbbbbbfbbbbbbbbjbobbbbbbbbbbibbubbbbjbbbnzgbbzbbfbbbbbbbbbbbfbpbbbbbbbbbbygbbbgbabbbbbbbhibbb",
"output": "12"
},
{
"input": "lrqrrrrrrrjrrrrrcdrrgrrmwvrrrrrrrrrxfzrmrmrryrrrurrrdrrrrrrrrrrererrrsrrrrrrrrrrrqrrrrcrrwjsrrlrrrrr",
"output": "10"
},
{
"input": "ssssusisisosscssssztzessssyspskjssvosiissussszsosssslsssdsssvssvsssslsssmsfjasjsssssowscsjsssszsspss",
"output": "8"
},
{
"input": "uukuuuumueuuuujuukgdhbztuuuubbguuocuozfaunqufjujuguyuuvkuuauubuubuucuvtjuuuuuusduduuuuuuuueunuuuuuzu",
"output": "7"
},
{
"input": "jpkkgwklngwqcfzmwkkpcwkkkkkekkkekkkdsykqwjkkkhkkkxdnukkkkkkmkqykkkxqklkskkrkkkkkqqjikkkkkkpknkkkkkoh",
"output": "7"
},
{
"input": "bmzbbfbbhqxwthtbbisbbbbbtbbfbbpbfbbpbkbjfbcbbbbzbbbdwmbbbrnvqdbbtbbuglrnbbbbvmbyblebbabibrevaxbbjbqb",
"output": "6"
},
{
"input": "qqqmqqqsbteqqopsuqiqumrqzpqnqgqeniqqkyqqyqqqpxzqeqqquhdqquhqqqfqjirqaqqaquxqoqqjqqqqbjbgqcqqqqicnkqc",
"output": "4"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaasaaaavaaaaaaauaaeaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "44"
},
{
"input": "a",
"output": "0"
},
{
"input": "fg",
"output": "0"
},
{
"input": "yy",
"output": "1"
},
{
"input": "abcabcabc",
"output": "6"
},
{
"input": "qwerqwedqwes",
"output": "3"
}
] | 1,680,779,304
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
s = input()
n = len(s)
ans = 0
for i in range(n):
for j in range(i+1, n):
if s[i:j] in s[j:]:
ans = max(ans, j-i)
print(ans)
|
Title: You're Given a String...
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You're given a string of lower-case Latin letters. Your task is to find the length of its longest substring that can be met in the string at least twice. These occurrences can overlap (see sample test 2).
Input Specification:
The first input line contains the string. It's guaranteed, that the string is non-empty, consists of lower-case Latin letters, and its length doesn't exceed 100.
Output Specification:
Output one number — length of the longest substring that can be met in the string at least twice.
Demo Input:
['abcd\n', 'ababa\n', 'zzz\n']
Demo Output:
['0', '3', '2']
Note:
none
|
```python
s = input()
n = len(s)
ans = 0
for i in range(n):
for j in range(i+1, n):
if s[i:j] in s[j:]:
ans = max(ans, j-i)
print(ans)
```
| 0
|
186
|
A
|
Comparing Strings
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
|
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
|
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
|
[
"ab\nba\n",
"aa\nab\n"
] |
[
"YES\n",
"NO\n"
] |
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
| 500
|
[
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "aa\nab",
"output": "NO"
},
{
"input": "a\nza",
"output": "NO"
},
{
"input": "vvea\nvvae",
"output": "YES"
},
{
"input": "rtfabanpc\natfabrnpc",
"output": "YES"
},
{
"input": "mt\ntm",
"output": "YES"
},
{
"input": "qxolmbkkt\naovlajmlf",
"output": "NO"
},
{
"input": "b\ng",
"output": "NO"
},
{
"input": "ab\naba",
"output": "NO"
},
{
"input": "ba\na",
"output": "NO"
},
{
"input": "a\nab",
"output": "NO"
},
{
"input": "a\naa",
"output": "NO"
},
{
"input": "a\nz",
"output": "NO"
},
{
"input": "aabb\nbbaa",
"output": "NO"
},
{
"input": "ab\nbd",
"output": "NO"
},
{
"input": "bac\ndae",
"output": "NO"
},
{
"input": "abc\nakl",
"output": "NO"
},
{
"input": "cb\naa",
"output": "NO"
},
{
"input": "abaab\naabba",
"output": "NO"
},
{
"input": "aab\naaa",
"output": "NO"
},
{
"input": "abcde\nedcba",
"output": "NO"
},
{
"input": "abab\nbaba",
"output": "NO"
},
{
"input": "ab\nbac",
"output": "NO"
},
{
"input": "abcd\naqcb",
"output": "NO"
},
{
"input": "abc\nbad",
"output": "NO"
},
{
"input": "ab\nca",
"output": "NO"
},
{
"input": "abc\nab",
"output": "NO"
},
{
"input": "ab\nbae",
"output": "NO"
},
{
"input": "aaaabcccca\naaaadccccb",
"output": "NO"
},
{
"input": "acaa\nabca",
"output": "NO"
},
{
"input": "aba\naab",
"output": "YES"
},
{
"input": "ah\nla",
"output": "NO"
},
{
"input": "aab\naa",
"output": "NO"
},
{
"input": "abab\nabcd",
"output": "NO"
},
{
"input": "ed\nab",
"output": "NO"
}
] | 1,592,891,965
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 30
| 248
| 8,192,000
|
#COMPARING STRINGS(186A)
a = input()
b = input()
a = sorted(a)
a1 = ''.join(a)
b = sorted(b)
b1 = ''.join(b)
if a != b:
print("NO")
else:
print("YES")
|
Title: Comparing Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
Input Specification:
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Output Specification:
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
Demo Input:
['ab\nba\n', 'aa\nab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
|
```python
#COMPARING STRINGS(186A)
a = input()
b = input()
a = sorted(a)
a1 = ''.join(a)
b = sorted(b)
b1 = ''.join(b)
if a != b:
print("NO")
else:
print("YES")
```
| 0
|
|
416
|
C
|
Booking System
|
PROGRAMMING
| 1,600
|
[
"binary search",
"dp",
"greedy",
"implementation"
] | null | null |
Innovation technologies are on a victorious march around the planet. They integrate into all spheres of human activity!
A restaurant called "Dijkstra's Place" has started thinking about optimizing the booking system.
There are *n* booking requests received by now. Each request is characterized by two numbers: *c**i* and *p**i* — the size of the group of visitors who will come via this request and the total sum of money they will spend in the restaurant, correspondingly.
We know that for each request, all *c**i* people want to sit at the same table and are going to spend the whole evening in the restaurant, from the opening moment at 18:00 to the closing moment.
Unfortunately, there only are *k* tables in the restaurant. For each table, we know *r**i* — the maximum number of people who can sit at it. A table can have only people from the same group sitting at it. If you cannot find a large enough table for the whole group, then all visitors leave and naturally, pay nothing.
Your task is: given the tables and the requests, decide which requests to accept and which requests to decline so that the money paid by the happy and full visitors was maximum.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of requests from visitors. Then *n* lines follow. Each line contains two integers: *c**i*,<=*p**i* (1<=≤<=*c**i*,<=*p**i*<=≤<=1000) — the size of the group of visitors who will come by the *i*-th request and the total sum of money they will pay when they visit the restaurant, correspondingly.
The next line contains integer *k* (1<=≤<=*k*<=≤<=1000) — the number of tables in the restaurant. The last line contains *k* space-separated integers: *r*1,<=*r*2,<=...,<=*r**k* (1<=≤<=*r**i*<=≤<=1000) — the maximum number of people that can sit at each table.
|
In the first line print two integers: *m*,<=*s* — the number of accepted requests and the total money you get from these requests, correspondingly.
Then print *m* lines — each line must contain two space-separated integers: the number of the accepted request and the number of the table to seat people who come via this request. The requests and the tables are consecutively numbered starting from 1 in the order in which they are given in the input.
If there are multiple optimal answers, print any of them.
|
[
"3\n10 50\n2 100\n5 30\n3\n4 6 9\n"
] |
[
"2 130\n2 1\n3 2\n"
] |
none
| 1,500
|
[
{
"input": "3\n10 50\n2 100\n5 30\n3\n4 6 9",
"output": "2 130\n2 1\n3 2"
},
{
"input": "1\n1 1\n1\n1",
"output": "1 1\n1 1"
},
{
"input": "1\n2 1\n1\n1",
"output": "0 0"
},
{
"input": "2\n10 10\n5 5\n1\n5",
"output": "1 5\n2 1"
},
{
"input": "2\n10 10\n5 5\n1\n10",
"output": "1 10\n1 1"
},
{
"input": "2\n2 100\n10 10\n1\n10",
"output": "1 100\n1 1"
},
{
"input": "2\n10 100\n5 90\n2\n15 20",
"output": "2 190\n1 1\n2 2"
},
{
"input": "3\n10 10\n3 5\n5 8\n3\n3 4 10",
"output": "2 15\n1 3\n2 1"
},
{
"input": "10\n739 307\n523 658\n700 143\n373 577\n120 433\n353 833\n665 516\n988 101\n817 604\n800 551\n10\n431 425 227 147 153 170 954 757 222 759",
"output": "6 3621\n6 2\n2 8\n9 7\n4 1\n7 10\n5 4"
},
{
"input": "9\n216 860\n299 720\n688 831\n555 733\n863 873\n594 923\n583 839\n738 824\n57 327\n10\n492 578 452 808 492 163 670 31 267 627",
"output": "7 5233\n6 10\n1 9\n7 7\n3 4\n4 2\n2 3\n9 6"
},
{
"input": "3\n694 606\n76 973\n676 110\n5\n592 737 313 903 13",
"output": "3 1689\n2 3\n1 2\n3 4"
},
{
"input": "7\n172 864\n853 523\n368 989\n920 452\n351 456\n269 104\n313 677\n9\n165 47 259 51 693 941 471 871 206",
"output": "5 3509\n3 7\n1 9\n7 5\n2 8\n5 6"
},
{
"input": "1\n545 609\n4\n584 822 973 652",
"output": "1 609\n1 1"
},
{
"input": "9\n23 163\n895 838\n344 444\n284 763\n942 39\n431 92\n147 515\n59 505\n940 999\n8\n382 497 297 125 624 212 851 859",
"output": "6 2482\n4 3\n7 6\n8 4\n3 1\n1 2\n6 5"
},
{
"input": "3\n500 613\n671 899\n628 131\n10\n622 467 479 982 886 968 326 64 228 321",
"output": "3 1643\n2 5\n1 1\n3 6"
},
{
"input": "7\n682 870\n640 857\n616 306\n649 777\n725 215\n402 977\n981 353\n1\n846",
"output": "1 977\n6 1"
},
{
"input": "1\n160 616\n5\n406 713 290 308 741",
"output": "1 616\n1 3"
},
{
"input": "6\n397 946\n871 126\n800 290\n505 429\n239 43\n320 292\n9\n387 925 9 440 395 320 58 707 994",
"output": "6 2126\n1 4\n4 8\n6 6\n3 2\n2 9\n5 1"
},
{
"input": "1\n3 20\n4\n3 2 1 4",
"output": "1 20\n1 1"
},
{
"input": "2\n2 100\n1 1000\n1\n2",
"output": "1 1000\n2 1"
}
] | 1,598,336,115
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 124
| 0
|
n = int(input())
l = []
val = []
ind1, ind2 = 0, 0
ans = []
pos = 1
for i in range(n):
l.append([int(x) for x in input().split()])
l1 = l[:]
l1.sort()
k = int(input())
r = [int(x) for x in input().split()]
r.sort()
l1.reverse()
r.reverse()
while(ind1 < n and ind2 < k):
if l1[ind1][0] <= r[ind2]:
ind2 += 1
ans.append(l1[ind1][1])
val.append(l1[ind1][0])
ind1 += 1
print(len(ans), sum(ans))
for i in range(len(l)):
v = l[i][0]
if v in val:
print(i + 1, pos)
pos += 1
del val[val.index(v)]
|
Title: Booking System
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Innovation technologies are on a victorious march around the planet. They integrate into all spheres of human activity!
A restaurant called "Dijkstra's Place" has started thinking about optimizing the booking system.
There are *n* booking requests received by now. Each request is characterized by two numbers: *c**i* and *p**i* — the size of the group of visitors who will come via this request and the total sum of money they will spend in the restaurant, correspondingly.
We know that for each request, all *c**i* people want to sit at the same table and are going to spend the whole evening in the restaurant, from the opening moment at 18:00 to the closing moment.
Unfortunately, there only are *k* tables in the restaurant. For each table, we know *r**i* — the maximum number of people who can sit at it. A table can have only people from the same group sitting at it. If you cannot find a large enough table for the whole group, then all visitors leave and naturally, pay nothing.
Your task is: given the tables and the requests, decide which requests to accept and which requests to decline so that the money paid by the happy and full visitors was maximum.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of requests from visitors. Then *n* lines follow. Each line contains two integers: *c**i*,<=*p**i* (1<=≤<=*c**i*,<=*p**i*<=≤<=1000) — the size of the group of visitors who will come by the *i*-th request and the total sum of money they will pay when they visit the restaurant, correspondingly.
The next line contains integer *k* (1<=≤<=*k*<=≤<=1000) — the number of tables in the restaurant. The last line contains *k* space-separated integers: *r*1,<=*r*2,<=...,<=*r**k* (1<=≤<=*r**i*<=≤<=1000) — the maximum number of people that can sit at each table.
Output Specification:
In the first line print two integers: *m*,<=*s* — the number of accepted requests and the total money you get from these requests, correspondingly.
Then print *m* lines — each line must contain two space-separated integers: the number of the accepted request and the number of the table to seat people who come via this request. The requests and the tables are consecutively numbered starting from 1 in the order in which they are given in the input.
If there are multiple optimal answers, print any of them.
Demo Input:
['3\n10 50\n2 100\n5 30\n3\n4 6 9\n']
Demo Output:
['2 130\n2 1\n3 2\n']
Note:
none
|
```python
n = int(input())
l = []
val = []
ind1, ind2 = 0, 0
ans = []
pos = 1
for i in range(n):
l.append([int(x) for x in input().split()])
l1 = l[:]
l1.sort()
k = int(input())
r = [int(x) for x in input().split()]
r.sort()
l1.reverse()
r.reverse()
while(ind1 < n and ind2 < k):
if l1[ind1][0] <= r[ind2]:
ind2 += 1
ans.append(l1[ind1][1])
val.append(l1[ind1][0])
ind1 += 1
print(len(ans), sum(ans))
for i in range(len(l)):
v = l[i][0]
if v in val:
print(i + 1, pos)
pos += 1
del val[val.index(v)]
```
| 0
|
|
688
|
B
|
Lovely Palindromes
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"math"
] | null | null |
Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not.
Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them.
Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number?
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000).
|
Print the *n*-th even-length palindrome number.
|
[
"1\n",
"10\n"
] |
[
"11\n",
"1001\n"
] |
The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
| 1,000
|
[
{
"input": "1",
"output": "11"
},
{
"input": "10",
"output": "1001"
},
{
"input": "11",
"output": "1111"
},
{
"input": "12",
"output": "1221"
},
{
"input": "100",
"output": "100001"
},
{
"input": "1321",
"output": "13211231"
},
{
"input": "2",
"output": "22"
},
{
"input": "3",
"output": "33"
},
{
"input": "4",
"output": "44"
},
{
"input": "5",
"output": "55"
},
{
"input": "6",
"output": "66"
},
{
"input": "7",
"output": "77"
},
{
"input": "8",
"output": "88"
},
{
"input": "9",
"output": "99"
},
{
"input": "13",
"output": "1331"
},
{
"input": "14",
"output": "1441"
},
{
"input": "15",
"output": "1551"
},
{
"input": "16",
"output": "1661"
},
{
"input": "17",
"output": "1771"
},
{
"input": "18",
"output": "1881"
},
{
"input": "19",
"output": "1991"
},
{
"input": "20",
"output": "2002"
},
{
"input": "26550",
"output": "2655005562"
},
{
"input": "16137",
"output": "1613773161"
},
{
"input": "91471",
"output": "9147117419"
},
{
"input": "41242",
"output": "4124224214"
},
{
"input": "30866",
"output": "3086666803"
},
{
"input": "4442231232741003009964183199713851566466079882929007253443848371978048610682180431295671905105980116",
"output": "44422312327410030099641831997138515664660798829290072534438483719780486106821804312956719051059801166110895015091765921340812860168408791738483443527009292889706646651583179913814699003001472321322444"
},
{
"input": "7806526084732010742850470902979267046151204705563201965818390803445852115032119297648697933316807252",
"output": "78065260847320107428504709029792670461512047055632019658183908034458521150321192976486979333168072522527086133397968467929112305112585443080938185691023655074021516407629792090740582470102374806256087"
},
{
"input": "2244399823612183124978103773977739948197709395321563148611877999503840818596183803323258317041875913",
"output": "22443998236121831249781037739777399481977093953215631486118779995038408185961838033232583170418759133195781407138523233083816958180483059997781168413651235939077918499377793773018794213812163289934422"
},
{
"input": "123451",
"output": "123451154321"
}
] | 1,677,072,571
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 40
| 62
| 409,600
|
n = input ()
print (n + n [ : : -1])
|
Title: Lovely Palindromes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not.
Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them.
Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number?
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000).
Output Specification:
Print the *n*-th even-length palindrome number.
Demo Input:
['1\n', '10\n']
Demo Output:
['11\n', '1001\n']
Note:
The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
|
```python
n = input ()
print (n + n [ : : -1])
```
| 3
|
|
637
|
B
|
Chat Order
|
PROGRAMMING
| 1,200
|
[
"*special",
"binary search",
"constructive algorithms",
"data structures",
"sortings"
] | null | null |
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
|
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
|
[
"4\nalex\nivan\nroman\nivan\n",
"8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n"
] |
[
"ivan\nroman\nalex\n",
"alina\nmaria\nekaterina\ndarya\n"
] |
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex
| 1,000
|
[
{
"input": "4\nalex\nivan\nroman\nivan",
"output": "ivan\nroman\nalex"
},
{
"input": "8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina",
"output": "alina\nmaria\nekaterina\ndarya"
},
{
"input": "1\nwdi",
"output": "wdi"
},
{
"input": "2\nypg\nypg",
"output": "ypg"
},
{
"input": "3\nexhll\nexhll\narruapexj",
"output": "arruapexj\nexhll"
},
{
"input": "3\nfv\nle\nle",
"output": "le\nfv"
},
{
"input": "8\nm\nm\nm\nm\nm\nm\nm\nm",
"output": "m"
},
{
"input": "10\nr\nr\ni\nw\nk\nr\nb\nu\nu\nr",
"output": "r\nu\nb\nk\nw\ni"
},
{
"input": "7\ne\nfau\ncmk\nnzs\nby\nwx\ntjmok",
"output": "tjmok\nwx\nby\nnzs\ncmk\nfau\ne"
},
{
"input": "6\nklrj\nwe\nklrj\nwe\nwe\nwe",
"output": "we\nklrj"
},
{
"input": "8\nzncybqmh\naeebef\nzncybqmh\nn\naeebef\nzncybqmh\nzncybqmh\nzncybqmh",
"output": "zncybqmh\naeebef\nn"
},
{
"input": "30\nkqqcbs\nvap\nkymomn\nj\nkqqcbs\nfuzlzoum\nkymomn\ndbh\nfuzlzoum\nkymomn\nvap\nvlgzs\ndbh\nvlgzs\nbvy\ndbh\nkymomn\nkymomn\neoqql\nkymomn\nkymomn\nkqqcbs\nvlgzs\nkqqcbs\nkqqcbs\nfuzlzoum\nvlgzs\nrylgdoo\nvlgzs\nrylgdoo",
"output": "rylgdoo\nvlgzs\nfuzlzoum\nkqqcbs\nkymomn\neoqql\ndbh\nbvy\nvap\nj"
},
{
"input": "40\nji\nv\nv\nns\nji\nn\nji\nv\nfvy\nvje\nns\nvje\nv\nhas\nv\nusm\nhas\nfvy\nvje\nkdb\nn\nv\nji\nji\nn\nhas\nv\nji\nkdb\nr\nvje\nns\nv\nusm\nn\nvje\nhas\nns\nhas\nn",
"output": "n\nhas\nns\nvje\nusm\nv\nr\nkdb\nji\nfvy"
},
{
"input": "50\njcg\nvle\njopb\nepdb\nnkef\nfv\nxj\nufe\nfuy\noqta\ngbc\nyuz\nec\nyji\nkuux\ncwm\ntq\nnno\nhp\nzry\nxxpp\ntjvo\ngyz\nkwo\nvwqz\nyaqc\njnj\nwoav\nqcv\ndcu\ngc\nhovn\nop\nevy\ndc\ntrpu\nyb\nuzfa\npca\noq\nnhxy\nsiqu\nde\nhphy\nc\nwovu\nf\nbvv\ndsik\nlwyg",
"output": "lwyg\ndsik\nbvv\nf\nwovu\nc\nhphy\nde\nsiqu\nnhxy\noq\npca\nuzfa\nyb\ntrpu\ndc\nevy\nop\nhovn\ngc\ndcu\nqcv\nwoav\njnj\nyaqc\nvwqz\nkwo\ngyz\ntjvo\nxxpp\nzry\nhp\nnno\ntq\ncwm\nkuux\nyji\nec\nyuz\ngbc\noqta\nfuy\nufe\nxj\nfv\nnkef\nepdb\njopb\nvle\njcg"
},
{
"input": "100\nvhh\nvhh\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nvhh\nvhh\nvhh\nfa\nvhh\nvhh\nfa\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nfa\nfa\nfa\nfa\nfa\nfa\nvhh\nvhh\nfa\nvhh\nfa\nfa\nvhh\nfa\nfa\nvhh\nfa\nvhh\nvhh\nfa\nvhh",
"output": "vhh\nfa"
},
{
"input": "2\naa\nbb",
"output": "bb\naa"
},
{
"input": "2\naa\na",
"output": "a\naa"
},
{
"input": "3\naa\naa\naa",
"output": "aa"
},
{
"input": "5\naa\na\naa\na\naa",
"output": "aa\na"
},
{
"input": "7\naaaa\naaaa\naaa\na\naa\naaaaaaa\naaa",
"output": "aaa\naaaaaaa\naa\na\naaaa"
},
{
"input": "5\na\naa\naaa\naaaa\na",
"output": "a\naaaa\naaa\naa"
},
{
"input": "12\naaaaa\naaaaaa\naaaa\naaaaaa\naa\naaaa\naaaa\naaaaaa\na\naaa\naaaaaaaa\naa",
"output": "aa\naaaaaaaa\naaa\na\naaaaaa\naaaa\naaaaa"
},
{
"input": "3\na\naa\naaa",
"output": "aaa\naa\na"
},
{
"input": "9\nzzz\nzzzzz\nzzz\nzzzz\nzz\nzzzz\nzzzzz\nzzzz\nzzzzzzz",
"output": "zzzzzzz\nzzzz\nzzzzz\nzz\nzzz"
}
] | 1,637,147,910
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 95
| 577
| 15,564,800
|
def main():
n = int(input())
l = []
viewed = set()
for i in range(n):
cin = input()
l.append(cin)
for i in range(n - 1, -1, -1):
if l[i] in viewed:
continue
print(l[i])
viewed.add(l[i])
if __name__ == '__main__':
# t = int(input())
# while t > 0:
# t -= 1
# main()
main()
|
Title: Chat Order
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a big lover of killing time in social networks. A page with a chatlist in his favourite network is made so that when a message is sent to some friend, his friend's chat rises to the very top of the page. The relative order of the other chats doesn't change. If there was no chat with this friend before, then a new chat is simply inserted to the top of the list.
Assuming that the chat list is initially empty, given the sequence of Polycaprus' messages make a list of chats after all of his messages are processed. Assume that no friend wrote any message to Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of Polycarpus' messages. Next *n* lines enlist the message recipients in the order in which the messages were sent. The name of each participant is a non-empty sequence of lowercase English letters of length at most 10.
Output Specification:
Print all the recipients to who Polycarp talked to in the order of chats with them, from top to bottom.
Demo Input:
['4\nalex\nivan\nroman\nivan\n', '8\nalina\nmaria\nekaterina\ndarya\ndarya\nekaterina\nmaria\nalina\n']
Demo Output:
['ivan\nroman\nalex\n', 'alina\nmaria\nekaterina\ndarya\n']
Note:
In the first test case Polycarpus first writes to friend by name "alex", and the list looks as follows:
1. alex
Then Polycarpus writes to friend by name "ivan" and the list looks as follows:
1. ivan 1. alex
Polycarpus writes the third message to friend by name "roman" and the list looks as follows:
1. roman 1. ivan 1. alex
Polycarpus writes the fourth message to friend by name "ivan", to who he has already sent a message, so the list of chats changes as follows:
1. ivan 1. roman 1. alex
|
```python
def main():
n = int(input())
l = []
viewed = set()
for i in range(n):
cin = input()
l.append(cin)
for i in range(n - 1, -1, -1):
if l[i] in viewed:
continue
print(l[i])
viewed.add(l[i])
if __name__ == '__main__':
# t = int(input())
# while t > 0:
# t -= 1
# main()
main()
```
| 3
|
|
236
|
A
|
Boy or Girl
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
|
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
|
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
|
[
"wjmzbmr\n",
"xiaodao\n",
"sevenkplus\n"
] |
[
"CHAT WITH HER!\n",
"IGNORE HIM!\n",
"CHAT WITH HER!\n"
] |
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
| 500
|
[
{
"input": "wjmzbmr",
"output": "CHAT WITH HER!"
},
{
"input": "xiaodao",
"output": "IGNORE HIM!"
},
{
"input": "sevenkplus",
"output": "CHAT WITH HER!"
},
{
"input": "pezu",
"output": "CHAT WITH HER!"
},
{
"input": "wnemlgppy",
"output": "CHAT WITH HER!"
},
{
"input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn",
"output": "IGNORE HIM!"
},
{
"input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx",
"output": "CHAT WITH HER!"
},
{
"input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt",
"output": "IGNORE HIM!"
},
{
"input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk",
"output": "IGNORE HIM!"
},
{
"input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz",
"output": "IGNORE HIM!"
},
{
"input": "tgcdptnkc",
"output": "IGNORE HIM!"
},
{
"input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi",
"output": "IGNORE HIM!"
},
{
"input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp",
"output": "IGNORE HIM!"
},
{
"input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia",
"output": "IGNORE HIM!"
},
{
"input": "fpellxwskyekoyvrfnuf",
"output": "CHAT WITH HER!"
},
{
"input": "xninyvkuvakfbs",
"output": "IGNORE HIM!"
},
{
"input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak",
"output": "CHAT WITH HER!"
},
{
"input": "kmsk",
"output": "IGNORE HIM!"
},
{
"input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz",
"output": "CHAT WITH HER!"
},
{
"input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq",
"output": "CHAT WITH HER!"
},
{
"input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm",
"output": "IGNORE HIM!"
},
{
"input": "ppcpbnhwoizajrl",
"output": "IGNORE HIM!"
},
{
"input": "sgubujztzwkzvztitssxxxwzanfmddfqvv",
"output": "CHAT WITH HER!"
},
{
"input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw",
"output": "IGNORE HIM!"
},
{
"input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu",
"output": "CHAT WITH HER!"
},
{
"input": "ojjvpnkrxibyevxk",
"output": "CHAT WITH HER!"
},
{
"input": "wjweqcrqfuollfvfbiyriijovweg",
"output": "IGNORE HIM!"
},
{
"input": "hkdbykboclchfdsuovvpknwqr",
"output": "IGNORE HIM!"
},
{
"input": "stjvyfrfowopwfjdveduedqylerqugykyu",
"output": "IGNORE HIM!"
},
{
"input": "rafcaanqytfclvfdegak",
"output": "CHAT WITH HER!"
},
{
"input": "xczn",
"output": "CHAT WITH HER!"
},
{
"input": "arcoaeozyeawbveoxpmafxxzdjldsielp",
"output": "IGNORE HIM!"
},
{
"input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika",
"output": "CHAT WITH HER!"
},
{
"input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh",
"output": "CHAT WITH HER!"
},
{
"input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg",
"output": "CHAT WITH HER!"
},
{
"input": "udlpagtpq",
"output": "CHAT WITH HER!"
},
{
"input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy",
"output": "CHAT WITH HER!"
},
{
"input": "qagzrqjomdwhagkhrjahhxkieijyten",
"output": "CHAT WITH HER!"
},
{
"input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb",
"output": "CHAT WITH HER!"
},
{
"input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr",
"output": "CHAT WITH HER!"
},
{
"input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc",
"output": "IGNORE HIM!"
},
{
"input": "lnpdosnceumubvk",
"output": "IGNORE HIM!"
},
{
"input": "efrk",
"output": "CHAT WITH HER!"
},
{
"input": "temnownneghnrujforif",
"output": "IGNORE HIM!"
},
{
"input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta",
"output": "IGNORE HIM!"
},
{
"input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh",
"output": "IGNORE HIM!"
},
{
"input": "gwntwbpj",
"output": "IGNORE HIM!"
},
{
"input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim",
"output": "IGNORE HIM!"
},
{
"input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd",
"output": "CHAT WITH HER!"
},
{
"input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx",
"output": "IGNORE HIM!"
},
{
"input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks",
"output": "CHAT WITH HER!"
},
{
"input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx",
"output": "CHAT WITH HER!"
},
{
"input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc",
"output": "CHAT WITH HER!"
},
{
"input": "yzlzmesxdttfcztooypjztlgxwcr",
"output": "IGNORE HIM!"
},
{
"input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc",
"output": "IGNORE HIM!"
},
{
"input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq",
"output": "CHAT WITH HER!"
},
{
"input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj",
"output": "IGNORE HIM!"
},
{
"input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom",
"output": "CHAT WITH HER!"
},
{
"input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo",
"output": "CHAT WITH HER!"
},
{
"input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh",
"output": "IGNORE HIM!"
},
{
"input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa",
"output": "CHAT WITH HER!"
},
{
"input": "oh",
"output": "CHAT WITH HER!"
},
{
"input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri",
"output": "IGNORE HIM!"
},
{
"input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp",
"output": "CHAT WITH HER!"
},
{
"input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp",
"output": "CHAT WITH HER!"
},
{
"input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo",
"output": "CHAT WITH HER!"
},
{
"input": "mnmbupgo",
"output": "IGNORE HIM!"
},
{
"input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl",
"output": "IGNORE HIM!"
},
{
"input": "yocxrzspinchmhtmqo",
"output": "CHAT WITH HER!"
},
{
"input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv",
"output": "CHAT WITH HER!"
},
{
"input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad",
"output": "IGNORE HIM!"
},
{
"input": "ubvhyaebyxoghakajqrpqpctwbrfqzli",
"output": "CHAT WITH HER!"
},
{
"input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy",
"output": "IGNORE HIM!"
},
{
"input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd",
"output": "IGNORE HIM!"
},
{
"input": "acrzbavz",
"output": "CHAT WITH HER!"
},
{
"input": "drvzznznvrzskftnrhvvzxcalwutxmdza",
"output": "IGNORE HIM!"
},
{
"input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws",
"output": "CHAT WITH HER!"
},
{
"input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff",
"output": "CHAT WITH HER!"
},
{
"input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu",
"output": "CHAT WITH HER!"
},
{
"input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw",
"output": "IGNORE HIM!"
},
{
"input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy",
"output": "CHAT WITH HER!"
},
{
"input": "rhh",
"output": "CHAT WITH HER!"
},
{
"input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo",
"output": "IGNORE HIM!"
},
{
"input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn",
"output": "CHAT WITH HER!"
},
{
"input": "urigreuzpxnej",
"output": "CHAT WITH HER!"
}
] | 1,695,086,552
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 1
| 124
| 0
|
word = list(input())
o = 0
word = set(word)
if len(word) % 2 == 0:
print("CHAT WITH HER!")
else:
print("IGNORE HIM")
|
Title: Boy or Girl
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
Input Specification:
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
Output Specification:
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
Demo Input:
['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n']
Demo Output:
['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n']
Note:
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
|
```python
word = list(input())
o = 0
word = set(word)
if len(word) % 2 == 0:
print("CHAT WITH HER!")
else:
print("IGNORE HIM")
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
You have an array *a* with length *n*, you can perform operations. Each operation is like this: choose two adjacent elements from *a*, say *x* and *y*, and replace one of them with *gcd*(*x*,<=*y*), where *gcd* denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor).
What is the minimum number of operations you need to make all of the elements equal to 1?
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=2000) — the number of elements in the array.
The second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
|
Print -1, if it is impossible to turn all numbers to 1. Otherwise, print the minimum number of operations needed to make all numbers equal to 1.
|
[
"5\n2 2 3 4 6\n",
"4\n2 4 6 8\n",
"3\n2 6 9\n"
] |
[
"5\n",
"-1\n",
"4\n"
] |
In the first sample you can turn all numbers to 1 using the following 5 moves:
- [2, 2, 3, 4, 6]. - [2, 1, 3, 4, 6] - [2, 1, 3, 1, 6] - [2, 1, 1, 1, 6] - [1, 1, 1, 1, 6] - [1, 1, 1, 1, 1]
We can prove that in this case it is not possible to make all numbers one using less than 5 moves.
| 0
|
[
{
"input": "5\n2 2 3 4 6",
"output": "5"
},
{
"input": "4\n2 4 6 8",
"output": "-1"
},
{
"input": "3\n2 6 9",
"output": "4"
},
{
"input": "15\n10 10 10 10 10 10 21 21 21 21 21 21 21 21 21",
"output": "15"
},
{
"input": "12\n10 10 14 14 14 14 14 14 14 14 21 21",
"output": "20"
},
{
"input": "5\n10 10 14 21 21",
"output": "6"
},
{
"input": "9\n10 10 10 10 10 14 14 21 21",
"output": "11"
},
{
"input": "9\n10 10 10 10 10 10 10 10 21",
"output": "9"
},
{
"input": "13\n10 10 10 15 15 15 15 15 15 15 15 21 21",
"output": "21"
},
{
"input": "15\n10 10 10 10 10 10 10 10 10 10 10 10 15 15 21",
"output": "17"
},
{
"input": "4\n1 1 1 1",
"output": "0"
},
{
"input": "1\n3",
"output": "-1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n1000000000 1000000000",
"output": "-1"
},
{
"input": "1\n1000000000",
"output": "-1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n42 15 35",
"output": "4"
},
{
"input": "3\n6 10 15",
"output": "4"
},
{
"input": "4\n2 1 1 1",
"output": "1"
},
{
"input": "5\n2 1 1 1 2",
"output": "2"
},
{
"input": "3\n30 14 21",
"output": "4"
},
{
"input": "3\n15 6 10",
"output": "4"
},
{
"input": "4\n1 1 1 2",
"output": "1"
},
{
"input": "5\n1 1 1 2 2",
"output": "2"
},
{
"input": "4\n2 6 9 1",
"output": "3"
},
{
"input": "6\n2 3 4 1 1 1",
"output": "3"
},
{
"input": "15\n2 6 6 6 3 3 3 15 5 5 5 7 5 5 5",
"output": "15"
},
{
"input": "5\n2 3 2 6 9",
"output": "5"
},
{
"input": "6\n6 15 10 6 15 10",
"output": "7"
}
] | 1,510,944,161
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 1,560
| 0
|
n = int(input())
array = list(map(int, input().split()))
def gcd(a, b):
if b > 0:
return gcd(b, a % b)
else:
return a
allGcd = array[0]
for elem in array:
allGcd = gcd(allGcd, elem)
if allGcd > 1:
print(-1)
else:
ones = 0
for elem in array:
if elem == 1:
ones += 1
if ones > 1:
print(n - ones)
else:
res = 2000000000
for i in range(n):
tmp = array[i]
for j in range(i, n):
tmp = gcd(tmp, array[j])
if tmp == 1:
res = min(res, j-i)
print(n + res - 1)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have an array *a* with length *n*, you can perform operations. Each operation is like this: choose two adjacent elements from *a*, say *x* and *y*, and replace one of them with *gcd*(*x*,<=*y*), where *gcd* denotes the [greatest common divisor](https://en.wikipedia.org/wiki/Greatest_common_divisor).
What is the minimum number of operations you need to make all of the elements equal to 1?
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=2000) — the number of elements in the array.
The second line contains *n* space separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
Output Specification:
Print -1, if it is impossible to turn all numbers to 1. Otherwise, print the minimum number of operations needed to make all numbers equal to 1.
Demo Input:
['5\n2 2 3 4 6\n', '4\n2 4 6 8\n', '3\n2 6 9\n']
Demo Output:
['5\n', '-1\n', '4\n']
Note:
In the first sample you can turn all numbers to 1 using the following 5 moves:
- [2, 2, 3, 4, 6]. - [2, 1, 3, 4, 6] - [2, 1, 3, 1, 6] - [2, 1, 1, 1, 6] - [1, 1, 1, 1, 6] - [1, 1, 1, 1, 1]
We can prove that in this case it is not possible to make all numbers one using less than 5 moves.
|
```python
n = int(input())
array = list(map(int, input().split()))
def gcd(a, b):
if b > 0:
return gcd(b, a % b)
else:
return a
allGcd = array[0]
for elem in array:
allGcd = gcd(allGcd, elem)
if allGcd > 1:
print(-1)
else:
ones = 0
for elem in array:
if elem == 1:
ones += 1
if ones > 1:
print(n - ones)
else:
res = 2000000000
for i in range(n):
tmp = array[i]
for j in range(i, n):
tmp = gcd(tmp, array[j])
if tmp == 1:
res = min(res, j-i)
print(n + res - 1)
```
| 3
|
|
612
|
A
|
The Text Splitting
|
PROGRAMMING
| 1,300
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test).
|
The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits.
|
If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* — the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right.
If there are several solutions print any of them.
|
[
"5 2 3\nHello\n",
"10 9 5\nCodeforces\n",
"6 4 5\nPrivet\n",
"8 1 1\nabacabac\n"
] |
[
"2\nHe\nllo\n",
"2\nCodef\norces\n",
"-1\n",
"8\na\nb\na\nc\na\nb\na\nc\n"
] |
none
| 0
|
[
{
"input": "5 2 3\nHello",
"output": "2\nHe\nllo"
},
{
"input": "10 9 5\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "6 4 5\nPrivet",
"output": "-1"
},
{
"input": "8 1 1\nabacabac",
"output": "8\na\nb\na\nc\na\nb\na\nc"
},
{
"input": "1 1 1\n1",
"output": "1\n1"
},
{
"input": "10 8 1\nuTl9w4lcdo",
"output": "10\nu\nT\nl\n9\nw\n4\nl\nc\nd\no"
},
{
"input": "20 6 4\nfmFRpk2NrzSvnQC9gB61",
"output": "5\nfmFR\npk2N\nrzSv\nnQC9\ngB61"
},
{
"input": "30 23 6\nWXDjl9kitaDTY673R5xyTlbL9gqeQ6",
"output": "5\nWXDjl9\nkitaDT\nY673R5\nxyTlbL\n9gqeQ6"
},
{
"input": "40 14 3\nSOHBIkWEv7ScrkHgMtFFxP9G7JQLYXFoH1sJDAde",
"output": "6\nSOHBIkWEv7Scrk\nHgMtFFxP9G7JQL\nYXF\noH1\nsJD\nAde"
},
{
"input": "50 16 3\nXCgVJUu4aMQ7HMxZjNxe3XARNiahK303g9y7NV8oN6tWdyXrlu",
"output": "8\nXCgVJUu4aMQ7HMxZ\njNxe3XARNiahK303\ng9y\n7NV\n8oN\n6tW\ndyX\nrlu"
},
{
"input": "60 52 8\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4hCKogONj",
"output": "2\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4\nhCKogONj"
},
{
"input": "70 50 5\n1BH1ECq7hjzooQOZdbiYHTAgATcP5mxI7kLI9rqA9AriWc9kE5KoLa1zmuTDFsd2ClAPPY",
"output": "14\n1BH1E\nCq7hj\nzooQO\nZdbiY\nHTAgA\nTcP5m\nxI7kL\nI9rqA\n9AriW\nc9kE5\nKoLa1\nzmuTD\nFsd2C\nlAPPY"
},
{
"input": "80 51 8\no2mpu1FCofuiLQb472qczCNHfVzz5TfJtVMrzgN3ff7FwlAY0fQ0ROhWmIX2bggodORNA76bHMjA5yyc",
"output": "10\no2mpu1FC\nofuiLQb4\n72qczCNH\nfVzz5TfJ\ntVMrzgN3\nff7FwlAY\n0fQ0ROhW\nmIX2bggo\ndORNA76b\nHMjA5yyc"
},
{
"input": "90 12 7\nclcImtsw176FFOA6OHGFxtEfEyhFh5bH4iktV0Y8onIcn0soTwiiHUFRWC6Ow36tT5bsQjgrVSTcB8fAVoe7dJIWkE",
"output": "10\nclcImtsw176F\nFOA6OHGFxtEf\nEyhFh5bH4ikt\nV0Y8onIcn0so\nTwiiHUF\nRWC6Ow3\n6tT5bsQ\njgrVSTc\nB8fAVoe\n7dJIWkE"
},
{
"input": "100 25 5\n2SRB9mRpXMRND5zQjeRxc4GhUBlEQSmLgnUtB9xTKoC5QM9uptc8dKwB88XRJy02r7edEtN2C6D60EjzK1EHPJcWNj6fbF8kECeB",
"output": "20\n2SRB9\nmRpXM\nRND5z\nQjeRx\nc4GhU\nBlEQS\nmLgnU\ntB9xT\nKoC5Q\nM9upt\nc8dKw\nB88XR\nJy02r\n7edEt\nN2C6D\n60Ejz\nK1EHP\nJcWNj\n6fbF8\nkECeB"
},
{
"input": "100 97 74\nxL8yd8lENYnXZs28xleyci4SxqsjZqkYzkEbQXfLQ4l4gKf9QQ9xjBjeZ0f9xQySf5psDUDkJEtPLsa62n4CLc6lF6E2yEqvt4EJ",
"output": "-1"
},
{
"input": "51 25 11\nwpk5wqrB6d3qE1slUrzJwMFafnnOu8aESlvTEb7Pp42FDG2iGQn",
"output": "-1"
},
{
"input": "70 13 37\nfzL91QIJvNoZRP4A9aNRT2GTksd8jEb1713pnWFaCGKHQ1oYvlTHXIl95lqyZRKJ1UPYvT",
"output": "-1"
},
{
"input": "10 3 1\nXQ2vXLPShy",
"output": "10\nX\nQ\n2\nv\nX\nL\nP\nS\nh\ny"
},
{
"input": "4 2 3\naaaa",
"output": "2\naa\naa"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb"
},
{
"input": "99 2 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 2 3\nhavanahavan",
"output": "4\nha\nvan\naha\nvan"
},
{
"input": "100 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "50\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa"
},
{
"input": "17 3 5\ngopstopmipodoshli",
"output": "5\ngop\nsto\npmi\npod\noshli"
},
{
"input": "5 4 3\nfoyku",
"output": "-1"
},
{
"input": "99 2 2\n123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789",
"output": "-1"
},
{
"input": "99 2 2\nrecursionishellrecursionishellrecursionishellrecursionishellrecursionishellrecursionishelldontuseit",
"output": "-1"
},
{
"input": "11 2 3\nqibwnnvqqgo",
"output": "4\nqi\nbwn\nnvq\nqgo"
},
{
"input": "4 4 3\nhhhh",
"output": "1\nhhhh"
},
{
"input": "99 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "99 2 5\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "21\nhh\nhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh"
},
{
"input": "10 5 9\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "10 5 9\naaaaaaaaaa",
"output": "2\naaaaa\naaaaa"
},
{
"input": "11 3 2\nmlmqpohwtsf",
"output": "5\nmlm\nqp\noh\nwt\nsf"
},
{
"input": "3 3 2\nzyx",
"output": "1\nzyx"
},
{
"input": "100 3 3\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "4 2 3\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "3 2 3\nejt",
"output": "1\nejt"
},
{
"input": "5 2 4\nzyxwv",
"output": "-1"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na"
},
{
"input": "100 5 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa"
},
{
"input": "3 2 2\nzyx",
"output": "-1"
},
{
"input": "99 2 2\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "-1"
},
{
"input": "26 8 9\nabcabcabcabcabcabcabcabcab",
"output": "3\nabcabcab\ncabcabcab\ncabcabcab"
},
{
"input": "6 3 5\naaaaaa",
"output": "2\naaa\naaa"
},
{
"input": "3 2 3\nzyx",
"output": "1\nzyx"
},
{
"input": "5 5 2\naaaaa",
"output": "1\naaaaa"
},
{
"input": "4 3 2\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "5 4 3\nzyxwv",
"output": "-1"
},
{
"input": "95 3 29\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "23\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabcabcabcabcabcabcabcabcabcab"
},
{
"input": "3 2 2\naaa",
"output": "-1"
},
{
"input": "91 62 3\nfjzhkfwzoabaauvbkuzaahkozofaophaafhfpuhobufawkzbavaazwavwppfwapkapaofbfjwaavajojgjguahphofj",
"output": "-1"
},
{
"input": "99 2 2\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc",
"output": "-1"
},
{
"input": "56 13 5\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "8\nabcabcabcabca\nbcabcabcabcab\ncabca\nbcabc\nabcab\ncabca\nbcabc\nabcab"
},
{
"input": "79 7 31\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca",
"output": "-1"
},
{
"input": "92 79 6\nxlvplpckwnhmctoethhslkcyashqtsoeltriddglfwtgkfvkvgytygbcyohrvcxvosdioqvackxiuifmkgdngvbbudcb",
"output": "-1"
},
{
"input": "48 16 13\nibhfinipihcbsqnvtgsbkobepmwymlyfmlfgblvhlfhyojsy",
"output": "3\nibhfinipihcbsqnv\ntgsbkobepmwymlyf\nmlfgblvhlfhyojsy"
},
{
"input": "16 3 7\naaaaaaaaaaaaaaaa",
"output": "4\naaa\naaa\naaa\naaaaaaa"
},
{
"input": "11 10 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 8 8\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 7 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "41 3 4\nabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "11\nabc\nabc\nabc\nabca\nbcab\ncabc\nabca\nbcab\ncabc\nabca\nbcab"
},
{
"input": "11 3 2\naaaaaaaaaaa",
"output": "5\naaa\naa\naa\naa\naa"
},
{
"input": "14 9 4\nabcdefghijklmn",
"output": "-1"
},
{
"input": "9 9 5\n123456789",
"output": "1\n123456789"
},
{
"input": "92 10 41\nmeotryyfneonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlgeftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw",
"output": "3\nmeotryyfne\nonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlg\neftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw"
},
{
"input": "17 16 3\ndxyhgtsxtuyljmclj",
"output": "-1"
},
{
"input": "82 13 30\nfmtwumakkejtolxqxrnydhqoufwtdwldfxcfjrndauqcarhbwmdwxsxfbqjsfspuxobywhcrvlndsdmkqd",
"output": "5\nfmtwumakkejto\nlxqxrnydhqouf\nwtdwldfxcfjrn\ndauqcarhbwmdw\nxsxfbqjsfspuxobywhcrvlndsdmkqd"
},
{
"input": "95 3 3\nihnfqcswushyoirjxlxxnwqtwtaowounkumxukwpacxwatimhhhoggqwkkspcplvyndfukbxickcixidgxkjtnpkoeiwlor",
"output": "-1"
},
{
"input": "7 5 3\nzyxwvut",
"output": "-1"
},
{
"input": "17 16 4\nctvfhkiakagcilrdw",
"output": "-1"
}
] | 1,508,934,848
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 46
| 0
|
n, p, q = map(int, input().split())
s = input()
for i in range(n):
for j in range(n):
if (i * p + j * q == n):
print(i + j)
for ii in range (i):
print(s[ii * p : (ii + 1) * p])
for jj in range (j):
print(s[i * p + jj * q : i * p + (jj + 1) * q])
exit()
print("-1")
|
Title: The Text Splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test).
Input Specification:
The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits.
Output Specification:
If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* — the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right.
If there are several solutions print any of them.
Demo Input:
['5 2 3\nHello\n', '10 9 5\nCodeforces\n', '6 4 5\nPrivet\n', '8 1 1\nabacabac\n']
Demo Output:
['2\nHe\nllo\n', '2\nCodef\norces\n', '-1\n', '8\na\nb\na\nc\na\nb\na\nc\n']
Note:
none
|
```python
n, p, q = map(int, input().split())
s = input()
for i in range(n):
for j in range(n):
if (i * p + j * q == n):
print(i + j)
for ii in range (i):
print(s[ii * p : (ii + 1) * p])
for jj in range (j):
print(s[i * p + jj * q : i * p + (jj + 1) * q])
exit()
print("-1")
```
| 0
|
|
591
|
B
|
Rebranding
|
PROGRAMMING
| 1,200
|
[
"implementation",
"strings"
] | null | null |
The name of one small but proud corporation consists of *n* lowercase English letters. The Corporation has decided to try rebranding — an active marketing strategy, that includes a set of measures to change either the brand (both for the company and the goods it produces) or its components: the name, the logo, the slogan. They decided to start with the name.
For this purpose the corporation has consecutively hired *m* designers. Once a company hires the *i*-th designer, he immediately contributes to the creation of a new corporation name as follows: he takes the newest version of the name and replaces all the letters *x**i* by *y**i*, and all the letters *y**i* by *x**i*. This results in the new version. It is possible that some of these letters do no occur in the string. It may also happen that *x**i* coincides with *y**i*. The version of the name received after the work of the last designer becomes the new name of the corporation.
Manager Arkady has recently got a job in this company, but is already soaked in the spirit of teamwork and is very worried about the success of the rebranding. Naturally, he can't wait to find out what is the new name the Corporation will receive.
Satisfy Arkady's curiosity and tell him the final version of the name.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the length of the initial name and the number of designers hired, respectively.
The second line consists of *n* lowercase English letters and represents the original name of the corporation.
Next *m* lines contain the descriptions of the designers' actions: the *i*-th of them contains two space-separated lowercase English letters *x**i* and *y**i*.
|
Print the new name of the corporation.
|
[
"6 1\npolice\np m\n",
"11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b\n"
] |
[
"molice\n",
"cdcbcdcfcdc\n"
] |
In the second sample the name of the corporation consecutively changes as follows:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c7648432f7138ca53234357d7e08d1d119166055.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/de89ad7bc7f27c46ec34f5e66ce0dc23bd5bc90a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/812e653c8d7ff496e6a0f04c676423806751531e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19c564fcefb8dde36256240a8b877bb6a4792bfe.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e1cafd93792430ad1a49e893e04715383bdae757.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "6 1\npolice\np m",
"output": "molice"
},
{
"input": "11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b",
"output": "cdcbcdcfcdc"
},
{
"input": "1 1\nf\nz h",
"output": "f"
},
{
"input": "1 1\na\na b",
"output": "b"
},
{
"input": "10 10\nlellelleel\ne l\ne l\ne l\ne l\ne l\ne e\nl l\nl e\nl l\ne e",
"output": "lellelleel"
}
] | 1,690,786,166
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 2,000
| 614,400
|
n, m = map(int, input().split())
a = input()
for _ in range(m):
first, second = input().split()
a = a.translate(str.maketrans({first: second, second: first}))
print(a)
|
Title: Rebranding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The name of one small but proud corporation consists of *n* lowercase English letters. The Corporation has decided to try rebranding — an active marketing strategy, that includes a set of measures to change either the brand (both for the company and the goods it produces) or its components: the name, the logo, the slogan. They decided to start with the name.
For this purpose the corporation has consecutively hired *m* designers. Once a company hires the *i*-th designer, he immediately contributes to the creation of a new corporation name as follows: he takes the newest version of the name and replaces all the letters *x**i* by *y**i*, and all the letters *y**i* by *x**i*. This results in the new version. It is possible that some of these letters do no occur in the string. It may also happen that *x**i* coincides with *y**i*. The version of the name received after the work of the last designer becomes the new name of the corporation.
Manager Arkady has recently got a job in this company, but is already soaked in the spirit of teamwork and is very worried about the success of the rebranding. Naturally, he can't wait to find out what is the new name the Corporation will receive.
Satisfy Arkady's curiosity and tell him the final version of the name.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the length of the initial name and the number of designers hired, respectively.
The second line consists of *n* lowercase English letters and represents the original name of the corporation.
Next *m* lines contain the descriptions of the designers' actions: the *i*-th of them contains two space-separated lowercase English letters *x**i* and *y**i*.
Output Specification:
Print the new name of the corporation.
Demo Input:
['6 1\npolice\np m\n', '11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b\n']
Demo Output:
['molice\n', 'cdcbcdcfcdc\n']
Note:
In the second sample the name of the corporation consecutively changes as follows:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c7648432f7138ca53234357d7e08d1d119166055.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/de89ad7bc7f27c46ec34f5e66ce0dc23bd5bc90a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/812e653c8d7ff496e6a0f04c676423806751531e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19c564fcefb8dde36256240a8b877bb6a4792bfe.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e1cafd93792430ad1a49e893e04715383bdae757.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
n, m = map(int, input().split())
a = input()
for _ in range(m):
first, second = input().split()
a = a.translate(str.maketrans({first: second, second: first}))
print(a)
```
| 0
|
|
757
|
B
|
Bash's Big Day
|
PROGRAMMING
| 1,400
|
[
"greedy",
"math",
"number theory"
] | null | null |
Bash has set out on a journey to become the greatest Pokemon master. To get his first Pokemon, he went to Professor Zulu's Lab. Since Bash is Professor Zulu's favourite student, Zulu allows him to take as many Pokemon from his lab as he pleases.
But Zulu warns him that a group of *k*<=><=1 Pokemon with strengths {*s*1,<=*s*2,<=*s*3,<=...,<=*s**k*} tend to fight among each other if *gcd*(*s*1,<=*s*2,<=*s*3,<=...,<=*s**k*)<==<=1 (see notes for *gcd* definition).
Bash, being smart, does not want his Pokemon to fight among each other. However, he also wants to maximize the number of Pokemon he takes from the lab. Can you help Bash find out the maximum number of Pokemon he can take?
Note: A Pokemon cannot fight with itself.
|
The input consists of two lines.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105), the number of Pokemon in the lab.
The next line contains *n* space separated integers, where the *i*-th of them denotes *s**i* (1<=≤<=*s**i*<=≤<=105), the strength of the *i*-th Pokemon.
|
Print single integer — the maximum number of Pokemons Bash can take.
|
[
"3\n2 3 4\n",
"5\n2 3 4 6 7\n"
] |
[
"2\n",
"3\n"
] |
*gcd* (greatest common divisor) of positive integers set {*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ..., *a*<sub class="lower-index">*n*</sub>} is the maximum positive integer that divides all the integers {*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ..., *a*<sub class="lower-index">*n*</sub>}.
In the first sample, we can take Pokemons with strengths {2, 4} since *gcd*(2, 4) = 2.
In the second sample, we can take Pokemons with strengths {2, 4, 6}, and there is no larger group with *gcd* ≠ 1.
| 1,000
|
[
{
"input": "3\n2 3 4",
"output": "2"
},
{
"input": "5\n2 3 4 6 7",
"output": "3"
},
{
"input": "3\n5 6 4",
"output": "2"
},
{
"input": "8\n41 74 4 27 85 39 100 36",
"output": "4"
},
{
"input": "6\n89 20 86 81 62 23",
"output": "3"
},
{
"input": "71\n23 84 98 8 14 4 42 56 83 87 28 22 32 50 5 96 90 1 59 74 77 88 71 38 62 36 85 97 99 6 81 20 49 57 66 9 45 41 29 68 35 19 27 76 78 72 55 25 46 48 26 53 39 31 94 34 63 37 64 16 79 24 82 17 12 3 89 61 80 30 10",
"output": "38"
},
{
"input": "95\n72 38 75 62 87 30 11 65 35 16 73 23 18 48 19 4 22 42 14 60 49 83 59 15 51 27 80 97 37 100 64 81 54 71 52 20 5 98 78 86 26 55 25 57 36 3 8 74 82 21 29 1 76 2 79 61 39 9 89 77 70 63 56 28 92 53 31 45 93 47 67 99 58 12 84 44 32 34 69 40 13 7 66 68 17 85 6 90 33 91 94 24 46 10 50",
"output": "48"
},
{
"input": "44\n39706 21317 26213 55086 10799 31825 29024 6565 96535 11412 14642 91901 41932 24538 81351 53861 63403 34199 82286 32594 29684 42753 16857 73821 71085 36306 70080 11233 21023 8551 85406 95390 92375 52675 77938 46265 74855 5229 5856 66713 65730 24525 84078 20684",
"output": "19"
},
{
"input": "35\n45633 86983 46174 48399 33926 51395 76300 6387 48852 82808 28694 79864 4482 35982 21956 76522 19656 74518 28480 71481 25700 46815 14170 95705 8535 96993 29029 8898 97637 62710 14615 22864 69849 27068 68557",
"output": "20"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n10 7 9 8 3 3 10 7 3 3",
"output": "5"
},
{
"input": "9\n10 10 6 10 9 1 8 3 5",
"output": "5"
},
{
"input": "7\n9 4 2 3 3 9 8",
"output": "4"
},
{
"input": "1\n4",
"output": "1"
},
{
"input": "6\n1623 45906 37856 34727 27156 12598",
"output": "4"
},
{
"input": "30\n83172 59163 67334 83980 5932 8773 77649 41428 62789 28159 17183 10199 41496 59500 14614 10468 54886 64679 42382 57021 50499 95643 77239 61434 16181 30505 59152 55972 18265 70566",
"output": "15"
},
{
"input": "23\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 22 16 2 13 16",
"output": "22"
},
{
"input": "46\n12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 12553 15 1 18 28 20 6 31 16 5 23 21 38 3 11 18 11 3 25 33",
"output": "27"
},
{
"input": "43\n8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8831 8 23 40 33 11 5 21 16 19 15 41 30 28 31 5 32 16 5 38 11 21 34",
"output": "21"
},
{
"input": "25\n58427 26687 48857 46477 7039 25423 58757 48119 38113 40637 22391 48337 4157 10597 8167 19031 64613 70913 69313 18047 17159 77491 13499 70949 24107",
"output": "1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "2\n3 6",
"output": "2"
},
{
"input": "5\n1 1 1 1 1",
"output": "1"
},
{
"input": "5\n3 3 3 3 3",
"output": "5"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "2\n541 541",
"output": "2"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n99989 99989",
"output": "2"
},
{
"input": "3\n3 9 27",
"output": "3"
},
{
"input": "2\n1009 1009",
"output": "2"
},
{
"input": "4\n1 1 1 1",
"output": "1"
},
{
"input": "6\n2 10 20 5 15 25",
"output": "5"
},
{
"input": "3\n3 3 6",
"output": "3"
},
{
"input": "3\n457 457 457",
"output": "3"
},
{
"input": "2\n34 17",
"output": "2"
},
{
"input": "3\n12 24 3",
"output": "3"
},
{
"input": "10\n99991 99991 99991 99991 99991 99991 99991 99991 99991 99991",
"output": "10"
},
{
"input": "2\n1009 2018",
"output": "2"
},
{
"input": "3\n3 3 3",
"output": "3"
},
{
"input": "7\n6 9 12 15 21 27 33",
"output": "7"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "2\n557 557",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "5\n2 2 101 101 101",
"output": "3"
},
{
"input": "2\n122 3721",
"output": "2"
},
{
"input": "2\n49201 98402",
"output": "2"
},
{
"input": "2\n88258 44129",
"output": "2"
},
{
"input": "2\n7919 47514",
"output": "2"
},
{
"input": "5\n1 2 1 1 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "5\n1 1 1 1 2",
"output": "1"
},
{
"input": "3\n10007 20014 30021",
"output": "3"
},
{
"input": "4\n10 10 5 5",
"output": "4"
},
{
"input": "2\n6 9",
"output": "2"
},
{
"input": "3\n6 12 9",
"output": "3"
},
{
"input": "2\n14 7",
"output": "2"
},
{
"input": "2\n199 199",
"output": "2"
},
{
"input": "3\n49999 49999 99998",
"output": "3"
},
{
"input": "5\n1009 1009 1009 1009 1009",
"output": "5"
},
{
"input": "3\n17 17 17",
"output": "3"
},
{
"input": "2\n503 1509",
"output": "2"
},
{
"input": "3\n49999 99998 99998",
"output": "3"
},
{
"input": "2\n28657 28657",
"output": "2"
},
{
"input": "3\n121 22 33",
"output": "3"
},
{
"input": "2\n10079 20158",
"output": "2"
},
{
"input": "2\n6 15",
"output": "2"
},
{
"input": "4\n6 6 6 3",
"output": "4"
},
{
"input": "2\n991 1982",
"output": "2"
},
{
"input": "3\n20362 30543 50905",
"output": "3"
},
{
"input": "2\n443 886",
"output": "2"
},
{
"input": "4\n3 7 7 21",
"output": "3"
},
{
"input": "3\n3 6 9",
"output": "3"
},
{
"input": "2\n217 31",
"output": "2"
},
{
"input": "6\n10 10 10 5 5 5",
"output": "6"
},
{
"input": "4\n49441 25225 9081 4036",
"output": "4"
},
{
"input": "2\n4 9",
"output": "1"
},
{
"input": "2\n18 27",
"output": "2"
},
{
"input": "2\n13 26",
"output": "2"
},
{
"input": "4\n6 6 6 15",
"output": "4"
}
] | 1,484,907,202
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 2,000
| 11,878,400
|
def simple(l):
m = [2]
for i in range(3, l + 1):
k = 0
for j in range(2, int(i ** 0.5) + 1):
if i % j == 0:
k = 1
break
if k != 1:
m.append(i)
return m
n = int(input())
s = list(map(int, input().split()))
k = 0
ans = 0
i = 0
m = simple(max(s))
while i != len(m):
curr = 0
for elem in s:
if elem % m[i] == 0:
curr += 1
if curr > ans:
ans = curr
i += 1
if ans == 0:
ans = 1
print(ans)
|
Title: Bash's Big Day
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bash has set out on a journey to become the greatest Pokemon master. To get his first Pokemon, he went to Professor Zulu's Lab. Since Bash is Professor Zulu's favourite student, Zulu allows him to take as many Pokemon from his lab as he pleases.
But Zulu warns him that a group of *k*<=><=1 Pokemon with strengths {*s*1,<=*s*2,<=*s*3,<=...,<=*s**k*} tend to fight among each other if *gcd*(*s*1,<=*s*2,<=*s*3,<=...,<=*s**k*)<==<=1 (see notes for *gcd* definition).
Bash, being smart, does not want his Pokemon to fight among each other. However, he also wants to maximize the number of Pokemon he takes from the lab. Can you help Bash find out the maximum number of Pokemon he can take?
Note: A Pokemon cannot fight with itself.
Input Specification:
The input consists of two lines.
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105), the number of Pokemon in the lab.
The next line contains *n* space separated integers, where the *i*-th of them denotes *s**i* (1<=≤<=*s**i*<=≤<=105), the strength of the *i*-th Pokemon.
Output Specification:
Print single integer — the maximum number of Pokemons Bash can take.
Demo Input:
['3\n2 3 4\n', '5\n2 3 4 6 7\n']
Demo Output:
['2\n', '3\n']
Note:
*gcd* (greatest common divisor) of positive integers set {*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ..., *a*<sub class="lower-index">*n*</sub>} is the maximum positive integer that divides all the integers {*a*<sub class="lower-index">1</sub>, *a*<sub class="lower-index">2</sub>, ..., *a*<sub class="lower-index">*n*</sub>}.
In the first sample, we can take Pokemons with strengths {2, 4} since *gcd*(2, 4) = 2.
In the second sample, we can take Pokemons with strengths {2, 4, 6}, and there is no larger group with *gcd* ≠ 1.
|
```python
def simple(l):
m = [2]
for i in range(3, l + 1):
k = 0
for j in range(2, int(i ** 0.5) + 1):
if i % j == 0:
k = 1
break
if k != 1:
m.append(i)
return m
n = int(input())
s = list(map(int, input().split()))
k = 0
ans = 0
i = 0
m = simple(max(s))
while i != len(m):
curr = 0
for elem in s:
if elem % m[i] == 0:
curr += 1
if curr > ans:
ans = curr
i += 1
if ans == 0:
ans = 1
print(ans)
```
| 0
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,624,617,717
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 154
| 0
|
n = int(input())
a = list(map(int,input().split()))
count_even = []
count_odd = []
for i in a:
if i%2 ==0:
count_even.append(i)
else:
count_odd.append(i)
if len(count_odd) >= 1 and len(count_even) >= 1:
if len(count_even) > len(count_odd):
print(a.index(count_odd[0])+1)
break
if len(count_even) < len(count_odd):
print(a.index(count_even[0])+1)
break
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n = int(input())
a = list(map(int,input().split()))
count_even = []
count_odd = []
for i in a:
if i%2 ==0:
count_even.append(i)
else:
count_odd.append(i)
if len(count_odd) >= 1 and len(count_even) >= 1:
if len(count_even) > len(count_odd):
print(a.index(count_odd[0])+1)
break
if len(count_even) < len(count_odd):
print(a.index(count_even[0])+1)
break
```
| 3.9615
|
21
|
A
|
Jabber ID
|
PROGRAMMING
| 1,900
|
[
"implementation",
"strings"
] |
A. Jabber ID
|
0
|
256
|
Jabber ID on the national Berland service «Babber» has a form <username>@<hostname>[/resource], where
- <username> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <username> is between 1 and 16, inclusive. - <hostname> — is a sequence of word separated by periods (characters «.»), where each word should contain only characters allowed for <username>, the length of each word is between 1 and 16, inclusive. The length of <hostname> is between 1 and 32, inclusive. - <resource> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <resource> is between 1 and 16, inclusive.
The content of square brackets is optional — it can be present or can be absent.
There are the samples of correct Jabber IDs: [[email protected]](/cdn-cgi/l/email-protection), [[email protected]](/cdn-cgi/l/email-protection)/contest.
Your task is to write program which checks if given string is a correct Jabber ID.
|
The input contains of a single line. The line has the length between 1 and 100 characters, inclusive. Each characters has ASCII-code between 33 and 127, inclusive.
|
Print YES or NO.
|
[
"[email protected]\n",
"[email protected]/contest.icpc/12\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "mike@codeforces.com",
"output": "YES"
},
{
"input": "john.smith@codeforces.ru/contest.icpc/12",
"output": "NO"
},
{
"input": "test@test.ri/abacaba",
"output": "YES"
},
{
"input": "@ops",
"output": "NO"
},
{
"input": "this-is-the-test",
"output": "NO"
},
{
"input": "mike@codeforces.commike@codeforces.com",
"output": "NO"
},
{
"input": "oooop/oooop",
"output": "NO"
},
{
"input": "w@S8/XU.5._R7fHq.@../e.WP!54Ey1L.9jv",
"output": "NO"
},
{
"input": "lNC9D1L5U@.L!_!CcAOEEx.0z.aiW/S430sbQT",
"output": "NO"
},
{
"input": "@/YTd.K1@lD",
"output": "NO"
},
{
"input": "Fyi!d1l@.OesGopTnRn.81xdSb8q./MzuI",
"output": "NO"
},
{
"input": "_TlPy65w/@.Vl@.8k",
"output": "NO"
},
{
"input": "xpS@._s8.e0lJci/.LdiT",
"output": "NO"
},
{
"input": "lGwo8.D2@.3",
"output": "NO"
},
{
"input": "Ccz9T5rKZQuEerGo@6l.",
"output": "NO"
},
{
"input": "Y@5nh@8.9P.Bx5AaY.1g.Tc_MK7.g_..0.",
"output": "NO"
},
{
"input": "Q2/6y!SP9sG@7zIGr.Du_nR8.",
"output": "NO"
},
{
"input": "eWfLL@gW!BEJUxFh@dghf.d4.FiYp/2.Pr7a/5O6zXdAkikjCEDrb",
"output": "NO"
},
{
"input": "8oI/a@Q",
"output": "NO"
},
{
"input": "J@Y9Gz550l@PqVZdQ!u",
"output": "NO"
},
{
"input": "VTE6aTTta@DHe4xeG@6.c2R.J.O7sndWEEW.9j@.l..3Bs",
"output": "NO"
},
{
"input": "aeo2XkK@UX.nQJN!Tg..wGN5YOi68U.oP2Yl3/",
"output": "NO"
},
{
"input": "m13zREg8LbPr@T2.Z9@g.9u.v.A..XNH/1/tloIceXydZf3",
"output": "NO"
},
{
"input": "4@@..f3ZT./oUGZ@",
"output": "NO"
},
{
"input": "G.rVAxwDx@a.PVSe!KtpX4tzs/0yQGzZCPJPJoda",
"output": "NO"
},
{
"input": "SV9T5RR425Sl0b@kzj.XT.PFWc..ho/VE7gjf",
"output": "NO"
},
{
"input": "bgko@1../xwSj_J",
"output": "NO"
},
{
"input": "n5ymLC.bE@ukio.im2../.",
"output": "NO"
},
{
"input": "zr.KB_6ZMSwI2GA5@R/4iP1ZKHpszW!YN/",
"output": "NO"
},
{
"input": "@alK@pR",
"output": "NO"
},
{
"input": "al_Y2I4IKp@A_N.ruCw0VL/hRzJtx.S7sp/r!c.n9ffh",
"output": "NO"
},
{
"input": "C1rE26_rTAVzLm@6@X5OGX.ibJ9./kkBEVlcU",
"output": "NO"
},
{
"input": "feGSXP@eyUfr8.x4Re.JL.6B.r/fX_",
"output": "NO"
},
{
"input": "Ht15T@50eo.E@.",
"output": "NO"
},
{
"input": "k9MITs_Ar.JL2RRs4@VRq.wCuJ.6..amF.fE4.5I.6fJ7gz7",
"output": "NO"
},
{
"input": "MiWPE8@fc./IViqq4T4PSUuMdhH",
"output": "NO"
},
{
"input": "pxSCmv!NbMvz2@pTQ.t!.Ntz/QEh_sl",
"output": "NO"
},
{
"input": "s@mH@RO_/iWD",
"output": "NO"
},
{
"input": "UP51i49wX@pvx@2LWm8w/G4M3J./9L6Szy",
"output": "NO"
},
{
"input": "xC_5Vx8NgF..ln@X1.drRTX..1vx.Xb3of@/PQYPeq@_y8!h_iF",
"output": "NO"
},
{
"input": "qG3@LKp",
"output": "YES"
},
{
"input": "flTq1knyb@2!Mtfss",
"output": "NO"
},
{
"input": "/pqi7WXQPJFM4q1@hxUyUy/_pWo0n",
"output": "NO"
},
{
"input": "zXme@.Dq.TWBs.fB.M",
"output": "NO"
},
{
"input": "o3EaAnc3K6@h",
"output": "YES"
},
{
"input": "G/AZdVMTzRLV4Ucm@eQ!..pq!..tRTi5.Ejkqa/HGpFYk",
"output": "NO"
},
{
"input": ".c_V@L.1v!AFAEk7glMq.ag8Sy8@0.Qm/OLKoJpZlac",
"output": "NO"
},
{
"input": "WKxNIM79u@I.RM",
"output": "NO"
},
{
"input": "POTjlYcxAZsbyZPDh@sPm.z6aVaO.H1wEUhD9YvROQFUk/M_jTHS_6!",
"output": "NO"
},
{
"input": "pbRIiuA@KZ2hVed2fMikA.@ebd.tE2Y",
"output": "NO"
},
{
"input": "OlS_OwxYhH@im.0A7o/juNlxB",
"output": "YES"
},
{
"input": "xkjHHDRBEFwgNP@G9TGStEs2Lu.BJge3EBXw3c9EfE",
"output": "YES"
},
{
"input": "bK@8X7tQO.pXBHJpDewD",
"output": "YES"
},
{
"input": "kKUXy6@0WefbXz39ywP.Q3r7uF",
"output": "YES"
},
{
"input": "SllbRLdZ6@.T.E3x.BE2nIv.5db_.38./zgVGNjpldr",
"output": "NO"
},
{
"input": "4lBJkY8c097oa@ZYmVbtiyyYN.gbj",
"output": "YES"
},
{
"input": "F@JX4.SI1/0EY3XmYatfY",
"output": "YES"
},
{
"input": "oLo01@B77Pu.9R.vtAZG0.HQSunv0J.",
"output": "NO"
},
{
"input": "xLEctap0T@22U9W_fA/7iQeJGFu1lSgMZ",
"output": "YES"
},
{
"input": "WYh@yUWfOQiF.gOK9k8aEa",
"output": "YES"
},
{
"input": "BPxNVANhtEh@Oh_go.",
"output": "NO"
},
{
"input": "mGIY@cHRNC8GlJ/2pcl3LYxpi3PaKGs",
"output": "YES"
},
{
"input": "x6yfn7BGwqWd@.N/UXC",
"output": "NO"
},
{
"input": "cUIr@cP.eGQC2xJXvI1X7",
"output": "YES"
},
{
"input": "MLZ6e1vgZ4hOI@ktWk.Ro.o6C4/i8cnKHT",
"output": "YES"
},
{
"input": "XCJIa@jFaP.Eu28YaoT9Z.Epk.Z/4TBzLWf724zE1r",
"output": "YES"
},
{
"input": "Cz1U1xjg6iW0U@.97HoVA.YG.Qd.eI.DCXxtibi6HG.GV/0sN",
"output": "NO"
},
{
"input": "nrKbWV@P0irxQoRxDsNvG/69WxCwCsfB",
"output": "YES"
},
{
"input": "yI1nRv3FbuhgaI@.Y9vKe.8oc.BLi.6JfYT/tT5d36",
"output": "NO"
},
{
"input": "IGsma3L6YTJRrXS@1g.yR3mC.c.xoCns7Wo1.9C.Oe.5ebkR/_97Ltj3",
"output": "YES"
},
{
"input": "Uu538LDu9Bye@Gu0W0P5a.b9zA9nSaNhzB_TQ2.z/qfi5CZrH",
"output": "YES"
},
{
"input": "bdHl525me@XzR_iO23v.YFXbnHUybbgw.i/WVEhm",
"output": "YES"
},
{
"input": "NQsZ0K@eE8VMB.w2nYtKImB.4nUF",
"output": "YES"
},
{
"input": "186@E.MmBaKLj.WYpt4wPZkzv93",
"output": "YES"
},
{
"input": "hmhYxkGtWYRJFtBU@Drg3L7WKujE.lU61Ljqxv./FJ4X",
"output": "NO"
},
{
"input": "t1RIUz9l3FA15@tOL9.rv.NjhouD.",
"output": "NO"
},
{
"input": "_I4ytjyccT@q.WIc.Cqn",
"output": "YES"
},
{
"input": "LwHHRYq@whOoq.e9b6i0xnoWBl7z.SGJiJe/iUij1x7",
"output": "YES"
},
{
"input": "Yesx@9_KiJq2cBI6.",
"output": "NO"
},
{
"input": "Zu5VFUtSbIw@ner5e",
"output": "YES"
},
{
"input": "test@test.",
"output": "NO"
},
{
"input": "test@.test",
"output": "NO"
},
{
"input": "est.@test",
"output": "NO"
},
{
"input": "test@test.ru/",
"output": "NO"
},
{
"input": "asd@asd@",
"output": "NO"
},
{
"input": "@",
"output": "NO"
},
{
"input": "/",
"output": "NO"
},
{
"input": ".",
"output": "NO"
},
{
"input": "mike@",
"output": "NO"
},
{
"input": "@mike",
"output": "NO"
},
{
"input": "@mail.ru",
"output": "NO"
},
{
"input": "test.me",
"output": "NO"
},
{
"input": "$@ru",
"output": "NO"
},
{
"input": "testme@o.o.o.o.o/ooooo",
"output": "YES"
},
{
"input": "oooop/oooop",
"output": "NO"
},
{
"input": "mail.ru/a",
"output": "NO"
},
{
"input": "mike@mail.ru/aaa",
"output": "YES"
},
{
"input": "mike@mike.mike",
"output": "YES"
}
] | 1,685,024,636
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 819,200
|
import string
s = input()
valid = True
username = s[:s.index('@')]
valid &= len(username) <= 16
for letter in username:
valid &= (letter == '_' or letter.isdigit() or letter in string.ascii_letters)
rest = s[s.index('@') + 1:]
if '/' in rest:
l = rest.split('/')
host, resources = l[0], l[1:]
for resource in resources:
valid &= len(resource) <= 16 and (letter == '_' or letter.isdigit() or letter in string.ascii_letters)
else:
host = s[s.index('@') + 1:]
if '.' in host:
host = host.split('.')
valid &= len(host) == 2
for p in host:
valid &= len(p) <= 16
else: valid = False
|
Title: Jabber ID
Time Limit: 0 seconds
Memory Limit: 256 megabytes
Problem Description:
Jabber ID on the national Berland service «Babber» has a form <username>@<hostname>[/resource], where
- <username> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <username> is between 1 and 16, inclusive. - <hostname> — is a sequence of word separated by periods (characters «.»), where each word should contain only characters allowed for <username>, the length of each word is between 1 and 16, inclusive. The length of <hostname> is between 1 and 32, inclusive. - <resource> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <resource> is between 1 and 16, inclusive.
The content of square brackets is optional — it can be present or can be absent.
There are the samples of correct Jabber IDs: [[email protected]](/cdn-cgi/l/email-protection), [[email protected]](/cdn-cgi/l/email-protection)/contest.
Your task is to write program which checks if given string is a correct Jabber ID.
Input Specification:
The input contains of a single line. The line has the length between 1 and 100 characters, inclusive. Each characters has ASCII-code between 33 and 127, inclusive.
Output Specification:
Print YES or NO.
Demo Input:
['[email\xa0protected]\n', '[email\xa0protected]/contest.icpc/12\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
import string
s = input()
valid = True
username = s[:s.index('@')]
valid &= len(username) <= 16
for letter in username:
valid &= (letter == '_' or letter.isdigit() or letter in string.ascii_letters)
rest = s[s.index('@') + 1:]
if '/' in rest:
l = rest.split('/')
host, resources = l[0], l[1:]
for resource in resources:
valid &= len(resource) <= 16 and (letter == '_' or letter.isdigit() or letter in string.ascii_letters)
else:
host = s[s.index('@') + 1:]
if '.' in host:
host = host.split('.')
valid &= len(host) == 2
for p in host:
valid &= len(p) <= 16
else: valid = False
```
| 0
|
858
|
C
|
Did you mean...
|
PROGRAMMING
| 1,500
|
[
"dp",
"greedy",
"implementation"
] | null | null |
Beroffice text editor has a wide range of features that help working with text. One of the features is an automatic search for typos and suggestions of how to fix them.
Beroffice works only with small English letters (i.e. with 26 letters from a to z). Beroffice thinks that a word is typed with a typo if there are three or more consonants in a row in the word. The only exception is that if the block of consonants has all letters the same, then this block (even if its length is greater than three) is not considered a typo. Formally, a word is typed with a typo if there is a block of not less that three consonants in a row, and there are at least two different letters in this block.
For example:
- the following words have typos: "hellno", "hackcerrs" and "backtothefutttture"; - the following words don't have typos: "helllllooooo", "tobeornottobe" and "oooooo".
When Beroffice editor finds a word with a typo, it inserts as little as possible number of spaces in this word (dividing it into several words) in such a way that each of the resulting words is typed without any typos.
Implement this feature of Beroffice editor. Consider the following letters as the only vowels: 'a', 'e', 'i', 'o' and 'u'. All the other letters are consonants in this problem.
|
The only line contains a non-empty word consisting of small English letters. The length of the word is between 1 and 3000 letters.
|
Print the given word without any changes if there are no typos.
If there is at least one typo in the word, insert the minimum number of spaces into the word so that each of the resulting words doesn't have any typos. If there are multiple solutions, print any of them.
|
[
"hellno\n",
"abacaba\n",
"asdfasdf\n"
] |
[
"hell no \n",
"abacaba \n",
"asd fasd f \n"
] |
none
| 1,500
|
[
{
"input": "hellno",
"output": "hell no "
},
{
"input": "abacaba",
"output": "abacaba "
},
{
"input": "asdfasdf",
"output": "asd fasd f "
},
{
"input": "ooo",
"output": "ooo "
},
{
"input": "moyaoborona",
"output": "moyaoborona "
},
{
"input": "jxegxxx",
"output": "jxegx xx "
},
{
"input": "orfyaenanabckumulsboloyhljhacdgcmnooxvxrtuhcslxgslfpnfnyejbxqisxjyoyvcvuddboxkqgbogkfz",
"output": "orf yaenanabc kumuls boloyh lj hacd gc mnooxv xr tuhc sl xg sl fp nf nyejb xqisx jyoyv cvudd boxk qg bogk fz "
},
{
"input": "zxdgmhsjotvajkwshjpvzcuwehpeyfhakhtlvuoftkgdmvpafmxcliqvrztloocziqdkexhzcbdgxaoyvte",
"output": "zx dg mh sjotvajk ws hj pv zcuwehpeyf hakh tl vuoft kg dm vpafm xc liqv rz tloocziqd kexh zc bd gxaoyv te "
},
{
"input": "niblehmwtycadhbfuginpyafszjbucaszihijndzjtuyuaxkrovotshtsajmdcflnfdmahzbvpymiczqqleedpofcnvhieknlz",
"output": "niblehm wt ycadh bfuginp yafs zj bucaszihijn dz jtuyuaxk rovots ht sajm dc fl nf dmahz bv py micz qq leedpofc nv hiekn lz "
},
{
"input": "pqvtgtctpkgjgxnposjqedofficoyznxlerxyqypyzpoehejtjvyafjxjppywwgeakf",
"output": "pq vt gt ct pk gj gx nposj qedofficoyz nx lerx yq yp yz poehejt jv yafj xj pp yw wgeakf "
},
{
"input": "mvjajoyeg",
"output": "mv jajoyeg "
},
{
"input": "dipxocwjosvdaillxolmthjhzhsxskzqslebpixpuhpgeesrkedhohisdsjsrkiktbjzlhectrfcathvewzficirqbdvzq",
"output": "dipxocw josv daill xolm th jh zh sx sk zq slebpixpuhp geesr kedhohisd sj sr kikt bj zl hect rf cath vewz ficirq bd vz q "
},
{
"input": "ibbtvelwjirxqermucqrgmoauonisgmarjxxybllktccdykvef",
"output": "ibb tvelw jirx qermucq rg moauonisg marj xx yb ll kt cc dy kvef "
},
{
"input": "jxevkmrwlomaaahaubvjzqtyfqhqbhpqhomxqpiuersltohinvfyeykmlooujymldjqhgqjkvqknlyj",
"output": "jxevk mr wlomaaahaubv jz qt yf qh qb hp qhomx qpiuers ltohinv fyeyk mlooujy ml dj qh gq jk vq kn ly j "
},
{
"input": "hzxkuwqxonsulnndlhygvmallghjerwp",
"output": "hz xkuwq xonsuln nd lh yg vmall gh jerw p "
},
{
"input": "jbvcsjdyzlzmxwcvmixunfzxidzvwzaqqdhguvelwbdosbd",
"output": "jb vc sj dy zl zm xw cv mixunf zxidz vw zaqq dh guvelw bdosb d "
},
{
"input": "uyrsxaqmtibbxpfabprvnvbinjoxubupvfyjlqnfrfdeptipketwghr",
"output": "uyr sxaqm tibb xp fabp rv nv binjoxubupv fy jl qn fr fdeptipketw gh r "
},
{
"input": "xfcftysljytybkkzkpqdzralahgvbkxdtheqrhfxpecdjqofnyiahggnkiuusalu",
"output": "xf cf ty sl jy ty bk kz kp qd zralahg vb kx dt heqr hf xpecd jqofn yiahg gn kiuusalu "
},
{
"input": "a",
"output": "a "
},
{
"input": "b",
"output": "b "
},
{
"input": "aa",
"output": "aa "
},
{
"input": "ab",
"output": "ab "
},
{
"input": "ba",
"output": "ba "
},
{
"input": "bb",
"output": "bb "
},
{
"input": "aaa",
"output": "aaa "
},
{
"input": "aab",
"output": "aab "
},
{
"input": "aba",
"output": "aba "
},
{
"input": "abb",
"output": "abb "
},
{
"input": "baa",
"output": "baa "
},
{
"input": "bab",
"output": "bab "
},
{
"input": "bba",
"output": "bba "
},
{
"input": "bbb",
"output": "bbb "
},
{
"input": "bbc",
"output": "bb c "
},
{
"input": "bcb",
"output": "bc b "
},
{
"input": "cbb",
"output": "cb b "
},
{
"input": "bababcdfabbcabcdfacbbabcdfacacabcdfacbcabcdfaccbabcdfacaaabcdfabacabcdfabcbabcdfacbaabcdfabaaabcdfabbaabcdfacababcdfabbbabcdfabcaabcdfaaababcdfabccabcdfacccabcdfaacbabcdfaabaabcdfaabcabcdfaaacabcdfaccaabcdfaabbabcdfaaaaabcdfaacaabcdfaacc",
"output": "bababc dfabb cabc dfacb babc dfacacabc dfacb cabc dfacc babc dfacaaabc dfabacabc dfabc babc dfacbaabc dfabaaabc dfabbaabc dfacababc dfabbbabc dfabcaabc dfaaababc dfabc cabc dfacccabc dfaacbabc dfaabaabc dfaabcabc dfaaacabc dfaccaabc dfaabbabc dfaaaaabc dfaacaabc dfaacc "
},
{
"input": "bddabcdfaccdabcdfadddabcdfabbdabcdfacddabcdfacdbabcdfacbbabcdfacbcabcdfacbdabcdfadbbabcdfabdbabcdfabdcabcdfabbcabcdfabccabcdfabbbabcdfaddcabcdfaccbabcdfadbdabcdfacccabcdfadcdabcdfadcbabcdfabcbabcdfadbcabcdfacdcabcdfabcdabcdfadccabcdfaddb",
"output": "bd dabc dfacc dabc dfadddabc dfabb dabc dfacd dabc dfacd babc dfacb babc dfacb cabc dfacb dabc dfadb babc dfabd babc dfabd cabc dfabb cabc dfabc cabc dfabbbabc dfadd cabc dfacc babc dfadb dabc dfacccabc dfadc dabc dfadc babc dfabc babc dfadb cabc dfacd cabc dfabc dabc dfadc cabc dfadd b "
},
{
"input": "helllllooooo",
"output": "helllllooooo "
},
{
"input": "bbbzxxx",
"output": "bbb zx xx "
},
{
"input": "ffff",
"output": "ffff "
},
{
"input": "cdddddddddddddddddd",
"output": "cd ddddddddddddddddd "
},
{
"input": "bbbc",
"output": "bbb c "
},
{
"input": "lll",
"output": "lll "
},
{
"input": "bbbbb",
"output": "bbbbb "
},
{
"input": "llll",
"output": "llll "
},
{
"input": "bbbbbbccc",
"output": "bbbbbb ccc "
},
{
"input": "lllllb",
"output": "lllll b "
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz "
},
{
"input": "lllll",
"output": "lllll "
},
{
"input": "bbbbbbbbbc",
"output": "bbbbbbbbb c "
},
{
"input": "helllllno",
"output": "helllll no "
},
{
"input": "nnnnnnnnnnnn",
"output": "nnnnnnnnnnnn "
},
{
"input": "bbbbbccc",
"output": "bbbbb ccc "
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzz "
},
{
"input": "nnnnnnnnnnnnnnnnnn",
"output": "nnnnnnnnnnnnnnnnnn "
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzz",
"output": "zzzzzzzzzzzzzzzzzzzzzzz "
},
{
"input": "hhhh",
"output": "hhhh "
},
{
"input": "nnnnnnnnnnnnnnnnnnnnnnnnn",
"output": "nnnnnnnnnnnnnnnnnnnnnnnnn "
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz "
},
{
"input": "dddd",
"output": "dddd "
},
{
"input": "heffffffgggggghhhhhh",
"output": "heffffff gggggg hhhhhh "
},
{
"input": "bcddd",
"output": "bc ddd "
},
{
"input": "x",
"output": "x "
},
{
"input": "nnn",
"output": "nnn "
},
{
"input": "xxxxxxxx",
"output": "xxxxxxxx "
},
{
"input": "cclcc",
"output": "cc lc c "
},
{
"input": "tttttttttttttt",
"output": "tttttttttttttt "
},
{
"input": "xxxxxxx",
"output": "xxxxxxx "
},
{
"input": "ccccb",
"output": "cccc b "
},
{
"input": "bcecccc",
"output": "bcecccc "
},
{
"input": "jjja",
"output": "jjja "
},
{
"input": "zzz",
"output": "zzz "
},
{
"input": "xxxxxxxxxzzzzzzzzzzzz",
"output": "xxxxxxxxx zzzzzzzzzzzz "
},
{
"input": "alllewww",
"output": "alllewww "
},
{
"input": "bbbbbbbbb",
"output": "bbbbbbbbb "
},
{
"input": "jjj",
"output": "jjj "
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbb "
},
{
"input": "kkkkkkkkkklllllllllllllll",
"output": "kkkkkkkkkk lllllllllllllll "
},
{
"input": "helllllllllllo",
"output": "helllllllllllo "
},
{
"input": "ttttsttttt",
"output": "tttt st tttt "
},
{
"input": "tttttttsssssss",
"output": "ttttttt sssssss "
},
{
"input": "assstttttatsfatsfdjfdhtsjdsaatttssssststsss",
"output": "asss tttttats fats fd jf dh ts jd saattt sssss ts ts ss "
},
{
"input": "xxxxx",
"output": "xxxxx "
},
{
"input": "bbbhbbb",
"output": "bbb hb bb "
},
{
"input": "bbbbbbbb",
"output": "bbbbbbbb "
}
] | 1,643,407,079
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 108
| 46
| 2,150,400
|
def insert (source_str, insert_str, pos):
return source_str[:pos]+insert_str+source_str[pos:]
def isVowel(c):
vowels = ["a", "i", "o", "u", "e"]
if (c in vowels):
return True
return False
word = input()
newWord = word
conCount, cutCount = 0, 0
block = set()
isTypo = False
for i in range(len(word)):
letter = word[i]
if (isVowel(letter)):
conCount = 0
block.clear()
else:
conCount += 1
block.add(letter)
if (len(block) > 1 and conCount >= 3):
isTypo = True
newWord = insert(newWord, " ", i + cutCount)
cutCount += 1
conCount = 1
block.clear()
block.add(letter)
if (isTypo):
print(newWord)
else:
print(word)
|
Title: Did you mean...
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Beroffice text editor has a wide range of features that help working with text. One of the features is an automatic search for typos and suggestions of how to fix them.
Beroffice works only with small English letters (i.e. with 26 letters from a to z). Beroffice thinks that a word is typed with a typo if there are three or more consonants in a row in the word. The only exception is that if the block of consonants has all letters the same, then this block (even if its length is greater than three) is not considered a typo. Formally, a word is typed with a typo if there is a block of not less that three consonants in a row, and there are at least two different letters in this block.
For example:
- the following words have typos: "hellno", "hackcerrs" and "backtothefutttture"; - the following words don't have typos: "helllllooooo", "tobeornottobe" and "oooooo".
When Beroffice editor finds a word with a typo, it inserts as little as possible number of spaces in this word (dividing it into several words) in such a way that each of the resulting words is typed without any typos.
Implement this feature of Beroffice editor. Consider the following letters as the only vowels: 'a', 'e', 'i', 'o' and 'u'. All the other letters are consonants in this problem.
Input Specification:
The only line contains a non-empty word consisting of small English letters. The length of the word is between 1 and 3000 letters.
Output Specification:
Print the given word without any changes if there are no typos.
If there is at least one typo in the word, insert the minimum number of spaces into the word so that each of the resulting words doesn't have any typos. If there are multiple solutions, print any of them.
Demo Input:
['hellno\n', 'abacaba\n', 'asdfasdf\n']
Demo Output:
['hell no \n', 'abacaba \n', 'asd fasd f \n']
Note:
none
|
```python
def insert (source_str, insert_str, pos):
return source_str[:pos]+insert_str+source_str[pos:]
def isVowel(c):
vowels = ["a", "i", "o", "u", "e"]
if (c in vowels):
return True
return False
word = input()
newWord = word
conCount, cutCount = 0, 0
block = set()
isTypo = False
for i in range(len(word)):
letter = word[i]
if (isVowel(letter)):
conCount = 0
block.clear()
else:
conCount += 1
block.add(letter)
if (len(block) > 1 and conCount >= 3):
isTypo = True
newWord = insert(newWord, " ", i + cutCount)
cutCount += 1
conCount = 1
block.clear()
block.add(letter)
if (isTypo):
print(newWord)
else:
print(word)
```
| 3
|
|
611
|
B
|
New Year and Old Property
|
PROGRAMMING
| 1,300
|
[
"bitmasks",
"brute force",
"implementation"
] | null | null |
The year 2015 is almost over.
Limak is a little polar bear. He has recently learnt about the binary system. He noticed that the passing year has exactly one zero in its representation in the binary system — 201510<==<=111110111112. Note that he doesn't care about the number of zeros in the decimal representation.
Limak chose some interval of years. He is going to count all years from this interval that have exactly one zero in the binary representation. Can you do it faster?
Assume that all positive integers are always written without leading zeros.
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=1018) — the first year and the last year in Limak's interval respectively.
|
Print one integer – the number of years Limak will count in his chosen interval.
|
[
"5 10\n",
"2015 2015\n",
"100 105\n",
"72057594000000000 72057595000000000\n"
] |
[
"2\n",
"1\n",
"0\n",
"26\n"
] |
In the first sample Limak's interval contains numbers 5<sub class="lower-index">10</sub> = 101<sub class="lower-index">2</sub>, 6<sub class="lower-index">10</sub> = 110<sub class="lower-index">2</sub>, 7<sub class="lower-index">10</sub> = 111<sub class="lower-index">2</sub>, 8<sub class="lower-index">10</sub> = 1000<sub class="lower-index">2</sub>, 9<sub class="lower-index">10</sub> = 1001<sub class="lower-index">2</sub> and 10<sub class="lower-index">10</sub> = 1010<sub class="lower-index">2</sub>. Two of them (101<sub class="lower-index">2</sub> and 110<sub class="lower-index">2</sub>) have the described property.
| 750
|
[
{
"input": "5 10",
"output": "2"
},
{
"input": "2015 2015",
"output": "1"
},
{
"input": "100 105",
"output": "0"
},
{
"input": "72057594000000000 72057595000000000",
"output": "26"
},
{
"input": "1 100",
"output": "16"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "0"
},
{
"input": "1 1000000000000000000",
"output": "1712"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 7",
"output": "3"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "1"
},
{
"input": "2 4",
"output": "1"
},
{
"input": "2 5",
"output": "2"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "3"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "3 4",
"output": "0"
},
{
"input": "3 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "2"
},
{
"input": "4 4",
"output": "0"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "2"
},
{
"input": "5 7",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "7 7",
"output": "0"
},
{
"input": "1 8",
"output": "3"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "7 8",
"output": "0"
},
{
"input": "8 8",
"output": "0"
},
{
"input": "1 1022",
"output": "45"
},
{
"input": "1 1023",
"output": "45"
},
{
"input": "1 1024",
"output": "45"
},
{
"input": "1 1025",
"output": "45"
},
{
"input": "1 1026",
"output": "45"
},
{
"input": "509 1022",
"output": "11"
},
{
"input": "510 1022",
"output": "10"
},
{
"input": "511 1022",
"output": "9"
},
{
"input": "512 1022",
"output": "9"
},
{
"input": "513 1022",
"output": "9"
},
{
"input": "509 1023",
"output": "11"
},
{
"input": "510 1023",
"output": "10"
},
{
"input": "511 1023",
"output": "9"
},
{
"input": "512 1023",
"output": "9"
},
{
"input": "513 1023",
"output": "9"
},
{
"input": "509 1024",
"output": "11"
},
{
"input": "510 1024",
"output": "10"
},
{
"input": "511 1024",
"output": "9"
},
{
"input": "512 1024",
"output": "9"
},
{
"input": "513 1024",
"output": "9"
},
{
"input": "509 1025",
"output": "11"
},
{
"input": "510 1025",
"output": "10"
},
{
"input": "511 1025",
"output": "9"
},
{
"input": "512 1025",
"output": "9"
},
{
"input": "513 1025",
"output": "9"
},
{
"input": "1 1000000000",
"output": "408"
},
{
"input": "10000000000 70000000000000000",
"output": "961"
},
{
"input": "1 935829385028502935",
"output": "1712"
},
{
"input": "500000000000000000 1000000000000000000",
"output": "58"
},
{
"input": "500000000000000000 576460752303423488",
"output": "57"
},
{
"input": "576460752303423488 1000000000000000000",
"output": "1"
},
{
"input": "999999999999999999 1000000000000000000",
"output": "0"
},
{
"input": "1124800395214847 36011204832919551",
"output": "257"
},
{
"input": "1124800395214847 36011204832919550",
"output": "256"
},
{
"input": "1124800395214847 36011204832919552",
"output": "257"
},
{
"input": "1124800395214846 36011204832919551",
"output": "257"
},
{
"input": "1124800395214848 36011204832919551",
"output": "256"
},
{
"input": "1 287104476244869119",
"output": "1603"
},
{
"input": "1 287104476244869118",
"output": "1602"
},
{
"input": "1 287104476244869120",
"output": "1603"
},
{
"input": "492581209243647 1000000000000000000",
"output": "583"
},
{
"input": "492581209243646 1000000000000000000",
"output": "583"
},
{
"input": "492581209243648 1000000000000000000",
"output": "582"
},
{
"input": "1099444518911 1099444518911",
"output": "1"
},
{
"input": "1099444518910 1099444518911",
"output": "1"
},
{
"input": "1099444518911 1099444518912",
"output": "1"
},
{
"input": "1099444518910 1099444518912",
"output": "1"
},
{
"input": "864691128455135231 864691128455135231",
"output": "1"
},
{
"input": "864691128455135231 864691128455135232",
"output": "1"
},
{
"input": "864691128455135230 864691128455135232",
"output": "1"
},
{
"input": "864691128455135230 864691128455135231",
"output": "1"
},
{
"input": "864691128455135231 1000000000000000000",
"output": "1"
},
{
"input": "864691128455135232 1000000000000000000",
"output": "0"
},
{
"input": "864691128455135230 1000000000000000000",
"output": "1"
},
{
"input": "576460752303423487 576460752303423487",
"output": "0"
},
{
"input": "1 576460752303423487",
"output": "1711"
},
{
"input": "1 576460752303423486",
"output": "1711"
},
{
"input": "2 1000000000000000000",
"output": "1712"
},
{
"input": "3 1000000000000000000",
"output": "1711"
},
{
"input": "4 1000000000000000000",
"output": "1711"
},
{
"input": "5 1000000000000000000",
"output": "1711"
},
{
"input": "6 1000000000000000000",
"output": "1710"
},
{
"input": "5 6",
"output": "2"
},
{
"input": "1 2",
"output": "1"
}
] | 1,451,821,664
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 103
| 140
| 0
|
def tobin(s):
res = 0
l = len(s)
#print(s)
#print(l)
for i in range(l):
res += int(s[-i-1]) * 2 ** i
return res
n, m = tuple(map(int, input().split()))
lis = []
for i in range(1, 61):
for j in range(i):
lis.append(tobin('1' + '1' * j + '0' + '1' * (i - j - 1)))
i = 0
while n > lis[i]:
i += 1
j = 0
while m >= lis[j]:
j += 1
print(j - i)
|
Title: New Year and Old Property
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The year 2015 is almost over.
Limak is a little polar bear. He has recently learnt about the binary system. He noticed that the passing year has exactly one zero in its representation in the binary system — 201510<==<=111110111112. Note that he doesn't care about the number of zeros in the decimal representation.
Limak chose some interval of years. He is going to count all years from this interval that have exactly one zero in the binary representation. Can you do it faster?
Assume that all positive integers are always written without leading zeros.
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=1018) — the first year and the last year in Limak's interval respectively.
Output Specification:
Print one integer – the number of years Limak will count in his chosen interval.
Demo Input:
['5 10\n', '2015 2015\n', '100 105\n', '72057594000000000 72057595000000000\n']
Demo Output:
['2\n', '1\n', '0\n', '26\n']
Note:
In the first sample Limak's interval contains numbers 5<sub class="lower-index">10</sub> = 101<sub class="lower-index">2</sub>, 6<sub class="lower-index">10</sub> = 110<sub class="lower-index">2</sub>, 7<sub class="lower-index">10</sub> = 111<sub class="lower-index">2</sub>, 8<sub class="lower-index">10</sub> = 1000<sub class="lower-index">2</sub>, 9<sub class="lower-index">10</sub> = 1001<sub class="lower-index">2</sub> and 10<sub class="lower-index">10</sub> = 1010<sub class="lower-index">2</sub>. Two of them (101<sub class="lower-index">2</sub> and 110<sub class="lower-index">2</sub>) have the described property.
|
```python
def tobin(s):
res = 0
l = len(s)
#print(s)
#print(l)
for i in range(l):
res += int(s[-i-1]) * 2 ** i
return res
n, m = tuple(map(int, input().split()))
lis = []
for i in range(1, 61):
for j in range(i):
lis.append(tobin('1' + '1' * j + '0' + '1' * (i - j - 1)))
i = 0
while n > lis[i]:
i += 1
j = 0
while m >= lis[j]:
j += 1
print(j - i)
```
| 3
|
|
228
|
A
|
Is your horseshoe on the other hoof?
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
|
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers.
|
Print a single integer — the minimum number of horseshoes Valera needs to buy.
|
[
"1 7 3 3\n",
"7 7 7 7\n"
] |
[
"1\n",
"3\n"
] |
none
| 500
|
[
{
"input": "1 7 3 3",
"output": "1"
},
{
"input": "7 7 7 7",
"output": "3"
},
{
"input": "81170865 673572653 756938629 995577259",
"output": "0"
},
{
"input": "3491663 217797045 522540872 715355328",
"output": "0"
},
{
"input": "251590420 586975278 916631563 586975278",
"output": "1"
},
{
"input": "259504825 377489979 588153796 377489979",
"output": "1"
},
{
"input": "652588203 931100304 931100304 652588203",
"output": "2"
},
{
"input": "391958720 651507265 391958720 651507265",
"output": "2"
},
{
"input": "90793237 90793237 90793237 90793237",
"output": "3"
},
{
"input": "551651653 551651653 551651653 551651653",
"output": "3"
},
{
"input": "156630260 609654355 668943582 973622757",
"output": "0"
},
{
"input": "17061017 110313588 434481173 796661222",
"output": "0"
},
{
"input": "24975422 256716298 337790533 690960249",
"output": "0"
},
{
"input": "255635360 732742923 798648949 883146723",
"output": "0"
},
{
"input": "133315691 265159773 734556507 265159773",
"output": "1"
},
{
"input": "28442865 741657755 978106882 978106882",
"output": "1"
},
{
"input": "131245479 174845575 497483467 131245479",
"output": "1"
},
{
"input": "139159884 616215581 958341883 616215581",
"output": "1"
},
{
"input": "147784432 947653080 947653080 947653080",
"output": "2"
},
{
"input": "94055790 756126496 756126496 94055790",
"output": "2"
},
{
"input": "240458500 511952208 240458500 511952208",
"output": "2"
},
{
"input": "681828506 972810624 972810624 681828506",
"output": "2"
},
{
"input": "454961014 454961014 454961014 454961014",
"output": "3"
},
{
"input": "915819430 915819430 915819430 915819430",
"output": "3"
},
{
"input": "671645142 671645142 671645142 671645142",
"output": "3"
},
{
"input": "132503558 132503558 132503558 132503558",
"output": "3"
},
{
"input": "5 5 999999 6",
"output": "1"
},
{
"input": "1 1 2 5",
"output": "1"
},
{
"input": "2 1 2 3",
"output": "1"
},
{
"input": "1 1 3 5",
"output": "1"
},
{
"input": "1 1 3 3",
"output": "2"
},
{
"input": "2 2 2 1",
"output": "2"
},
{
"input": "3 1 1 1",
"output": "2"
},
{
"input": "1 2 2 2",
"output": "2"
}
] | 1,686,948,685
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 92
| 0
|
single_count = len({*input().split(' ')})
print(4-single_count)
|
Title: Is your horseshoe on the other hoof?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera the Horse is going to the party with friends. He has been following the fashion trends for a while, and he knows that it is very popular to wear all horseshoes of different color. Valera has got four horseshoes left from the last year, but maybe some of them have the same color. In this case he needs to go to the store and buy some few more horseshoes, not to lose face in front of his stylish comrades.
Fortunately, the store sells horseshoes of all colors under the sun and Valera has enough money to buy any four of them. However, in order to save the money, he would like to spend as little money as possible, so you need to help Valera and determine what is the minimum number of horseshoes he needs to buy to wear four horseshoes of different colors to a party.
Input Specification:
The first line contains four space-separated integers *s*1,<=*s*2,<=*s*3,<=*s*4 (1<=≤<=*s*1,<=*s*2,<=*s*3,<=*s*4<=≤<=109) — the colors of horseshoes Valera has.
Consider all possible colors indexed with integers.
Output Specification:
Print a single integer — the minimum number of horseshoes Valera needs to buy.
Demo Input:
['1 7 3 3\n', '7 7 7 7\n']
Demo Output:
['1\n', '3\n']
Note:
none
|
```python
single_count = len({*input().split(' ')})
print(4-single_count)
```
| 3
|
|
1,005
|
D
|
Polycarp and Div 3
|
PROGRAMMING
| 1,500
|
[
"dp",
"greedy",
"number theory"
] | null | null |
Polycarp likes numbers that are divisible by 3.
He has a huge number $s$. Polycarp wants to cut from it the maximum number of numbers that are divisible by $3$. To do this, he makes an arbitrary number of vertical cuts between pairs of adjacent digits. As a result, after $m$ such cuts, there will be $m+1$ parts in total. Polycarp analyzes each of the obtained numbers and finds the number of those that are divisible by $3$.
For example, if the original number is $s=3121$, then Polycarp can cut it into three parts with two cuts: $3|1|21$. As a result, he will get two numbers that are divisible by $3$.
Polycarp can make an arbitrary number of vertical cuts, where each cut is made between a pair of adjacent digits. The resulting numbers cannot contain extra leading zeroes (that is, the number can begin with 0 if and only if this number is exactly one character '0'). For example, 007, 01 and 00099 are not valid numbers, but 90, 0 and 10001 are valid.
What is the maximum number of numbers divisible by $3$ that Polycarp can obtain?
|
The first line of the input contains a positive integer $s$. The number of digits of the number $s$ is between $1$ and $2\cdot10^5$, inclusive. The first (leftmost) digit is not equal to 0.
|
Print the maximum number of numbers divisible by $3$ that Polycarp can get by making vertical cuts in the given number $s$.
|
[
"3121\n",
"6\n",
"1000000000000000000000000000000000\n",
"201920181\n"
] |
[
"2\n",
"1\n",
"33\n",
"4\n"
] |
In the first example, an example set of optimal cuts on the number is 3|1|21.
In the second example, you do not need to make any cuts. The specified number 6 forms one number that is divisible by $3$.
In the third example, cuts must be made between each pair of digits. As a result, Polycarp gets one digit 1 and $33$ digits 0. Each of the $33$ digits 0 forms a number that is divisible by $3$.
In the fourth example, an example set of optimal cuts is 2|0|1|9|201|81. The numbers $0$, $9$, $201$ and $81$ are divisible by $3$.
| 0
|
[
{
"input": "3121",
"output": "2"
},
{
"input": "6",
"output": "1"
},
{
"input": "1000000000000000000000000000000000",
"output": "33"
},
{
"input": "201920181",
"output": "4"
},
{
"input": "4",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "31",
"output": "1"
},
{
"input": "14139582796",
"output": "6"
},
{
"input": "1670000",
"output": "5"
},
{
"input": "604500",
"output": "5"
},
{
"input": "40041",
"output": "2"
},
{
"input": "10000170",
"output": "5"
}
] | 1,638,995,584
| 2,147,483,647
|
PyPy 3-64
|
MEMORY_LIMIT_EXCEEDED
|
TESTS
| 10
| 1,497
| 268,390,400
|
from functools import lru_cache
S = tuple(map(int, list(input())))
@lru_cache(maxsize = None)
def f(s):
if len(s) == 1:
return (s[0] % 3) == 0
if len(s) == 0:
return 0
a = ((s[0] % 3) == 0) + f(s[1:len(s)])
if len(s) >= 2:
b = (((s[0] + s[1]) % 3) == 0) + f(s[2:len(s)])
else:
b = -1
if len(s) >= 3:
c = (((s[0] + s[1] + s[2]) % 3) == 0) + f(s[3:len(s)])
else:
c = -1
return max(a, b, c)
print(int(f(S)))
|
Title: Polycarp and Div 3
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp likes numbers that are divisible by 3.
He has a huge number $s$. Polycarp wants to cut from it the maximum number of numbers that are divisible by $3$. To do this, he makes an arbitrary number of vertical cuts between pairs of adjacent digits. As a result, after $m$ such cuts, there will be $m+1$ parts in total. Polycarp analyzes each of the obtained numbers and finds the number of those that are divisible by $3$.
For example, if the original number is $s=3121$, then Polycarp can cut it into three parts with two cuts: $3|1|21$. As a result, he will get two numbers that are divisible by $3$.
Polycarp can make an arbitrary number of vertical cuts, where each cut is made between a pair of adjacent digits. The resulting numbers cannot contain extra leading zeroes (that is, the number can begin with 0 if and only if this number is exactly one character '0'). For example, 007, 01 and 00099 are not valid numbers, but 90, 0 and 10001 are valid.
What is the maximum number of numbers divisible by $3$ that Polycarp can obtain?
Input Specification:
The first line of the input contains a positive integer $s$. The number of digits of the number $s$ is between $1$ and $2\cdot10^5$, inclusive. The first (leftmost) digit is not equal to 0.
Output Specification:
Print the maximum number of numbers divisible by $3$ that Polycarp can get by making vertical cuts in the given number $s$.
Demo Input:
['3121\n', '6\n', '1000000000000000000000000000000000\n', '201920181\n']
Demo Output:
['2\n', '1\n', '33\n', '4\n']
Note:
In the first example, an example set of optimal cuts on the number is 3|1|21.
In the second example, you do not need to make any cuts. The specified number 6 forms one number that is divisible by $3$.
In the third example, cuts must be made between each pair of digits. As a result, Polycarp gets one digit 1 and $33$ digits 0. Each of the $33$ digits 0 forms a number that is divisible by $3$.
In the fourth example, an example set of optimal cuts is 2|0|1|9|201|81. The numbers $0$, $9$, $201$ and $81$ are divisible by $3$.
|
```python
from functools import lru_cache
S = tuple(map(int, list(input())))
@lru_cache(maxsize = None)
def f(s):
if len(s) == 1:
return (s[0] % 3) == 0
if len(s) == 0:
return 0
a = ((s[0] % 3) == 0) + f(s[1:len(s)])
if len(s) >= 2:
b = (((s[0] + s[1]) % 3) == 0) + f(s[2:len(s)])
else:
b = -1
if len(s) >= 3:
c = (((s[0] + s[1] + s[2]) % 3) == 0) + f(s[3:len(s)])
else:
c = -1
return max(a, b, c)
print(int(f(S)))
```
| 0
|
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
|
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,697,642,163
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 52
| 124
| 0
|
n = int(input())
cookies = [int(i) for i in input().split()]
total = 0
odds = 0
for cookie in cookies :
if cookie&1 :
odds += 1
total += cookie
evens = n - odds
if total & 1 :
print(odds)
else :
print(evens)
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
n = int(input())
cookies = [int(i) for i in input().split()]
total = 0
odds = 0
for cookie in cookies :
if cookie&1 :
odds += 1
total += cookie
evens = n - odds
if total & 1 :
print(odds)
else :
print(evens)
```
| 3
|
|
985
|
D
|
Sand Fortress
|
PROGRAMMING
| 2,100
|
[
"binary search",
"constructive algorithms",
"math"
] | null | null |
You are going to the beach with the idea to build the greatest sand castle ever in your head! The beach is not as three-dimensional as you could have imagined, it can be decribed as a line of spots to pile up sand pillars. Spots are numbered 1 through infinity from left to right.
Obviously, there is not enough sand on the beach, so you brought *n* packs of sand with you. Let height *h**i* of the sand pillar on some spot *i* be the number of sand packs you spent on it. You can't split a sand pack to multiple pillars, all the sand from it should go to a single one. There is a fence of height equal to the height of pillar with *H* sand packs to the left of the first spot and you should prevent sand from going over it.
Finally you ended up with the following conditions to building the castle:
- *h*1<=≤<=*H*: no sand from the leftmost spot should go over the fence; - For any |*h**i*<=-<=*h**i*<=+<=1|<=≤<=1: large difference in heights of two neighboring pillars can lead sand to fall down from the higher one to the lower, you really don't want this to happen; - : you want to spend all the sand you brought with you.
As you have infinite spots to build, it is always possible to come up with some valid castle structure. Though you want the castle to be as compact as possible.
Your task is to calculate the minimum number of spots you can occupy so that all the aforementioned conditions hold.
|
The only line contains two integer numbers *n* and *H* (1<=≤<=*n*,<=*H*<=≤<=1018) — the number of sand packs you have and the height of the fence, respectively.
|
Print the minimum number of spots you can occupy so the all the castle building conditions hold.
|
[
"5 2\n",
"6 8\n"
] |
[
"3\n",
"3\n"
] |
Here are the heights of some valid castles:
- *n* = 5, *H* = 2, [2, 2, 1, 0, ...], [2, 1, 1, 1, 0, ...], [1, 0, 1, 2, 1, 0, ...] - *n* = 6, *H* = 8, [3, 2, 1, 0, ...], [2, 2, 1, 1, 0, ...], [0, 1, 0, 1, 2, 1, 1, 0...] (this one has 5 spots occupied)
The first list for both cases is the optimal answer, 3 spots are occupied in them.
And here are some invalid ones:
- *n* = 5, *H* = 2, [3, 2, 0, ...], [2, 3, 0, ...], [1, 0, 2, 2, ...] - *n* = 6, *H* = 8, [2, 2, 2, 0, ...], [6, 0, ...], [1, 4, 1, 0...], [2, 2, 1, 0, ...]
| 0
|
[
{
"input": "5 2",
"output": "3"
},
{
"input": "6 8",
"output": "3"
},
{
"input": "20 4",
"output": "7"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "1414213562"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 1000000000000000000",
"output": "1"
},
{
"input": "1000000000000000000 1",
"output": "1999999999"
},
{
"input": "1036191544337895 45523434",
"output": "45523434"
},
{
"input": "1036191544337896 45523434",
"output": "45523435"
},
{
"input": "1036191544337895 45523433",
"output": "45523435"
},
{
"input": "1036191544337895 1",
"output": "64379858"
},
{
"input": "1036191544337895 1000000000000000000",
"output": "45523434"
},
{
"input": "30 3",
"output": "9"
},
{
"input": "30 4",
"output": "8"
},
{
"input": "6 100",
"output": "3"
},
{
"input": "7 100",
"output": "4"
},
{
"input": "1000000000000000000 99999999999",
"output": "1414213562"
},
{
"input": "999999997351043581 1000000000000000000",
"output": "1414213561"
},
{
"input": "911343366122896086 1416605974",
"output": "1350069158"
},
{
"input": "828974163639871882 2010864527",
"output": "1287613423"
},
{
"input": "696616491401388220 958775125",
"output": "1191798158"
},
{
"input": "999999999000000000 1",
"output": "1999999998"
},
{
"input": "961245465290770608 1687994843",
"output": "1386539192"
},
{
"input": "692106376966414549 974053139",
"output": "1186035874"
},
{
"input": "12 1",
"output": "6"
},
{
"input": "806680349368385877 1068656310",
"output": "1278847474"
}
] | 1,526,921,021
| 7,121
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 78
| 0
|
n,H = map(int,input().strip().split())
lower = 1
upper = H
k = 0
ans = 1e19
while lower<=upper:
mid = int((lower+upper)/2)
j = (mid*(mid+1))/2
if j<=n:
N = n
k = max(k,mid)
temp = mid
N -= (mid*(mid+1))/2
temp += int(N/mid)
N %= mid
if N!=0:
temp+=1
ans = min(ans,temp)
lower = mid+1
else:
upper = mid-1
print(ans)
|
Title: Sand Fortress
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are going to the beach with the idea to build the greatest sand castle ever in your head! The beach is not as three-dimensional as you could have imagined, it can be decribed as a line of spots to pile up sand pillars. Spots are numbered 1 through infinity from left to right.
Obviously, there is not enough sand on the beach, so you brought *n* packs of sand with you. Let height *h**i* of the sand pillar on some spot *i* be the number of sand packs you spent on it. You can't split a sand pack to multiple pillars, all the sand from it should go to a single one. There is a fence of height equal to the height of pillar with *H* sand packs to the left of the first spot and you should prevent sand from going over it.
Finally you ended up with the following conditions to building the castle:
- *h*1<=≤<=*H*: no sand from the leftmost spot should go over the fence; - For any |*h**i*<=-<=*h**i*<=+<=1|<=≤<=1: large difference in heights of two neighboring pillars can lead sand to fall down from the higher one to the lower, you really don't want this to happen; - : you want to spend all the sand you brought with you.
As you have infinite spots to build, it is always possible to come up with some valid castle structure. Though you want the castle to be as compact as possible.
Your task is to calculate the minimum number of spots you can occupy so that all the aforementioned conditions hold.
Input Specification:
The only line contains two integer numbers *n* and *H* (1<=≤<=*n*,<=*H*<=≤<=1018) — the number of sand packs you have and the height of the fence, respectively.
Output Specification:
Print the minimum number of spots you can occupy so the all the castle building conditions hold.
Demo Input:
['5 2\n', '6 8\n']
Demo Output:
['3\n', '3\n']
Note:
Here are the heights of some valid castles:
- *n* = 5, *H* = 2, [2, 2, 1, 0, ...], [2, 1, 1, 1, 0, ...], [1, 0, 1, 2, 1, 0, ...] - *n* = 6, *H* = 8, [3, 2, 1, 0, ...], [2, 2, 1, 1, 0, ...], [0, 1, 0, 1, 2, 1, 1, 0...] (this one has 5 spots occupied)
The first list for both cases is the optimal answer, 3 spots are occupied in them.
And here are some invalid ones:
- *n* = 5, *H* = 2, [3, 2, 0, ...], [2, 3, 0, ...], [1, 0, 2, 2, ...] - *n* = 6, *H* = 8, [2, 2, 2, 0, ...], [6, 0, ...], [1, 4, 1, 0...], [2, 2, 1, 0, ...]
|
```python
n,H = map(int,input().strip().split())
lower = 1
upper = H
k = 0
ans = 1e19
while lower<=upper:
mid = int((lower+upper)/2)
j = (mid*(mid+1))/2
if j<=n:
N = n
k = max(k,mid)
temp = mid
N -= (mid*(mid+1))/2
temp += int(N/mid)
N %= mid
if N!=0:
temp+=1
ans = min(ans,temp)
lower = mid+1
else:
upper = mid-1
print(ans)
```
| 0
|
|
378
|
A
|
Playing with Dice
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
|
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
|
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
|
[
"2 5\n",
"2 4\n"
] |
[
"3 0 3\n",
"2 1 3\n"
] |
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
| 500
|
[
{
"input": "2 5",
"output": "3 0 3"
},
{
"input": "2 4",
"output": "2 1 3"
},
{
"input": "5 3",
"output": "2 1 3"
},
{
"input": "1 6",
"output": "3 0 3"
},
{
"input": "5 1",
"output": "3 1 2"
},
{
"input": "6 3",
"output": "2 0 4"
},
{
"input": "2 3",
"output": "2 0 4"
},
{
"input": "5 6",
"output": "5 0 1"
},
{
"input": "4 4",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
},
{
"input": "6 4",
"output": "1 1 4"
},
{
"input": "1 4",
"output": "2 0 4"
},
{
"input": "5 5",
"output": "0 6 0"
},
{
"input": "4 5",
"output": "4 0 2"
},
{
"input": "4 3",
"output": "3 0 3"
},
{
"input": "1 5",
"output": "2 1 3"
},
{
"input": "6 5",
"output": "1 0 5"
},
{
"input": "2 2",
"output": "0 6 0"
},
{
"input": "1 3",
"output": "1 1 4"
},
{
"input": "3 6",
"output": "4 0 2"
},
{
"input": "3 1",
"output": "4 1 1"
},
{
"input": "3 2",
"output": "4 0 2"
},
{
"input": "3 5",
"output": "3 1 2"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "6 2",
"output": "2 1 3"
},
{
"input": "4 1",
"output": "4 0 2"
},
{
"input": "5 2",
"output": "3 0 3"
},
{
"input": "4 2",
"output": "3 1 2"
},
{
"input": "2 1",
"output": "5 0 1"
},
{
"input": "6 1",
"output": "3 0 3"
},
{
"input": "4 6",
"output": "4 1 1"
},
{
"input": "2 6",
"output": "3 1 2"
},
{
"input": "3 4",
"output": "3 0 3"
},
{
"input": "1 2",
"output": "1 0 5"
},
{
"input": "6 6",
"output": "0 6 0"
},
{
"input": "5 4",
"output": "2 0 4"
},
{
"input": "3 3",
"output": "0 6 0"
},
{
"input": "1 1",
"output": "0 6 0"
}
] | 1,567,808,257
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 109
| 0
|
def probWin(a, b):
# Number of way to throw dice the first win where
# 6 ways to throw a dice, d. First win when |a - d| < |b - d|
# d - b < a -d < b - d -> 2d < a - b < 0
# a
all_possibility = 6
a_win_chance = 0
b_win_chance = 0
draw_chance = 0
for i in range(1, 7):
if abs(a - i) == abs(b - i):
draw_chance += 1
if abs(a - i) < abs(b - i):
a_win_chance += 1
if abs(a - i) > abs(b - i):
b_win_chance += 1
return(a_win_chance, draw_chance, b_win_chance)
|
Title: Playing with Dice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players are playing a game. First each of them writes an integer from 1 to 6, and then a dice is thrown. The player whose written number got closer to the number on the dice wins. If both payers have the same difference, it's a draw.
The first player wrote number *a*, the second player wrote number *b*. How many ways to throw a dice are there, at which the first player wins, or there is a draw, or the second player wins?
Input Specification:
The single line contains two integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=6) — the numbers written on the paper by the first and second player, correspondingly.
Output Specification:
Print three integers: the number of ways to throw the dice at which the first player wins, the game ends with a draw or the second player wins, correspondingly.
Demo Input:
['2 5\n', '2 4\n']
Demo Output:
['3 0 3\n', '2 1 3\n']
Note:
The dice is a standard cube-shaped six-sided object with each side containing a number from 1 to 6, and where all numbers on all sides are distinct.
You can assume that number *a* is closer to number *x* than number *b*, if |*a* - *x*| < |*b* - *x*|.
|
```python
def probWin(a, b):
# Number of way to throw dice the first win where
# 6 ways to throw a dice, d. First win when |a - d| < |b - d|
# d - b < a -d < b - d -> 2d < a - b < 0
# a
all_possibility = 6
a_win_chance = 0
b_win_chance = 0
draw_chance = 0
for i in range(1, 7):
if abs(a - i) == abs(b - i):
draw_chance += 1
if abs(a - i) < abs(b - i):
a_win_chance += 1
if abs(a - i) > abs(b - i):
b_win_chance += 1
return(a_win_chance, draw_chance, b_win_chance)
```
| 0
|
|
629
|
A
|
Far Relative’s Birthday Cake
|
PROGRAMMING
| 800
|
[
"brute force",
"combinatorics",
"constructive algorithms",
"implementation"
] | null | null |
Door's family is going celebrate Famil Doors's birthday party. They love Famil Door so they are planning to make his birthday cake weird!
The cake is a *n*<=×<=*n* square consisting of equal squares with side length 1. Each square is either empty or consists of a single chocolate. They bought the cake and randomly started to put the chocolates on the cake. The value of Famil Door's happiness will be equal to the number of pairs of cells with chocolates that are in the same row or in the same column of the cake. Famil Doors's family is wondering what is the amount of happiness of Famil going to be?
Please, note that any pair can be counted no more than once, as two different cells can't share both the same row and the same column.
|
In the first line of the input, you are given a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the side of the cake.
Then follow *n* lines, each containing *n* characters. Empty cells are denoted with '.', while cells that contain chocolates are denoted by 'C'.
|
Print the value of Famil Door's happiness, i.e. the number of pairs of chocolate pieces that share the same row or the same column.
|
[
"3\n.CC\nC..\nC.C\n",
"4\nCC..\nC..C\n.CC.\n.CC.\n"
] |
[
"4\n",
"9\n"
] |
If we number rows from top to bottom and columns from left to right, then, pieces that share the same row in the first sample are:
1. (1, 2) and (1, 3) 1. (3, 1) and (3, 3) 1. (2, 1) and (3, 1) 1. (1, 3) and (3, 3)
| 500
|
[
{
"input": "3\n.CC\nC..\nC.C",
"output": "4"
},
{
"input": "4\nCC..\nC..C\n.CC.\n.CC.",
"output": "9"
},
{
"input": "5\n.CCCC\nCCCCC\n.CCC.\nCC...\n.CC.C",
"output": "46"
},
{
"input": "7\n.CC..CC\nCC.C..C\nC.C..C.\nC...C.C\nCCC.CCC\n.CC...C\n.C.CCC.",
"output": "84"
},
{
"input": "8\n..C....C\nC.CCC.CC\n.C..C.CC\nCC......\nC..C..CC\nC.C...C.\nC.C..C..\nC...C.C.",
"output": "80"
},
{
"input": "9\n.C...CCCC\nC.CCCC...\n....C..CC\n.CC.CCC..\n.C.C..CC.\nC...C.CCC\nCCC.C...C\nCCCC....C\n..C..C..C",
"output": "144"
},
{
"input": "10\n..C..C.C..\n..CC..C.CC\n.C.C...C.C\n..C.CC..CC\n....C..C.C\n...C..C..C\nCC.CC....C\n..CCCC.C.C\n..CC.CCC..\nCCCC..C.CC",
"output": "190"
},
{
"input": "11\nC.CC...C.CC\nCC.C....C.C\n.....C..CCC\n....C.CC.CC\nC..C..CC...\nC...C...C..\nCC..CCC.C.C\n..C.CC.C..C\nC...C.C..CC\n.C.C..CC..C\n.C.C.CC.C..",
"output": "228"
},
{
"input": "21\n...CCC.....CC..C..C.C\n..CCC...CC...CC.CCC.C\n....C.C.C..CCC..C.C.C\n....CCC..C..C.CC.CCC.\n...CCC.C..C.C.....CCC\n.CCC.....CCC..C...C.C\nCCCC.C...CCC.C...C.CC\nC..C...C.CCC..CC..C..\nC...CC..C.C.CC..C.CC.\nCC..CCCCCCCCC..C....C\n.C..CCCC.CCCC.CCC...C\nCCC...CCC...CCC.C..C.\n.CCCCCCCC.CCCC.CC.C..\n.C.C..C....C.CCCCCC.C\n...C...C.CCC.C.CC..C.\nCCC...CC..CC...C..C.C\n.CCCCC...C.C..C.CC.C.\n..CCC.C.C..CCC.CCC...\n..C..C.C.C.....CC.C..\n.CC.C...C.CCC.C....CC\n...C..CCCC.CCC....C..",
"output": "2103"
},
{
"input": "20\nC.C.CCC.C....C.CCCCC\nC.CC.C..CCC....CCCC.\n.CCC.CC...CC.CCCCCC.\n.C...CCCC..C....CCC.\n.C..CCCCCCC.C.C.....\nC....C.C..CCC.C..CCC\n...C.C.CC..CC..CC...\nC...CC.C.CCCCC....CC\n.CC.C.CCC....C.CCC.C\nCC...CC...CC..CC...C\nC.C..CC.C.CCCC.C.CC.\n..CCCCC.C.CCC..CCCC.\n....C..C..C.CC...C.C\nC..CCC..CC..C.CC..CC\n...CC......C.C..C.C.\nCC.CCCCC.CC.CC...C.C\n.C.CC..CC..CCC.C.CCC\nC..C.CC....C....C...\n..CCC..CCC...CC..C.C\n.C.CCC.CCCCCCCCC..CC",
"output": "2071"
},
{
"input": "17\nCCC..C.C....C.C.C\n.C.CC.CC...CC..C.\n.CCCC.CC.C..CCC.C\n...CCC.CC.CCC.C.C\nCCCCCCCC..C.CC.CC\n...C..C....C.CC.C\nCC....CCC...C.CC.\n.CC.C.CC..C......\n.CCCCC.C.CC.CCCCC\n..CCCC...C..CC..C\nC.CC.C.CC..C.C.C.\nC..C..C..CCC.C...\n.C..CCCC..C......\n.CC.C...C..CC.CC.\nC..C....CC...CC..\nC.CC.CC..C.C..C..\nCCCC...C.C..CCCC.",
"output": "1160"
},
{
"input": "15\nCCCC.C..CCC....\nCCCCCC.CC.....C\n...C.CC.C.C.CC.\nCCCCCCC..C..C..\nC..CCC..C.CCCC.\n.CC..C.C.C.CC.C\n.C.C..C..C.C..C\n...C...C..CCCC.\n.....C.C..CC...\nCC.C.C..CC.C..C\n..CCCCC..CCC...\nCC.CC.C..CC.CCC\n..CCC...CC.C..C\nCC..C.C..CCC..C\n.C.C....CCC...C",
"output": "789"
},
{
"input": "1\n.",
"output": "0"
},
{
"input": "3\n.CC\nC..\nC.C",
"output": "4"
},
{
"input": "13\nC.C...C.C.C..\nCC.CCCC.CC..C\n.C.CCCCC.CC..\nCCCC..C...C..\n...CC.C.C...C\n.CC.CCC...CC.\nCC.CCCCCC....\n.C...C..CC..C\nCCCC.CC...C..\n.C.CCC..C.CC.\n..C...CC..C.C\n..C.CCC..CC.C\n.C...CCC.CC.C",
"output": "529"
},
{
"input": "16\n.C.C.C.C.C...C.C\n..C..C.CCCCCC...\n..C.C.C.C..C..C.\n.CC....C.CCC..C.\n.C.CCC..C....CCC\nCC..C.CC..C.C.CC\n...C..C..CC..CC.\n.CCC..C.CC.C.C..\n.CC.C..........C\nC...C....CC..C..\nC.CCC.C..C..C...\n.CCCCCCCCCCCC..C\n..C.C.CC.CC.CCC.\nCC..C.C....C..CC\nC.CCC..C..C.C.CC\n.C.CCC.CC..CCC.C",
"output": "874"
},
{
"input": "2\nCC\nCC",
"output": "4"
},
{
"input": "3\nC..\nC..\nC..",
"output": "3"
}
] | 1,592,960,762
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 124
| 6,963,200
|
def solution(l1,n):
i=0
pairs=0
while i<len(l1):
j=0
count=0
while j<len(l1[i]):
if l1[i][j]=="C":
count+=1
j+=1
pairs+=int(count*(count-1)/2)
i+=1
i=0
while i<len(l1):
j=0
count=0
while j<len(l1[i]):
if l1[j][i]=="C":
count+=1
j+=1
pairs+=int(count*(count-1)/2)
i+=1
return pairs
def answer():
n=int(input())
l1=[]
while n:
l1.append(list(input()))
n-=1
print(solution(l1,n))
answer()
|
Title: Far Relative’s Birthday Cake
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Door's family is going celebrate Famil Doors's birthday party. They love Famil Door so they are planning to make his birthday cake weird!
The cake is a *n*<=×<=*n* square consisting of equal squares with side length 1. Each square is either empty or consists of a single chocolate. They bought the cake and randomly started to put the chocolates on the cake. The value of Famil Door's happiness will be equal to the number of pairs of cells with chocolates that are in the same row or in the same column of the cake. Famil Doors's family is wondering what is the amount of happiness of Famil going to be?
Please, note that any pair can be counted no more than once, as two different cells can't share both the same row and the same column.
Input Specification:
In the first line of the input, you are given a single integer *n* (1<=≤<=*n*<=≤<=100) — the length of the side of the cake.
Then follow *n* lines, each containing *n* characters. Empty cells are denoted with '.', while cells that contain chocolates are denoted by 'C'.
Output Specification:
Print the value of Famil Door's happiness, i.e. the number of pairs of chocolate pieces that share the same row or the same column.
Demo Input:
['3\n.CC\nC..\nC.C\n', '4\nCC..\nC..C\n.CC.\n.CC.\n']
Demo Output:
['4\n', '9\n']
Note:
If we number rows from top to bottom and columns from left to right, then, pieces that share the same row in the first sample are:
1. (1, 2) and (1, 3) 1. (3, 1) and (3, 3) 1. (2, 1) and (3, 1) 1. (1, 3) and (3, 3)
|
```python
def solution(l1,n):
i=0
pairs=0
while i<len(l1):
j=0
count=0
while j<len(l1[i]):
if l1[i][j]=="C":
count+=1
j+=1
pairs+=int(count*(count-1)/2)
i+=1
i=0
while i<len(l1):
j=0
count=0
while j<len(l1[i]):
if l1[j][i]=="C":
count+=1
j+=1
pairs+=int(count*(count-1)/2)
i+=1
return pairs
def answer():
n=int(input())
l1=[]
while n:
l1.append(list(input()))
n-=1
print(solution(l1,n))
answer()
```
| 3
|
|
808
|
B
|
Average Sleep Time
|
PROGRAMMING
| 1,300
|
[
"data structures",
"implementation",
"math"
] | null | null |
It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days!
When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day.
The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is .
You should write a program which will calculate average sleep times of Polycarp over all weeks.
|
The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105).
The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
|
Output average sleeping time over all weeks.
The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point.
|
[
"3 2\n3 4 7\n",
"1 1\n10\n",
"8 2\n1 2 4 100000 123 456 789 1\n"
] |
[
"9.0000000000\n",
"10.0000000000\n",
"28964.2857142857\n"
] |
In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
| 0
|
[
{
"input": "3 2\n3 4 7",
"output": "9.0000000000"
},
{
"input": "1 1\n10",
"output": "10.0000000000"
},
{
"input": "8 2\n1 2 4 100000 123 456 789 1",
"output": "28964.2857142857"
},
{
"input": "1 1\n1",
"output": "1.0000000000"
},
{
"input": "1 1\n100000",
"output": "100000.0000000000"
},
{
"input": "3 1\n1 2 3",
"output": "2.0000000000"
},
{
"input": "10 4\n11 3 5 20 12 7 9 2 2 20",
"output": "36.2857142857"
},
{
"input": "10 5\n15 9 3 2 17 10 9 18 4 19",
"output": "50.3333333333"
},
{
"input": "10 6\n19 3 20 16 14 10 1 13 7 3",
"output": "65.8000000000"
},
{
"input": "10 7\n8 16 2 13 15 9 5 13 9 2",
"output": "68.2500000000"
},
{
"input": "10 4\n127 1459 718 1183 880 1044 1857 1340 725 1496",
"output": "4574.4285714286"
},
{
"input": "10 5\n1384 1129 1780 1960 1567 1928 12 1523 1165 344",
"output": "6931.3333333333"
}
] | 1,517,815,082
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 233
| 18,739,200
|
##n = int(input())
##a = list(map(int, input().split()))
##print(' '.join(map(str, res)))
[n, k] = list(map(int, input().split()))
a = list(map(int, input().split()))
sum = 0
for i in range(k):
sum += a[i]
tot = sum;
for i in range(n-k):
sum -= a[i]
sum += a[i+k]
tot += sum
tot /= n-k+1
print(tot)
|
Title: Average Sleep Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's been almost a week since Polycarp couldn't get rid of insomnia. And as you may already know, one week in Berland lasts *k* days!
When Polycarp went to a doctor with his problem, the doctor asked him about his sleeping schedule (more specifically, the average amount of hours of sleep per week). Luckily, Polycarp kept records of sleep times for the last *n* days. So now he has a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* is the sleep time on the *i*-th day.
The number of records is so large that Polycarp is unable to calculate the average value by himself. Thus he is asking you to help him with the calculations. To get the average Polycarp is going to consider *k* consecutive days as a week. So there will be *n*<=-<=*k*<=+<=1 weeks to take into consideration. For example, if *k*<==<=2, *n*<==<=3 and *a*<==<=[3,<=4,<=7], then the result is .
You should write a program which will calculate average sleep times of Polycarp over all weeks.
Input Specification:
The first line contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105).
The second line contains *n* integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Output average sleeping time over all weeks.
The answer is considered to be correct if its absolute or relative error does not exceed 10<=-<=6. In particular, it is enough to output real number with at least 6 digits after the decimal point.
Demo Input:
['3 2\n3 4 7\n', '1 1\n10\n', '8 2\n1 2 4 100000 123 456 789 1\n']
Demo Output:
['9.0000000000\n', '10.0000000000\n', '28964.2857142857\n']
Note:
In the third example there are *n* - *k* + 1 = 7 weeks, so the answer is sums of all weeks divided by 7.
|
```python
##n = int(input())
##a = list(map(int, input().split()))
##print(' '.join(map(str, res)))
[n, k] = list(map(int, input().split()))
a = list(map(int, input().split()))
sum = 0
for i in range(k):
sum += a[i]
tot = sum;
for i in range(n-k):
sum -= a[i]
sum += a[i+k]
tot += sum
tot /= n-k+1
print(tot)
```
| 3
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,674,719,383
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 1
| 60
| 0
|
n = int(input())
t1 = input()
t1_g = 1
t2_g = 0
for i in range(1, n):
t = input()
if t == t1:
t1 += 1
else:
t2 = t
t2 += 2
print(t1 if t1_g > t2_g else t2)
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n = int(input())
t1 = input()
t1_g = 1
t2_g = 0
for i in range(1, n):
t = input()
if t == t1:
t1 += 1
else:
t2 = t
t2 += 2
print(t1 if t1_g > t2_g else t2)
```
| -1
|
789
|
A
|
Anastasia and pebbles
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
Anastasia loves going for a walk in Central Uzhlyandian Park. But she became uninterested in simple walking, so she began to collect Uzhlyandian pebbles. At first, she decided to collect all the pebbles she could find in the park.
She has only two pockets. She can put at most *k* pebbles in each pocket at the same time. There are *n* different pebble types in the park, and there are *w**i* pebbles of the *i*-th type. Anastasia is very responsible, so she never mixes pebbles of different types in same pocket. However, she can put different kinds of pebbles in different pockets at the same time. Unfortunately, she can't spend all her time collecting pebbles, so she can collect pebbles from the park only once a day.
Help her to find the minimum number of days needed to collect all the pebbles of Uzhlyandian Central Park, taking into consideration that Anastasia can't place pebbles of different types in same pocket.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=109) — the number of different pebble types and number of pebbles Anastasia can place in one pocket.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=≤<=*w**i*<=≤<=104) — number of pebbles of each type.
|
The only line of output contains one integer — the minimum number of days Anastasia needs to collect all the pebbles.
|
[
"3 2\n2 3 4\n",
"5 4\n3 1 8 9 7\n"
] |
[
"3\n",
"5\n"
] |
In the first sample case, Anastasia can collect all pebbles of the first type on the first day, of second type — on the second day, and of third type — on the third day.
Optimal sequence of actions in the second sample case:
- In the first day Anastasia collects 8 pebbles of the third type. - In the second day she collects 8 pebbles of the fourth type. - In the third day she collects 3 pebbles of the first type and 1 pebble of the fourth type. - In the fourth day she collects 7 pebbles of the fifth type. - In the fifth day she collects 1 pebble of the second type.
| 500
|
[
{
"input": "3 2\n2 3 4",
"output": "3"
},
{
"input": "5 4\n3 1 8 9 7",
"output": "5"
},
{
"input": "1 22\n1",
"output": "1"
},
{
"input": "3 57\n78 165 54",
"output": "3"
},
{
"input": "5 72\n74 10 146 189 184",
"output": "6"
},
{
"input": "9 13\n132 87 200 62 168 51 185 192 118",
"output": "48"
},
{
"input": "1 1\n10000",
"output": "5000"
},
{
"input": "10 1\n1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "2 2\n2 2",
"output": "1"
}
] | 1,492,171,721
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 140
| 11,878,400
|
'''input
5 4
3 1 8 9 7
'''
n, k = map(int, input().split())
w = list(map(int, input().split()))
for x in range(n):
if w[x] % k == 0:
w[x] //= k
else:
w[x] //= k
w[x] += 1
print(sum(w)//2+1)
|
Title: Anastasia and pebbles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anastasia loves going for a walk in Central Uzhlyandian Park. But she became uninterested in simple walking, so she began to collect Uzhlyandian pebbles. At first, she decided to collect all the pebbles she could find in the park.
She has only two pockets. She can put at most *k* pebbles in each pocket at the same time. There are *n* different pebble types in the park, and there are *w**i* pebbles of the *i*-th type. Anastasia is very responsible, so she never mixes pebbles of different types in same pocket. However, she can put different kinds of pebbles in different pockets at the same time. Unfortunately, she can't spend all her time collecting pebbles, so she can collect pebbles from the park only once a day.
Help her to find the minimum number of days needed to collect all the pebbles of Uzhlyandian Central Park, taking into consideration that Anastasia can't place pebbles of different types in same pocket.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=109) — the number of different pebble types and number of pebbles Anastasia can place in one pocket.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=≤<=*w**i*<=≤<=104) — number of pebbles of each type.
Output Specification:
The only line of output contains one integer — the minimum number of days Anastasia needs to collect all the pebbles.
Demo Input:
['3 2\n2 3 4\n', '5 4\n3 1 8 9 7\n']
Demo Output:
['3\n', '5\n']
Note:
In the first sample case, Anastasia can collect all pebbles of the first type on the first day, of second type — on the second day, and of third type — on the third day.
Optimal sequence of actions in the second sample case:
- In the first day Anastasia collects 8 pebbles of the third type. - In the second day she collects 8 pebbles of the fourth type. - In the third day she collects 3 pebbles of the first type and 1 pebble of the fourth type. - In the fourth day she collects 7 pebbles of the fifth type. - In the fifth day she collects 1 pebble of the second type.
|
```python
'''input
5 4
3 1 8 9 7
'''
n, k = map(int, input().split())
w = list(map(int, input().split()))
for x in range(n):
if w[x] % k == 0:
w[x] //= k
else:
w[x] //= k
w[x] += 1
print(sum(w)//2+1)
```
| 0
|
|
766
|
B
|
Mahmoud and a Triangle
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"geometry",
"greedy",
"math",
"number theory",
"sortings"
] | null | null |
Mahmoud has *n* line segments, the *i*-th of them has length *a**i*. Ehab challenged him to use exactly 3 line segments to form a non-degenerate triangle. Mahmoud doesn't accept challenges unless he is sure he can win, so he asked you to tell him if he should accept the challenge. Given the lengths of the line segments, check if he can choose exactly 3 of them to form a non-degenerate triangle.
Mahmoud should use exactly 3 line segments, he can't concatenate two line segments or change any length. A non-degenerate triangle is a triangle with positive area.
|
The first line contains single integer *n* (3<=≤<=*n*<=≤<=105) — the number of line segments Mahmoud has.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the lengths of line segments Mahmoud has.
|
In the only line print "YES" if he can choose exactly three line segments and form a non-degenerate triangle with them, and "NO" otherwise.
|
[
"5\n1 5 3 2 4\n",
"3\n4 1 2\n"
] |
[
"YES\n",
"NO\n"
] |
For the first example, he can use line segments with lengths 2, 4 and 5 to form a non-degenerate triangle.
| 1,000
|
[
{
"input": "5\n1 5 3 2 4",
"output": "YES"
},
{
"input": "3\n4 1 2",
"output": "NO"
},
{
"input": "30\n197 75 517 39724 7906061 1153471 3 15166 168284 3019844 272293 316 16 24548 42 118 5792 5 9373 1866366 4886214 24 2206 712886 104005 1363 836 64273 440585 3576",
"output": "NO"
},
{
"input": "30\n229017064 335281886 247217656 670601882 743442492 615491486 544941439 911270108 474843964 803323771 177115397 62179276 390270885 754889875 881720571 902691435 154083299 328505383 761264351 182674686 94104683 357622370 573909964 320060691 33548810 247029007 812823597 946798893 813659359 710111761",
"output": "YES"
},
{
"input": "40\n740553458 532562042 138583675 75471987 487348843 476240280 972115023 103690894 546736371 915774563 35356828 819948191 138721993 24257926 761587264 767176616 608310208 78275645 386063134 227581756 672567198 177797611 87579917 941781518 274774331 843623616 981221615 630282032 118843963 749160513 354134861 132333165 405839062 522698334 29698277 541005920 856214146 167344951 398332403 68622974",
"output": "YES"
},
{
"input": "40\n155 1470176 7384 765965701 1075 4 561554 6227772 93 16304522 1744 662 3 292572860 19335 908613 42685804 347058 20 132560 3848974 69067081 58 2819 111752888 408 81925 30 11951 4564 251 26381275 473392832 50628 180819969 2378797 10076746 9 214492 31291",
"output": "NO"
},
{
"input": "3\n1 1000000000 1000000000",
"output": "YES"
},
{
"input": "4\n1 1000000000 1000000000 1000000000",
"output": "YES"
},
{
"input": "3\n1 1000000000 1",
"output": "NO"
},
{
"input": "5\n1 2 3 5 2",
"output": "YES"
},
{
"input": "41\n19 161 4090221 118757367 2 45361275 1562319 596751 140871 97 1844 310910829 10708344 6618115 698 1 87059 33 2527892 12703 73396090 17326460 3 368811 20550 813975131 10 53804 28034805 7847 2992 33254 1139 227930 965568 261 4846 503064297 192153458 57 431",
"output": "NO"
},
{
"input": "42\n4317083 530966905 202811311 104 389267 35 1203 18287479 125344279 21690 859122498 65 859122508 56790 1951 148683 457 1 22 2668100 8283 2 77467028 13405 11302280 47877251 328155592 35095 29589769 240574 4 10 1019123 6985189 629846 5118 169 1648973 91891 741 282 3159",
"output": "YES"
},
{
"input": "43\n729551585 11379 5931704 330557 1653 15529406 729551578 278663905 1 729551584 2683 40656510 29802 147 1400284 2 126260 865419 51 17 172223763 86 1 534861 450887671 32 234 25127103 9597697 48226 7034 389 204294 2265706 65783617 4343 3665990 626 78034 106440137 5 18421 1023",
"output": "YES"
},
{
"input": "44\n719528276 2 235 444692918 24781885 169857576 18164 47558 15316043 9465834 64879816 2234575 1631 853530 8 1001 621 719528259 84 6933 31 1 3615623 719528266 40097928 274835337 1381044 11225 2642 5850203 6 527506 18 104977753 76959 29393 49 4283 141 201482 380 1 124523 326015",
"output": "YES"
},
{
"input": "45\n28237 82 62327732 506757 691225170 5 970 4118 264024506 313192 367 14713577 73933 691225154 6660 599 691225145 3473403 51 427200630 1326718 2146678 100848386 1569 27 163176119 193562 10784 45687 819951 38520653 225 119620 1 3 691225169 691225164 17445 23807072 1 9093493 5620082 2542 139 14",
"output": "YES"
},
{
"input": "44\n165580141 21 34 55 1 89 144 17711 2 377 610 987 2584 13 5 4181 6765 10946 1597 8 28657 3 233 75025 121393 196418 317811 9227465 832040 1346269 2178309 3524578 5702887 1 14930352 102334155 24157817 39088169 63245986 701408733 267914296 433494437 514229 46368",
"output": "NO"
},
{
"input": "3\n1 1000000000 999999999",
"output": "NO"
},
{
"input": "5\n1 1 1 1 1",
"output": "YES"
},
{
"input": "10\n1 10 100 1000 10000 100000 1000000 10000000 100000000 1000000000",
"output": "NO"
},
{
"input": "5\n2 3 4 10 20",
"output": "YES"
},
{
"input": "6\n18 23 40 80 160 161",
"output": "YES"
},
{
"input": "4\n5 6 7 888",
"output": "YES"
},
{
"input": "9\n1 1 2 2 4 5 10 10 20",
"output": "YES"
},
{
"input": "7\n3 150 900 4 500 1500 5",
"output": "YES"
},
{
"input": "3\n2 2 3",
"output": "YES"
},
{
"input": "7\n1 2 100 200 250 1000000 2000000",
"output": "YES"
},
{
"input": "8\n2 3 5 5 5 6 6 13",
"output": "YES"
},
{
"input": "3\n2 3 4",
"output": "YES"
},
{
"input": "6\n1 1 1 4 5 100",
"output": "YES"
},
{
"input": "13\n1 2 3 5 8 13 22 34 55 89 144 233 377",
"output": "YES"
},
{
"input": "4\n2 3 4 8",
"output": "YES"
},
{
"input": "3\n5 6 7",
"output": "YES"
},
{
"input": "5\n1 4 5 6 1000000",
"output": "YES"
},
{
"input": "4\n5 6 7 20",
"output": "YES"
},
{
"input": "6\n1 1 1 1 1 65",
"output": "YES"
},
{
"input": "4\n3 4 5 100",
"output": "YES"
},
{
"input": "3\n2 4 5",
"output": "YES"
},
{
"input": "7\n1 1 1 1 1 10 1000",
"output": "YES"
},
{
"input": "4\n1 1 2 3",
"output": "NO"
},
{
"input": "11\n1 2 5 6 7 8 9 17 18 19 100",
"output": "YES"
},
{
"input": "4\n5 16 20 200",
"output": "YES"
},
{
"input": "5\n17 6 3 3 1",
"output": "YES"
},
{
"input": "3\n1 1 1",
"output": "YES"
},
{
"input": "6\n1 1 1 2 3 5",
"output": "YES"
},
{
"input": "4\n2 4 6 6",
"output": "YES"
},
{
"input": "9\n1 2 4 4 4 4 7 8 20",
"output": "YES"
},
{
"input": "9\n1 1 2 5 5 5 10 10 20",
"output": "YES"
},
{
"input": "7\n3 150 600 4 1700 6000 5",
"output": "YES"
},
{
"input": "5\n5761 20966 27841 28800 29399",
"output": "YES"
},
{
"input": "9\n1 2 3 6 7 10 11 12 24",
"output": "YES"
},
{
"input": "4\n1 2 1 1",
"output": "YES"
},
{
"input": "5\n1 1 2 3 4",
"output": "YES"
}
] | 1,690,897,995
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 87
| 93
| 13,619,200
|
n = int(input())
l =list(map(int,input().split()))
l = sorted(l)
f = False
for i in range(n-2):
if(l[i]+l[i+1]>l[i+2]):
print('YES')
f= True
break
if(not f):
print('NO')
|
Title: Mahmoud and a Triangle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mahmoud has *n* line segments, the *i*-th of them has length *a**i*. Ehab challenged him to use exactly 3 line segments to form a non-degenerate triangle. Mahmoud doesn't accept challenges unless he is sure he can win, so he asked you to tell him if he should accept the challenge. Given the lengths of the line segments, check if he can choose exactly 3 of them to form a non-degenerate triangle.
Mahmoud should use exactly 3 line segments, he can't concatenate two line segments or change any length. A non-degenerate triangle is a triangle with positive area.
Input Specification:
The first line contains single integer *n* (3<=≤<=*n*<=≤<=105) — the number of line segments Mahmoud has.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the lengths of line segments Mahmoud has.
Output Specification:
In the only line print "YES" if he can choose exactly three line segments and form a non-degenerate triangle with them, and "NO" otherwise.
Demo Input:
['5\n1 5 3 2 4\n', '3\n4 1 2\n']
Demo Output:
['YES\n', 'NO\n']
Note:
For the first example, he can use line segments with lengths 2, 4 and 5 to form a non-degenerate triangle.
|
```python
n = int(input())
l =list(map(int,input().split()))
l = sorted(l)
f = False
for i in range(n-2):
if(l[i]+l[i+1]>l[i+2]):
print('YES')
f= True
break
if(not f):
print('NO')
```
| 3
|
|
638
|
A
|
Home Numbers
|
PROGRAMMING
| 1,100
|
[
"*special",
"constructive algorithms",
"math"
] | null | null |
The main street of Berland is a straight line with *n* houses built along it (*n* is an even number). The houses are located at both sides of the street. The houses with odd numbers are at one side of the street and are numbered from 1 to *n*<=-<=1 in the order from the beginning of the street to the end (in the picture: from left to right). The houses with even numbers are at the other side of the street and are numbered from 2 to *n* in the order from the end of the street to its beginning (in the picture: from right to left). The corresponding houses with even and odd numbers are strictly opposite each other, that is, house 1 is opposite house *n*, house 3 is opposite house *n*<=-<=2, house 5 is opposite house *n*<=-<=4 and so on.
Vasya needs to get to house number *a* as quickly as possible. He starts driving from the beginning of the street and drives his car to house *a*. To get from the beginning of the street to houses number 1 and *n*, he spends exactly 1 second. He also spends exactly one second to drive the distance between two neighbouring houses. Vasya can park at any side of the road, so the distance between the beginning of the street at the houses that stand opposite one another should be considered the same.
Your task is: find the minimum time Vasya needs to reach house *a*.
|
The first line of the input contains two integers, *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100<=000) — the number of houses on the street and the number of the house that Vasya needs to reach, correspondingly. It is guaranteed that number *n* is even.
|
Print a single integer — the minimum time Vasya needs to get from the beginning of the street to house *a*.
|
[
"4 2\n",
"8 5\n"
] |
[
"2\n",
"3\n"
] |
In the first sample there are only four houses on the street, two houses at each side. House 2 will be the last at Vasya's right.
The second sample corresponds to picture with *n* = 8. House 5 is the one before last at Vasya's left.
| 500
|
[
{
"input": "4 2",
"output": "2"
},
{
"input": "8 5",
"output": "3"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "10 1",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "100000 100000",
"output": "1"
},
{
"input": "100000 2",
"output": "50000"
},
{
"input": "100000 3",
"output": "2"
},
{
"input": "100000 99999",
"output": "50000"
},
{
"input": "100 100",
"output": "1"
},
{
"input": "3000 34",
"output": "1484"
},
{
"input": "2000 1",
"output": "1"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "24842 1038",
"output": "11903"
},
{
"input": "1628 274",
"output": "678"
},
{
"input": "16186 337",
"output": "169"
},
{
"input": "24562 2009",
"output": "1005"
},
{
"input": "9456 3443",
"output": "1722"
},
{
"input": "5610 332",
"output": "2640"
},
{
"input": "1764 1288",
"output": "239"
},
{
"input": "28588 13902",
"output": "7344"
},
{
"input": "92480 43074",
"output": "24704"
},
{
"input": "40022 26492",
"output": "6766"
},
{
"input": "85766 64050",
"output": "10859"
},
{
"input": "67808 61809",
"output": "30905"
},
{
"input": "80124 68695",
"output": "34348"
},
{
"input": "95522 91716",
"output": "1904"
},
{
"input": "7752 2915",
"output": "1458"
},
{
"input": "5094 5058",
"output": "19"
},
{
"input": "6144 4792",
"output": "677"
},
{
"input": "34334 20793",
"output": "10397"
},
{
"input": "23538 10243",
"output": "5122"
},
{
"input": "9328 7933",
"output": "3967"
},
{
"input": "11110 9885",
"output": "4943"
},
{
"input": "26096 2778",
"output": "11660"
},
{
"input": "75062 5323",
"output": "2662"
},
{
"input": "94790 7722",
"output": "43535"
},
{
"input": "90616 32240",
"output": "29189"
},
{
"input": "96998 8992",
"output": "44004"
},
{
"input": "95130 19219",
"output": "9610"
},
{
"input": "92586 8812",
"output": "41888"
},
{
"input": "3266 3044",
"output": "112"
},
{
"input": "5026 4697",
"output": "2349"
},
{
"input": "3044 2904",
"output": "71"
},
{
"input": "6022 5396",
"output": "314"
},
{
"input": "31270 25522",
"output": "2875"
},
{
"input": "82156 75519",
"output": "37760"
},
{
"input": "34614 27913",
"output": "13957"
},
{
"input": "88024 61143",
"output": "30572"
},
{
"input": "91870 55672",
"output": "18100"
},
{
"input": "95718 4868",
"output": "45426"
},
{
"input": "99564 358",
"output": "49604"
},
{
"input": "89266 13047",
"output": "6524"
},
{
"input": "90904 16455",
"output": "8228"
},
{
"input": "94750 13761",
"output": "6881"
},
{
"input": "100000 23458",
"output": "38272"
},
{
"input": "100000 23457",
"output": "11729"
},
{
"input": "59140 24272",
"output": "17435"
},
{
"input": "9860 8516",
"output": "673"
},
{
"input": "25988 2733",
"output": "1367"
},
{
"input": "9412 5309",
"output": "2655"
},
{
"input": "25540 23601",
"output": "11801"
},
{
"input": "76260 6050",
"output": "35106"
},
{
"input": "92388 39118",
"output": "26636"
},
{
"input": "8516 5495",
"output": "2748"
},
{
"input": "91940 37847",
"output": "18924"
},
{
"input": "30518 286",
"output": "15117"
},
{
"input": "46646 19345",
"output": "9673"
}
] | 1,458,478,146
| 2,946
|
Python 3
|
OK
|
TESTS
| 69
| 62
| 4,812,800
|
def get():
s = input().split()
return int(s[0]), int(s[1])
n, a = get()
print(str(int(a / 2 + 1 if a % 2 == 1 else n / 2 - a / 2 + 1)))
|
Title: Home Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The main street of Berland is a straight line with *n* houses built along it (*n* is an even number). The houses are located at both sides of the street. The houses with odd numbers are at one side of the street and are numbered from 1 to *n*<=-<=1 in the order from the beginning of the street to the end (in the picture: from left to right). The houses with even numbers are at the other side of the street and are numbered from 2 to *n* in the order from the end of the street to its beginning (in the picture: from right to left). The corresponding houses with even and odd numbers are strictly opposite each other, that is, house 1 is opposite house *n*, house 3 is opposite house *n*<=-<=2, house 5 is opposite house *n*<=-<=4 and so on.
Vasya needs to get to house number *a* as quickly as possible. He starts driving from the beginning of the street and drives his car to house *a*. To get from the beginning of the street to houses number 1 and *n*, he spends exactly 1 second. He also spends exactly one second to drive the distance between two neighbouring houses. Vasya can park at any side of the road, so the distance between the beginning of the street at the houses that stand opposite one another should be considered the same.
Your task is: find the minimum time Vasya needs to reach house *a*.
Input Specification:
The first line of the input contains two integers, *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100<=000) — the number of houses on the street and the number of the house that Vasya needs to reach, correspondingly. It is guaranteed that number *n* is even.
Output Specification:
Print a single integer — the minimum time Vasya needs to get from the beginning of the street to house *a*.
Demo Input:
['4 2\n', '8 5\n']
Demo Output:
['2\n', '3\n']
Note:
In the first sample there are only four houses on the street, two houses at each side. House 2 will be the last at Vasya's right.
The second sample corresponds to picture with *n* = 8. House 5 is the one before last at Vasya's left.
|
```python
def get():
s = input().split()
return int(s[0]), int(s[1])
n, a = get()
print(str(int(a / 2 + 1 if a % 2 == 1 else n / 2 - a / 2 + 1)))
```
| 3
|
|
362
|
B
|
Petya and Staircases
|
PROGRAMMING
| 1,100
|
[
"implementation",
"sortings"
] | null | null |
Little boy Petya loves stairs very much. But he is bored from simple going up and down them — he loves jumping over several stairs at a time. As he stands on some stair, he can either jump to the next one or jump over one or two stairs at a time. But some stairs are too dirty and Petya doesn't want to step on them.
Now Petya is on the first stair of the staircase, consisting of *n* stairs. He also knows the numbers of the dirty stairs of this staircase. Help Petya find out if he can jump through the entire staircase and reach the last stair number *n* without touching a dirty stair once.
One has to note that anyway Petya should step on the first and last stairs, so if the first or the last stair is dirty, then Petya cannot choose a path with clean steps only.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=109, 0<=≤<=*m*<=≤<=3000) — the number of stairs in the staircase and the number of dirty stairs, correspondingly. The second line contains *m* different space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=*n*) — the numbers of the dirty stairs (in an arbitrary order).
|
Print "YES" if Petya can reach stair number *n*, stepping only on the clean stairs. Otherwise print "NO".
|
[
"10 5\n2 4 8 3 6\n",
"10 5\n2 4 5 7 9\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "10 5\n2 4 8 3 6",
"output": "NO"
},
{
"input": "10 5\n2 4 5 7 9",
"output": "YES"
},
{
"input": "10 9\n2 3 4 5 6 7 8 9 10",
"output": "NO"
},
{
"input": "5 2\n4 5",
"output": "NO"
},
{
"input": "123 13\n36 73 111 2 92 5 47 55 48 113 7 78 37",
"output": "YES"
},
{
"input": "10 10\n7 6 4 2 5 10 8 3 9 1",
"output": "NO"
},
{
"input": "12312 0",
"output": "YES"
},
{
"input": "9817239 1\n6323187",
"output": "YES"
},
{
"input": "1 1\n1",
"output": "NO"
},
{
"input": "5 4\n4 2 5 1",
"output": "NO"
},
{
"input": "5 3\n4 3 5",
"output": "NO"
},
{
"input": "500 3\n18 62 445",
"output": "YES"
},
{
"input": "500 50\n72 474 467 241 442 437 336 234 410 120 438 164 405 177 142 114 27 20 445 235 46 176 88 488 242 391 28 414 145 92 206 334 152 343 367 254 100 243 155 348 148 450 461 483 97 34 471 69 416 362",
"output": "NO"
},
{
"input": "500 8\n365 313 338 410 482 417 325 384",
"output": "YES"
},
{
"input": "1000000000 10\n2 3 5 6 8 9 123 874 1230 1000000000",
"output": "NO"
},
{
"input": "1000000000 10\n1 2 3 5 6 8 9 123 874 1230",
"output": "NO"
},
{
"input": "10 1\n1",
"output": "NO"
},
{
"input": "10 4\n1 2 4 5",
"output": "NO"
},
{
"input": "50 20\n22 33 17 23 27 5 26 31 41 20 8 24 6 3 4 29 40 25 13 16",
"output": "NO"
},
{
"input": "50 40\n14 27 19 30 31 20 28 11 37 29 23 33 7 26 22 16 1 6 18 3 47 36 38 2 48 9 41 8 5 50 4 45 44 25 39 12 43 42 40 46",
"output": "NO"
},
{
"input": "123 12\n35 95 47 99 79 122 58 94 31 57 18 10",
"output": "YES"
},
{
"input": "10 5\n1 3 5 7 9",
"output": "NO"
},
{
"input": "100 7\n2 3 5 6 8 9 100",
"output": "NO"
},
{
"input": "100 3\n98 99 100",
"output": "NO"
},
{
"input": "100 3\n97 98 99",
"output": "NO"
},
{
"input": "100 3\n96 98 99",
"output": "YES"
},
{
"input": "10 6\n2 3 5 6 8 9",
"output": "YES"
},
{
"input": "1000000000 10\n2 4 10 18 40 42 49 58 59 60",
"output": "NO"
},
{
"input": "10 3\n1 4 6",
"output": "NO"
},
{
"input": "8 3\n2 3 4",
"output": "NO"
},
{
"input": "100 3\n4 5 6",
"output": "NO"
},
{
"input": "10 2\n10 1",
"output": "NO"
},
{
"input": "10 1\n10",
"output": "NO"
},
{
"input": "4 2\n2 3",
"output": "YES"
},
{
"input": "2 1\n1",
"output": "NO"
},
{
"input": "2 0",
"output": "YES"
},
{
"input": "4 3\n2 3 4",
"output": "NO"
},
{
"input": "5 3\n4 2 3",
"output": "NO"
}
] | 1,608,465,292
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 7
| 93
| 307,200
|
a,b=map(int,input().split())
l=list(map(int,input().split()))
l.sort()
x=True
for i in range(b-2):
if l[i+1]==l[i]+1 and l[i+2]==l[i]+2:
x=False
if l[0]==1 or l[-1]==a:
print('NO')
elif x:
print("YES")
else:
print('NO')
|
Title: Petya and Staircases
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little boy Petya loves stairs very much. But he is bored from simple going up and down them — he loves jumping over several stairs at a time. As he stands on some stair, he can either jump to the next one or jump over one or two stairs at a time. But some stairs are too dirty and Petya doesn't want to step on them.
Now Petya is on the first stair of the staircase, consisting of *n* stairs. He also knows the numbers of the dirty stairs of this staircase. Help Petya find out if he can jump through the entire staircase and reach the last stair number *n* without touching a dirty stair once.
One has to note that anyway Petya should step on the first and last stairs, so if the first or the last stair is dirty, then Petya cannot choose a path with clean steps only.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=109, 0<=≤<=*m*<=≤<=3000) — the number of stairs in the staircase and the number of dirty stairs, correspondingly. The second line contains *m* different space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=*n*) — the numbers of the dirty stairs (in an arbitrary order).
Output Specification:
Print "YES" if Petya can reach stair number *n*, stepping only on the clean stairs. Otherwise print "NO".
Demo Input:
['10 5\n2 4 8 3 6\n', '10 5\n2 4 5 7 9\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
a,b=map(int,input().split())
l=list(map(int,input().split()))
l.sort()
x=True
for i in range(b-2):
if l[i+1]==l[i]+1 and l[i+2]==l[i]+2:
x=False
if l[0]==1 or l[-1]==a:
print('NO')
elif x:
print("YES")
else:
print('NO')
```
| -1
|
|
716
|
A
|
Crazy Computer
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
|
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
|
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
|
[
"6 5\n1 3 8 14 19 20\n",
"6 1\n1 3 5 7 9 10\n"
] |
[
"3",
"2"
] |
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
| 500
|
[
{
"input": "6 5\n1 3 8 14 19 20",
"output": "3"
},
{
"input": "6 1\n1 3 5 7 9 10",
"output": "2"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "5 5\n1 7 12 13 14",
"output": "4"
},
{
"input": "2 1000000000\n1 1000000000",
"output": "2"
},
{
"input": "3 5\n1 10 20",
"output": "1"
},
{
"input": "3 10\n1 2 3",
"output": "3"
},
{
"input": "2 1\n1 100",
"output": "1"
},
{
"input": "3 1\n1 2 10",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
}
] | 1,687,611,243
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 54
| 108
| 13,824,000
|
n, c = map(int,input().split())
lista = list(map(int,input().split()))
szavak = 1
for i in range(n-1,1,-1):
if lista[i]-lista[i-1]>c:
break
else:
szavak += 1
print(szavak)
|
Title: Crazy Computer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
ZS the Coder is coding on a crazy computer. If you don't type in a word for a *c* consecutive seconds, everything you typed disappear!
More formally, if you typed a word at second *a* and then the next word at second *b*, then if *b*<=-<=*a*<=≤<=*c*, just the new word is appended to other words on the screen. If *b*<=-<=*a*<=><=*c*, then everything on the screen disappears and after that the word you have typed appears on the screen.
For example, if *c*<==<=5 and you typed words at seconds 1,<=3,<=8,<=14,<=19,<=20 then at the second 8 there will be 3 words on the screen. After that, everything disappears at the second 13 because nothing was typed. At the seconds 14 and 19 another two words are typed, and finally, at the second 20, one more word is typed, and a total of 3 words remain on the screen.
You're given the times when ZS the Coder typed the words. Determine how many words remain on the screen after he finished typing everything.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*c*<=≤<=109) — the number of words ZS the Coder typed and the crazy computer delay respectively.
The next line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=...<=<<=*t**n*<=≤<=109), where *t**i* denotes the second when ZS the Coder typed the *i*-th word.
Output Specification:
Print a single positive integer, the number of words that remain on the screen after all *n* words was typed, in other words, at the second *t**n*.
Demo Input:
['6 5\n1 3 8 14 19 20\n', '6 1\n1 3 5 7 9 10\n']
Demo Output:
['3', '2']
Note:
The first sample is already explained in the problem statement.
For the second sample, after typing the first word at the second 1, it disappears because the next word is typed at the second 3 and 3 - 1 > 1. Similarly, only 1 word will remain at the second 9. Then, a word is typed at the second 10, so there will be two words on the screen, as the old word won't disappear because 10 - 9 ≤ 1.
|
```python
n, c = map(int,input().split())
lista = list(map(int,input().split()))
szavak = 1
for i in range(n-1,1,-1):
if lista[i]-lista[i-1]>c:
break
else:
szavak += 1
print(szavak)
```
| 0
|
|
1,006
|
B
|
Polycarp's Practice
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Polycarp is practicing his problem solving skill. He has a list of $n$ problems with difficulties $a_1, a_2, \dots, a_n$, respectively. His plan is to practice for exactly $k$ days. Each day he has to solve at least one problem from his list. Polycarp solves the problems in the order they are given in his list, he cannot skip any problem from his list. He has to solve all $n$ problems in exactly $k$ days.
Thus, each day Polycarp solves a contiguous sequence of (consecutive) problems from the start of the list. He can't skip problems or solve them multiple times. As a result, in $k$ days he will solve all the $n$ problems.
The profit of the $j$-th day of Polycarp's practice is the maximum among all the difficulties of problems Polycarp solves during the $j$-th day (i.e. if he solves problems with indices from $l$ to $r$ during a day, then the profit of the day is $\max\limits_{l \le i \le r}a_i$). The total profit of his practice is the sum of the profits over all $k$ days of his practice.
You want to help Polycarp to get the maximum possible total profit over all valid ways to solve problems. Your task is to distribute all $n$ problems between $k$ days satisfying the conditions above in such a way, that the total profit is maximum.
For example, if $n = 8, k = 3$ and $a = [5, 4, 2, 6, 5, 1, 9, 2]$, one of the possible distributions with maximum total profit is: $[5, 4, 2], [6, 5], [1, 9, 2]$. Here the total profit equals $5 + 6 + 9 = 20$.
|
The first line of the input contains two integers $n$ and $k$ ($1 \le k \le n \le 2000$) — the number of problems and the number of days, respectively.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 2000$) — difficulties of problems in Polycarp's list, in the order they are placed in the list (i.e. in the order Polycarp will solve them).
|
In the first line of the output print the maximum possible total profit.
In the second line print exactly $k$ positive integers $t_1, t_2, \dots, t_k$ ($t_1 + t_2 + \dots + t_k$ must equal $n$), where $t_j$ means the number of problems Polycarp will solve during the $j$-th day in order to achieve the maximum possible total profit of his practice.
If there are many possible answers, you may print any of them.
|
[
"8 3\n5 4 2 6 5 1 9 2\n",
"5 1\n1 1 1 1 1\n",
"4 2\n1 2000 2000 2\n"
] |
[
"20\n3 2 3",
"1\n5\n",
"4000\n2 2\n"
] |
The first example is described in the problem statement.
In the second example there is only one possible distribution.
In the third example the best answer is to distribute problems in the following way: $[1, 2000], [2000, 2]$. The total profit of this distribution is $2000 + 2000 = 4000$.
| 0
|
[
{
"input": "8 3\n5 4 2 6 5 1 9 2",
"output": "20\n4 1 3"
},
{
"input": "5 1\n1 1 1 1 1",
"output": "1\n5"
},
{
"input": "4 2\n1 2000 2000 2",
"output": "4000\n2 2"
},
{
"input": "1 1\n2000",
"output": "2000\n1"
},
{
"input": "1 1\n1234",
"output": "1234\n1"
},
{
"input": "3 2\n1 1 1",
"output": "2\n2 1"
},
{
"input": "4 2\n3 5 1 1",
"output": "8\n1 3"
},
{
"input": "5 3\n5 5 6 7 1",
"output": "18\n2 1 2"
},
{
"input": "6 4\n1 1 1 1 2 2",
"output": "6\n3 1 1 1"
},
{
"input": "5 3\n5 5 6 6 4",
"output": "17\n2 1 2"
},
{
"input": "16 15\n14 4 9 12 17 1 1 8 12 13 6 9 17 2 18 12",
"output": "154\n1 1 1 1 1 2 1 1 1 1 1 1 1 1 1"
},
{
"input": "1 1\n1996",
"output": "1996\n1"
},
{
"input": "5 3\n5 5 5 9 10",
"output": "24\n3 1 1"
},
{
"input": "18 15\n18 2 13 1 18 3 2 18 18 20 9 2 20 20 4 20 9 12",
"output": "204\n1 2 2 1 2 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "5 3\n1 20 20 50 50",
"output": "120\n3 1 1"
},
{
"input": "8 3\n15 14 11 19 17 14 14 8",
"output": "51\n1 3 4"
},
{
"input": "5 2\n15 20 6 19 6",
"output": "39\n2 3"
},
{
"input": "6 3\n5 5 5 5 6 9",
"output": "20\n4 1 1"
},
{
"input": "5 3\n2 2 2 3 3",
"output": "8\n3 1 1"
},
{
"input": "7 3\n2 2 2 2 2 3 3",
"output": "8\n5 1 1"
},
{
"input": "6 5\n1 1 6 6 6 6",
"output": "25\n2 1 1 1 1"
},
{
"input": "8 4\n1 2 2 2 2 3 4 5",
"output": "14\n5 1 1 1"
},
{
"input": "6 4\n1 1 1 5 5 5",
"output": "16\n3 1 1 1"
},
{
"input": "6 3\n1 2 2 2 4 5",
"output": "11\n4 1 1"
},
{
"input": "18 6\n17 17 19 14 10 20 18 16 6 7 2 15 14 16 13 6 12 11",
"output": "107\n1 1 1 3 1 11"
},
{
"input": "6 3\n1 1 2 2 3 4",
"output": "9\n4 1 1"
},
{
"input": "8 3\n5 4 2 5 6 1 9 2",
"output": "20\n4 1 3"
}
] | 1,628,096,632
| 3,411
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 109
| 21,401,600
|
n, k = map(int, input().split())
a = [int(i) for i in input().split()]
ans = []
s = []
if k == 1:
print(max(a))
print(sum(a))
exit()
else:
for i in range(0, n, k):
w = a[i:i + k]
ans.append(len(w))
s.append(max(w))
print(sum(s))
for i in ans:
print(i, end=' ')
|
Title: Polycarp's Practice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is practicing his problem solving skill. He has a list of $n$ problems with difficulties $a_1, a_2, \dots, a_n$, respectively. His plan is to practice for exactly $k$ days. Each day he has to solve at least one problem from his list. Polycarp solves the problems in the order they are given in his list, he cannot skip any problem from his list. He has to solve all $n$ problems in exactly $k$ days.
Thus, each day Polycarp solves a contiguous sequence of (consecutive) problems from the start of the list. He can't skip problems or solve them multiple times. As a result, in $k$ days he will solve all the $n$ problems.
The profit of the $j$-th day of Polycarp's practice is the maximum among all the difficulties of problems Polycarp solves during the $j$-th day (i.e. if he solves problems with indices from $l$ to $r$ during a day, then the profit of the day is $\max\limits_{l \le i \le r}a_i$). The total profit of his practice is the sum of the profits over all $k$ days of his practice.
You want to help Polycarp to get the maximum possible total profit over all valid ways to solve problems. Your task is to distribute all $n$ problems between $k$ days satisfying the conditions above in such a way, that the total profit is maximum.
For example, if $n = 8, k = 3$ and $a = [5, 4, 2, 6, 5, 1, 9, 2]$, one of the possible distributions with maximum total profit is: $[5, 4, 2], [6, 5], [1, 9, 2]$. Here the total profit equals $5 + 6 + 9 = 20$.
Input Specification:
The first line of the input contains two integers $n$ and $k$ ($1 \le k \le n \le 2000$) — the number of problems and the number of days, respectively.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 2000$) — difficulties of problems in Polycarp's list, in the order they are placed in the list (i.e. in the order Polycarp will solve them).
Output Specification:
In the first line of the output print the maximum possible total profit.
In the second line print exactly $k$ positive integers $t_1, t_2, \dots, t_k$ ($t_1 + t_2 + \dots + t_k$ must equal $n$), where $t_j$ means the number of problems Polycarp will solve during the $j$-th day in order to achieve the maximum possible total profit of his practice.
If there are many possible answers, you may print any of them.
Demo Input:
['8 3\n5 4 2 6 5 1 9 2\n', '5 1\n1 1 1 1 1\n', '4 2\n1 2000 2000 2\n']
Demo Output:
['20\n3 2 3', '1\n5\n', '4000\n2 2\n']
Note:
The first example is described in the problem statement.
In the second example there is only one possible distribution.
In the third example the best answer is to distribute problems in the following way: $[1, 2000], [2000, 2]$. The total profit of this distribution is $2000 + 2000 = 4000$.
|
```python
n, k = map(int, input().split())
a = [int(i) for i in input().split()]
ans = []
s = []
if k == 1:
print(max(a))
print(sum(a))
exit()
else:
for i in range(0, n, k):
w = a[i:i + k]
ans.append(len(w))
s.append(max(w))
print(sum(s))
for i in ans:
print(i, end=' ')
```
| 0
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,673,997,947
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
word=str(input())
c,s=0,0
for i in word:
if ord(i)>=65 and ord(i)<=90:
c+=1
elif ord(i)>=97 and ord(i)<=122:
s+=1
if s>=c:
print(word.lower())
elif c>s:
print(word.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
word=str(input())
c,s=0,0
for i in word:
if ord(i)>=65 and ord(i)<=90:
c+=1
elif ord(i)>=97 and ord(i)<=122:
s+=1
if s>=c:
print(word.lower())
elif c>s:
print(word.upper())
```
| 3.977
|
96
|
A
|
Football
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] |
A. Football
|
2
|
256
|
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
|
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
|
Print "YES" if the situation is dangerous. Otherwise, print "NO".
|
[
"001001\n",
"1000000001\n"
] |
[
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "001001",
"output": "NO"
},
{
"input": "1000000001",
"output": "YES"
},
{
"input": "00100110111111101",
"output": "YES"
},
{
"input": "11110111111111111",
"output": "YES"
},
{
"input": "01",
"output": "NO"
},
{
"input": "10100101",
"output": "NO"
},
{
"input": "1010010100000000010",
"output": "YES"
},
{
"input": "101010101",
"output": "NO"
},
{
"input": "000000000100000000000110101100000",
"output": "YES"
},
{
"input": "100001000000110101100000",
"output": "NO"
},
{
"input": "100001000011010110000",
"output": "NO"
},
{
"input": "010",
"output": "NO"
},
{
"input": "10101011111111111111111111111100",
"output": "YES"
},
{
"input": "1001101100",
"output": "NO"
},
{
"input": "1001101010",
"output": "NO"
},
{
"input": "1111100111",
"output": "NO"
},
{
"input": "00110110001110001111",
"output": "NO"
},
{
"input": "11110001001111110001",
"output": "NO"
},
{
"input": "10001111001011111101",
"output": "NO"
},
{
"input": "10000010100000001000110001010100001001001010011",
"output": "YES"
},
{
"input": "01111011111010111100101100001011001010111110000010",
"output": "NO"
},
{
"input": "00100000100100101110011001011011101110110110010100",
"output": "NO"
},
{
"input": "10110100110001001011110101110010100010000000000100101010111110111110100011",
"output": "YES"
},
{
"input": "00011101010101111001011011001101101011111101000010100000111000011100101011",
"output": "NO"
},
{
"input": "01110000110100110101110100111000101101011101011110110100100111100001110111",
"output": "NO"
},
{
"input": "11110110011000100111100111101101011111110100010101011011111101110110110111",
"output": "YES"
},
{
"input": "100100010101110010001011001110100011100010011110100101100011010001001010001001101111001100",
"output": "NO"
},
{
"input": "111110010001011010010011111100110110001111000010100011011100111101111101110010101111011110000001010",
"output": "NO"
},
{
"input": "111110111100010100000100001010111011101011000111011011011010110010100010000101011111000011010011110",
"output": "NO"
},
{
"input": "1011110110111010110111111010010010100011111011110000011000110010011110111010110100011010100010111000",
"output": "NO"
},
{
"input": "0010100111100010110110000011100111110100111110001010000100111111111010111100101101010101001011010110",
"output": "YES"
},
{
"input": "1111010100010100101011101100101101110011000010100010000001111100010011100101010001101111000001011000",
"output": "NO"
},
{
"input": "0101100011001110001110100111100011010101011000000000110110010010111100101111010111100011101100100101",
"output": "YES"
},
{
"input": "0001101110011101110000000010011111101001101111100001001010110000110001100000010001111011011110001101",
"output": "YES"
},
{
"input": "1000010000100000100010000100001000010000100001000010000100001000010000100001000010000100001000010000",
"output": "NO"
},
{
"input": "1000000000100000000010000000001000000000100000000010000000001000000000100000000010000000001000000000",
"output": "YES"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "YES"
},
{
"input": "1111111111111111111111111111111111111111011111111111111111111111111111111111111111111111111111111111",
"output": "YES"
},
{
"input": "10100101000",
"output": "NO"
},
{
"input": "11110111011101",
"output": "NO"
},
{
"input": "10000000",
"output": "YES"
},
{
"input": "00000001",
"output": "YES"
},
{
"input": "01111111",
"output": "YES"
},
{
"input": "11111110",
"output": "YES"
}
] | 1,688,108,406
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 62
| 0
|
players = input()
danger = 0
dangerous = None
for i in range(len(players)) :
if i == len(players) - 1:
break
if danger == 7 :
break
elif players[i] == players[i+1] :
danger += 1
else :
danger = 0
if danger >= 7 :
dangerous = "YES"
else :
dangerous = "NO"
print(dangerous)
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
Input Specification:
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
Output Specification:
Print "YES" if the situation is dangerous. Otherwise, print "NO".
Demo Input:
['001001\n', '1000000001\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none
|
```python
players = input()
danger = 0
dangerous = None
for i in range(len(players)) :
if i == len(players) - 1:
break
if danger == 7 :
break
elif players[i] == players[i+1] :
danger += 1
else :
danger = 0
if danger >= 7 :
dangerous = "YES"
else :
dangerous = "NO"
print(dangerous)
```
| 0
|
959
|
A
|
Mahmoud and Ehab and the even-odd game
|
PROGRAMMING
| 800
|
[
"games",
"math"
] | null | null |
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that:
- 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd.
If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
|
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
|
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
|
[
"1\n",
"2\n"
] |
[
"Ehab",
"Mahmoud"
] |
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins.
In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
| 500
|
[
{
"input": "1",
"output": "Ehab"
},
{
"input": "2",
"output": "Mahmoud"
},
{
"input": "10000",
"output": "Mahmoud"
},
{
"input": "33333",
"output": "Ehab"
},
{
"input": "5",
"output": "Ehab"
},
{
"input": "1000000000",
"output": "Mahmoud"
},
{
"input": "999999999",
"output": "Ehab"
},
{
"input": "123123123",
"output": "Ehab"
},
{
"input": "22222221",
"output": "Ehab"
},
{
"input": "22222220",
"output": "Mahmoud"
},
{
"input": "3",
"output": "Ehab"
},
{
"input": "4",
"output": "Mahmoud"
},
{
"input": "6",
"output": "Mahmoud"
},
{
"input": "7",
"output": "Ehab"
},
{
"input": "8",
"output": "Mahmoud"
},
{
"input": "9",
"output": "Ehab"
},
{
"input": "10",
"output": "Mahmoud"
},
{
"input": "536870912",
"output": "Mahmoud"
},
{
"input": "536870913",
"output": "Ehab"
},
{
"input": "536870911",
"output": "Ehab"
}
] | 1,651,135,693
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 31
| 0
|
n = int(input())
if n % 2:
res = 'Ehab'
else:
res = 'Mahmoud'
print(res)
|
Title: Mahmoud and Ehab and the even-odd game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mahmoud and Ehab play a game called the even-odd game. Ehab chooses his favorite integer *n* and then they take turns, starting from Mahmoud. In each player's turn, he has to choose an integer *a* and subtract it from *n* such that:
- 1<=≤<=*a*<=≤<=*n*. - If it's Mahmoud's turn, *a* has to be even, but if it's Ehab's turn, *a* has to be odd.
If the current player can't choose any number satisfying the conditions, he loses. Can you determine the winner if they both play optimally?
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=109), the number at the beginning of the game.
Output Specification:
Output "Mahmoud" (without quotes) if Mahmoud wins and "Ehab" (without quotes) otherwise.
Demo Input:
['1\n', '2\n']
Demo Output:
['Ehab', 'Mahmoud']
Note:
In the first sample, Mahmoud can't choose any integer *a* initially because there is no positive even integer less than or equal to 1 so Ehab wins.
In the second sample, Mahmoud has to choose *a* = 2 and subtract it from *n*. It's Ehab's turn and *n* = 0. There is no positive odd integer less than or equal to 0 so Mahmoud wins.
|
```python
n = int(input())
if n % 2:
res = 'Ehab'
else:
res = 'Mahmoud'
print(res)
```
| 3
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,676,029,629
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 46
| 0
|
n = input()
m = input()
o = ''
for i in range(len(n)):
if bool(int(n[i]))^bool(int(m[i])):
o += '1'
else:
o += '0'
print(o)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
n = input()
m = input()
o = ''
for i in range(len(n)):
if bool(int(n[i]))^bool(int(m[i])):
o += '1'
else:
o += '0'
print(o)
```
| 3.9885
|
918
|
B
|
Radio Station
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
|
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
|
Print *m* lines, the commands in the configuration file after Dustin did his task.
|
[
"2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n",
"3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n"
] |
[
"block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n",
"redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n"
] |
none
| 1,000
|
[
{
"input": "2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;",
"output": "block 192.168.0.1; #replica\nproxy 192.168.0.2; #main"
},
{
"input": "3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;",
"output": "redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server"
},
{
"input": "10 10\nittmcs 112.147.123.173\njkt 228.40.73.178\nfwckqtz 88.28.31.198\nkal 224.226.34.213\nnacuyokm 49.57.13.44\nfouynv 243.18.250.17\ns 45.248.83.247\ne 75.69.23.169\nauwoqlch 100.44.219.187\nlkldjq 46.123.169.140\ngjcylatwzi 46.123.169.140;\ndxfi 88.28.31.198;\ngv 46.123.169.140;\nety 88.28.31.198;\notbmgcrn 46.123.169.140;\nw 112.147.123.173;\np 75.69.23.169;\nvdsnigk 46.123.169.140;\nmmc 46.123.169.140;\ngtc 49.57.13.44;",
"output": "gjcylatwzi 46.123.169.140; #lkldjq\ndxfi 88.28.31.198; #fwckqtz\ngv 46.123.169.140; #lkldjq\nety 88.28.31.198; #fwckqtz\notbmgcrn 46.123.169.140; #lkldjq\nw 112.147.123.173; #ittmcs\np 75.69.23.169; #e\nvdsnigk 46.123.169.140; #lkldjq\nmmc 46.123.169.140; #lkldjq\ngtc 49.57.13.44; #nacuyokm"
},
{
"input": "1 1\nervbfot 185.32.99.2\nzygoumbmx 185.32.99.2;",
"output": "zygoumbmx 185.32.99.2; #ervbfot"
},
{
"input": "1 2\ny 245.182.246.189\nlllq 245.182.246.189;\nxds 245.182.246.189;",
"output": "lllq 245.182.246.189; #y\nxds 245.182.246.189; #y"
},
{
"input": "2 1\ntdwmshz 203.115.124.110\neksckjya 201.80.191.212\nzbtjzzue 203.115.124.110;",
"output": "zbtjzzue 203.115.124.110; #tdwmshz"
},
{
"input": "8 5\nfhgkq 5.19.189.178\nphftablcr 75.18.177.178\nxnpcg 158.231.167.176\ncfahrkq 26.165.124.191\nfkgtnqtfoh 230.13.13.129\nt 101.24.94.85\nvjoirslx 59.6.179.72\ntwktmskb 38.194.117.184\nrvzzlygosc 26.165.124.191;\ndcsgxrkgv 101.24.94.85;\nyvmyppn 59.6.179.72;\ngpdjjuq 75.18.177.178;\nvdviz 101.24.94.85;",
"output": "rvzzlygosc 26.165.124.191; #cfahrkq\ndcsgxrkgv 101.24.94.85; #t\nyvmyppn 59.6.179.72; #vjoirslx\ngpdjjuq 75.18.177.178; #phftablcr\nvdviz 101.24.94.85; #t"
},
{
"input": "2 1\nmain 1.1.1.1\nget 11.1.1.1\ncommand 11.1.1.1;",
"output": "command 11.1.1.1; #get"
},
{
"input": "2 2\nmain 0.0.0.255\nmainn 0.0.2.55\nblock 0.0.0.255;\nblock 0.0.2.55;",
"output": "block 0.0.0.255; #main\nblock 0.0.2.55; #mainn"
},
{
"input": "2 2\nmain 0.0.63.0\nreplica 0.38.0.56\nblock 0.0.63.0;\nproxy 0.38.0.56;",
"output": "block 0.0.63.0; #main\nproxy 0.38.0.56; #replica"
},
{
"input": "2 2\nmain 192.168.10.12\nreplica 192.167.10.12\nblock 192.168.10.12;\nproxy 192.167.10.12;",
"output": "block 192.168.10.12; #main\nproxy 192.167.10.12; #replica"
},
{
"input": "2 1\nneserver 185.218.47.91\nserver 255.255.255.255\nblock 255.255.255.255;",
"output": "block 255.255.255.255; #server"
},
{
"input": "2 1\nalp 22.222.30.10\nbet 222.22.30.10\nblock 22.222.30.10;",
"output": "block 22.222.30.10; #alp"
}
] | 1,673,127,050
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 46
| 0
|
n, m = list(map(int, input().split()))
dic = {}
for i in range(n):
a, b = input().split()
dic[b] = a
for i in range(m):
linea = input()
a, b = linea.split()
print("{} #{}".format(linea, dic[b[0:-1]]))
|
Title: Radio Station
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As the guys fried the radio station facilities, the school principal gave them tasks as a punishment. Dustin's task was to add comments to nginx configuration for school's website. The school has *n* servers. Each server has a name and an ip (names aren't necessarily unique, but ips are). Dustin knows the ip and name of each server. For simplicity, we'll assume that an nginx command is of form "command ip;" where command is a string consisting of English lowercase letter only, and ip is the ip of one of school servers.
Each ip is of form "a.b.c.d" where *a*, *b*, *c* and *d* are non-negative integers less than or equal to 255 (with no leading zeros). The nginx configuration file Dustin has to add comments to has *m* commands. Nobody ever memorizes the ips of servers, so to understand the configuration better, Dustin has to comment the name of server that the ip belongs to at the end of each line (after each command). More formally, if a line is "command ip;" Dustin has to replace it with "command ip; #name" where name is the name of the server with ip equal to ip.
Dustin doesn't know anything about nginx, so he panicked again and his friends asked you to do his task for him.
Input Specification:
The first line of input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000).
The next *n* lines contain the names and ips of the servers. Each line contains a string name, name of the server and a string ip, ip of the server, separated by space (1<=≤<=|*name*|<=≤<=10, *name* only consists of English lowercase letters). It is guaranteed that all ip are distinct.
The next *m* lines contain the commands in the configuration file. Each line is of form "command ip;" (1<=≤<=|*command*|<=≤<=10, command only consists of English lowercase letters). It is guaranteed that ip belongs to one of the *n* school servers.
Output Specification:
Print *m* lines, the commands in the configuration file after Dustin did his task.
Demo Input:
['2 2\nmain 192.168.0.2\nreplica 192.168.0.1\nblock 192.168.0.1;\nproxy 192.168.0.2;\n', '3 5\ngoogle 8.8.8.8\ncodeforces 212.193.33.27\nserver 138.197.64.57\nredirect 138.197.64.57;\nblock 8.8.8.8;\ncf 212.193.33.27;\nunblock 8.8.8.8;\ncheck 138.197.64.57;\n']
Demo Output:
['block 192.168.0.1; #replica\nproxy 192.168.0.2; #main\n', 'redirect 138.197.64.57; #server\nblock 8.8.8.8; #google\ncf 212.193.33.27; #codeforces\nunblock 8.8.8.8; #google\ncheck 138.197.64.57; #server\n']
Note:
none
|
```python
n, m = list(map(int, input().split()))
dic = {}
for i in range(n):
a, b = input().split()
dic[b] = a
for i in range(m):
linea = input()
a, b = linea.split()
print("{} #{}".format(linea, dic[b[0:-1]]))
```
| 3
|
|
837
|
A
|
Text Volume
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
|
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
|
Print one integer number — volume of text.
|
[
"7\nNonZERO\n",
"24\nthis is zero answer text\n",
"24\nHarbour Space University\n"
] |
[
"5\n",
"0\n",
"1\n"
] |
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters.
| 0
|
[
{
"input": "7\nNonZERO",
"output": "5"
},
{
"input": "24\nthis is zero answer text",
"output": "0"
},
{
"input": "24\nHarbour Space University",
"output": "1"
},
{
"input": "2\nWM",
"output": "2"
},
{
"input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz",
"output": "105"
},
{
"input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g",
"output": "1"
},
{
"input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez",
"output": "50"
},
{
"input": "1\ne",
"output": "0"
},
{
"input": "1\nA",
"output": "1"
},
{
"input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ",
"output": "10"
},
{
"input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "200"
},
{
"input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "24\nHarbour Space UniversitY",
"output": "2"
},
{
"input": "5\naA AA",
"output": "2"
},
{
"input": "10\nas AS ASDA",
"output": "4"
},
{
"input": "10\nas AS ASDZ",
"output": "4"
},
{
"input": "3\na A",
"output": "1"
},
{
"input": "24\nHarbour space UniversitY",
"output": "2"
},
{
"input": "10\nas AS ASAa",
"output": "3"
},
{
"input": "15\naAb ABCDFGRHTJS",
"output": "11"
},
{
"input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR",
"output": "6"
},
{
"input": "10\nABC ABc AB",
"output": "3"
},
{
"input": "10\nA c de CDE",
"output": "3"
},
{
"input": "4\nA AB",
"output": "2"
},
{
"input": "18\nHARbour Space UNIV",
"output": "4"
},
{
"input": "13\na b c d e f A",
"output": "1"
},
{
"input": "6\nA B CA",
"output": "2"
},
{
"input": "4\naa A",
"output": "1"
},
{
"input": "3\nA a",
"output": "1"
}
] | 1,676,497,991
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 46
| 0
|
n = input()
l = list(input().split())
x = []
for i in l:
v = 0
for j in i:
if 90 >= ord(j) >= 65:
v += 1
x.append(v)
print(max(x))
|
Title: Text Volume
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Output Specification:
Print one integer number — volume of text.
Demo Input:
['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n']
Demo Output:
['5\n', '0\n', '1\n']
Note:
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters.
|
```python
n = input()
l = list(input().split())
x = []
for i in l:
v = 0
for j in i:
if 90 >= ord(j) >= 65:
v += 1
x.append(v)
print(max(x))
```
| 3
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,685,656,513
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
import math
n,m,a = l = [int(i) for i in input().split()]
if n <= a and m <= a :
print(1)
else:
x = n / a
y = m / a
ans = math.floor(x) + math.floor(y)
if a <= m or a <= n:
ans -= 1
if not x.is_integer():
ans += 1
if not y.is_integer():
ans += 1
print(ans)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
import math
n,m,a = l = [int(i) for i in input().split()]
if n <= a and m <= a :
print(1)
else:
x = n / a
y = m / a
ans = math.floor(x) + math.floor(y)
if a <= m or a <= n:
ans -= 1
if not x.is_integer():
ans += 1
if not y.is_integer():
ans += 1
print(ans)
```
| 0
|
305
|
C
|
Ivan and Powers of Two
|
PROGRAMMING
| 1,600
|
[
"greedy",
"implementation"
] | null | null |
Ivan has got an array of *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. Ivan knows that the array is sorted in the non-decreasing order.
Ivan wrote out integers 2*a*1,<=2*a*2,<=...,<=2*a**n* on a piece of paper. Now he wonders, what minimum number of integers of form 2*b* (*b*<=≥<=0) need to be added to the piece of paper so that the sum of all integers written on the paper equalled 2*v*<=-<=1 for some integer *v* (*v*<=≥<=0).
Help Ivan, find the required quantity of numbers.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The second input line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=2·109). It is guaranteed that *a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n*.
|
Print a single integer — the answer to the problem.
|
[
"4\n0 1 1 1\n",
"1\n3\n"
] |
[
"0\n",
"3\n"
] |
In the first sample you do not need to add anything, the sum of numbers already equals 2<sup class="upper-index">3</sup> - 1 = 7.
In the second sample you need to add numbers 2<sup class="upper-index">0</sup>, 2<sup class="upper-index">1</sup>, 2<sup class="upper-index">2</sup>.
| 1,500
|
[
{
"input": "4\n0 1 1 1",
"output": "0"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n2000000000",
"output": "2000000000"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "26\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 2",
"output": "5"
}
] | 1,553,623,826
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 2
| 500
| 7,987,200
|
n = int(input())
s = input().split(" ") #n non-negative integers
a = map(int, s)
a = list(sorted(a))
soma = 0
for i in range(len(a)):
soma += 2**a[i]
#conta zeros na representação binária
s = format(soma, 'b')
count = 0
for i in range(len(s)):
if s[i] == '0':
count += 1
print(count)
|
Title: Ivan and Powers of Two
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan has got an array of *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. Ivan knows that the array is sorted in the non-decreasing order.
Ivan wrote out integers 2*a*1,<=2*a*2,<=...,<=2*a**n* on a piece of paper. Now he wonders, what minimum number of integers of form 2*b* (*b*<=≥<=0) need to be added to the piece of paper so that the sum of all integers written on the paper equalled 2*v*<=-<=1 for some integer *v* (*v*<=≥<=0).
Help Ivan, find the required quantity of numbers.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The second input line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=2·109). It is guaranteed that *a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n*.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['4\n0 1 1 1\n', '1\n3\n']
Demo Output:
['0\n', '3\n']
Note:
In the first sample you do not need to add anything, the sum of numbers already equals 2<sup class="upper-index">3</sup> - 1 = 7.
In the second sample you need to add numbers 2<sup class="upper-index">0</sup>, 2<sup class="upper-index">1</sup>, 2<sup class="upper-index">2</sup>.
|
```python
n = int(input())
s = input().split(" ") #n non-negative integers
a = map(int, s)
a = list(sorted(a))
soma = 0
for i in range(len(a)):
soma += 2**a[i]
#conta zeros na representação binária
s = format(soma, 'b')
count = 0
for i in range(len(s)):
if s[i] == '0':
count += 1
print(count)
```
| 0
|
|
474
|
B
|
Worms
|
PROGRAMMING
| 1,200
|
[
"binary search",
"implementation"
] | null | null |
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
|
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
|
[
"5\n2 7 3 4 9\n3\n1 25 11\n"
] |
[
"1\n5\n3\n"
] |
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
| 1,000
|
[
{
"input": "5\n2 7 3 4 9\n3\n1 25 11",
"output": "1\n5\n3"
}
] | 1,686,347,880
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 38
| 436
| 27,852,800
|
def binarySearch(num,start,end):
middle = (end + start)//2
if worms[middle][0]<=num<=worms[middle][1]:
return middle
if num < worms[middle][0] :
return binarySearch(num,start,middle)
if num > worms[middle][1]:
return binarySearch(num,middle,end)
n = int(input())
a = list(map(int,input().split()))
m = int(input())
q = list(map(int,input().split()))
worms = []
start = 1
for i in range(n):
end = start + a[i] -1
worms.append([start,end])
start = end+1
for j in q:
print(binarySearch(j,0,n)+1)
|
Title: Worms
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Output Specification:
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
Demo Input:
['5\n2 7 3 4 9\n3\n1 25 11\n']
Demo Output:
['1\n5\n3\n']
Note:
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
|
```python
def binarySearch(num,start,end):
middle = (end + start)//2
if worms[middle][0]<=num<=worms[middle][1]:
return middle
if num < worms[middle][0] :
return binarySearch(num,start,middle)
if num > worms[middle][1]:
return binarySearch(num,middle,end)
n = int(input())
a = list(map(int,input().split()))
m = int(input())
q = list(map(int,input().split()))
worms = []
start = 1
for i in range(n):
end = start + a[i] -1
worms.append([start,end])
start = end+1
for j in q:
print(binarySearch(j,0,n)+1)
```
| 3
|
|
177
|
A1
|
Good Matrix Elements
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The Smart Beaver from ABBYY got hooked on square matrices. Now he is busy studying an *n*<=×<=*n* size matrix, where *n* is odd. The Smart Beaver considers the following matrix elements good:
- Elements of the main diagonal. - Elements of the secondary diagonal. - Elements of the "middle" row — the row which has exactly rows above it and the same number of rows below it. - Elements of the "middle" column — the column that has exactly columns to the left of it and the same number of columns to the right of it.
Help the Smart Beaver count the sum of good elements of the given matrix.
|
The first line of input data contains a single odd integer *n*. Each of the next *n* lines contains *n* integers *a**ij* (0<=≤<=*a**ij*<=≤<=100) separated by single spaces — the elements of the given matrix.
The input limitations for getting 30 points are:
- 1<=≤<=*n*<=≤<=5
The input limitations for getting 100 points are:
- 1<=≤<=*n*<=≤<=101
|
Print a single integer — the sum of good matrix elements.
|
[
"3\n1 2 3\n4 5 6\n7 8 9\n",
"5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n"
] |
[
"45\n",
"17\n"
] |
In the first sample all matrix elements will be good. Good elements in the second sample are shown on the figure.
| 30
|
[
{
"input": "3\n1 2 3\n4 5 6\n7 8 9",
"output": "45"
},
{
"input": "5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1",
"output": "17"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "5\n27 7 3 11 72\n19 49 68 19 59\n41 25 37 64 65\n8 39 96 62 90\n13 37 43 26 33",
"output": "756"
},
{
"input": "3\n19 7 16\n12 15 5\n15 15 5",
"output": "109"
},
{
"input": "3\n36 4 33\n11 46 32\n20 49 34",
"output": "265"
},
{
"input": "3\n79 91 74\n33 82 22\n18 28 54",
"output": "481"
},
{
"input": "5\n7 0 8 1 7\n5 1 1 0 4\n4 2 8 1 6\n1 2 3 2 7\n6 0 1 9 6",
"output": "65"
},
{
"input": "5\n27 20 28 11 17\n25 21 1 20 14\n14 22 28 1 6\n1 2 23 2 7\n6 0 1 29 6",
"output": "225"
},
{
"input": "5\n57 50 58 41 17\n25 21 1 50 44\n44 22 28 31 36\n31 32 23 32 37\n6 0 31 59 6",
"output": "495"
},
{
"input": "5\n57 80 28 41 47\n85 51 61 50 74\n44 82 28 31 36\n31 32 23 32 37\n66 60 31 59 6",
"output": "705"
},
{
"input": "5\n13 58 10 17 43\n61 73 100 0 9\n52 38 16 22 96\n11 4 14 67 62\n70 89 7 98 83",
"output": "708"
},
{
"input": "5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "5\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "5\n0 1 0 1 0\n0 0 0 0 1\n0 0 5 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "5"
},
{
"input": "5\n0 0 0 0 1\n0 1 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "3\n0 0 0\n0 0 0\n0 0 0",
"output": "0"
}
] | 1,591,241,351
| 2,147,483,647
|
Python 3
|
OK
|
TESTS1
| 17
| 186
| 0
|
n=int(input())
a=[]
sum=0
m=int(n/2)
for i in range(n):
a.append(list(map(int,input().split())))
for i in range(n):
sum+=a[i][i]+a[i][n-i-1]+a[i][m]+a[m][i]
print(sum-(a[m][m]*3))
|
Title: Good Matrix Elements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Smart Beaver from ABBYY got hooked on square matrices. Now he is busy studying an *n*<=×<=*n* size matrix, where *n* is odd. The Smart Beaver considers the following matrix elements good:
- Elements of the main diagonal. - Elements of the secondary diagonal. - Elements of the "middle" row — the row which has exactly rows above it and the same number of rows below it. - Elements of the "middle" column — the column that has exactly columns to the left of it and the same number of columns to the right of it.
Help the Smart Beaver count the sum of good elements of the given matrix.
Input Specification:
The first line of input data contains a single odd integer *n*. Each of the next *n* lines contains *n* integers *a**ij* (0<=≤<=*a**ij*<=≤<=100) separated by single spaces — the elements of the given matrix.
The input limitations for getting 30 points are:
- 1<=≤<=*n*<=≤<=5
The input limitations for getting 100 points are:
- 1<=≤<=*n*<=≤<=101
Output Specification:
Print a single integer — the sum of good matrix elements.
Demo Input:
['3\n1 2 3\n4 5 6\n7 8 9\n', '5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1\n']
Demo Output:
['45\n', '17\n']
Note:
In the first sample all matrix elements will be good. Good elements in the second sample are shown on the figure.
|
```python
n=int(input())
a=[]
sum=0
m=int(n/2)
for i in range(n):
a.append(list(map(int,input().split())))
for i in range(n):
sum+=a[i][i]+a[i][n-i-1]+a[i][m]+a[m][i]
print(sum-(a[m][m]*3))
```
| 3
|
|
740
|
B
|
Alyona and flowers
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms"
] | null | null |
Little Alyona is celebrating Happy Birthday! Her mother has an array of *n* flowers. Each flower has some mood, the mood of *i*-th flower is *a**i*. The mood can be positive, zero or negative.
Let's define a subarray as a segment of consecutive flowers. The mother suggested some set of subarrays. Alyona wants to choose several of the subarrays suggested by her mother. After that, each of the flowers will add to the girl's happiness its mood multiplied by the number of chosen subarrays the flower is in.
For example, consider the case when the mother has 5 flowers, and their moods are equal to 1,<=<=-<=2,<=1,<=3,<=<=-<=4. Suppose the mother suggested subarrays (1,<=<=-<=2), (3,<=<=-<=4), (1,<=3), (1,<=<=-<=2,<=1,<=3). Then if the girl chooses the third and the fourth subarrays then:
- the first flower adds 1·1<==<=1 to the girl's happiness, because he is in one of chosen subarrays, - the second flower adds (<=-<=2)·1<==<=<=-<=2, because he is in one of chosen subarrays, - the third flower adds 1·2<==<=2, because he is in two of chosen subarrays, - the fourth flower adds 3·2<==<=6, because he is in two of chosen subarrays, - the fifth flower adds (<=-<=4)·0<==<=0, because he is in no chosen subarrays.
Thus, in total 1<=+<=(<=-<=2)<=+<=2<=+<=6<=+<=0<==<=7 is added to the girl's happiness. Alyona wants to choose such subarrays from those suggested by the mother that the value added to her happiness would be as large as possible. Help her do this!
Alyona can choose any number of the subarrays, even 0 or all suggested by her mother.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of flowers and the number of subarrays suggested by the mother.
The second line contains the flowers moods — *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=100<=≤<=*a**i*<=≤<=100).
The next *m* lines contain the description of the subarrays suggested by the mother. The *i*-th of these lines contain two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) denoting the subarray *a*[*l**i*],<=*a*[*l**i*<=+<=1],<=...,<=*a*[*r**i*].
Each subarray can encounter more than once.
|
Print single integer — the maximum possible value added to the Alyona's happiness.
|
[
"5 4\n1 -2 1 3 -4\n1 2\n4 5\n3 4\n1 4\n",
"4 3\n1 2 3 4\n1 3\n2 4\n1 1\n",
"2 2\n-1 -2\n1 1\n1 2\n"
] |
[
"7\n",
"16\n",
"0\n"
] |
The first example is the situation described in the statements.
In the second example Alyona should choose all subarrays.
The third example has answer 0 because Alyona can choose none of the subarrays.
| 1,000
|
[
{
"input": "5 4\n1 -2 1 3 -4\n1 2\n4 5\n3 4\n1 4",
"output": "7"
},
{
"input": "4 3\n1 2 3 4\n1 3\n2 4\n1 1",
"output": "16"
},
{
"input": "2 2\n-1 -2\n1 1\n1 2",
"output": "0"
},
{
"input": "5 6\n1 1 1 -1 0\n2 4\n1 3\n4 5\n1 5\n1 4\n4 5",
"output": "8"
},
{
"input": "8 3\n5 -4 -2 5 3 -4 -2 6\n3 8\n4 6\n2 3",
"output": "10"
},
{
"input": "10 10\n0 0 0 0 0 0 0 0 0 0\n5 9\n1 9\n5 7\n3 8\n1 6\n1 9\n1 6\n6 9\n1 10\n3 8",
"output": "0"
},
{
"input": "3 6\n0 0 0\n1 1\n1 1\n1 3\n3 3\n2 3\n1 2",
"output": "0"
},
{
"input": "3 3\n1 -1 3\n1 2\n2 3\n1 3",
"output": "5"
},
{
"input": "6 8\n0 6 -5 8 -3 -2\n6 6\n2 3\n5 6\n4 6\n3 4\n2 5\n3 3\n5 6",
"output": "13"
},
{
"input": "10 4\n6 5 5 -1 0 5 0 -3 5 -4\n3 6\n4 9\n1 6\n1 4",
"output": "50"
},
{
"input": "9 1\n-1 -1 -1 -1 2 -1 2 0 0\n2 5",
"output": "0"
},
{
"input": "3 8\n3 4 4\n1 2\n1 3\n2 3\n1 2\n2 2\n1 1\n2 3\n1 3",
"output": "59"
},
{
"input": "3 8\n6 7 -1\n1 1\n1 3\n2 2\n1 3\n1 3\n1 1\n2 3\n2 3",
"output": "67"
},
{
"input": "53 7\n-43 57 92 97 85 -29 28 -8 -37 -47 51 -53 -95 -50 -39 -87 43 36 60 -95 93 8 67 -22 -78 -46 99 93 27 -72 -84 77 96 -47 1 -12 21 -98 -34 -88 57 -43 5 -15 20 -66 61 -29 30 -85 52 53 82\n15 26\n34 43\n37 41\n22 34\n19 43\n2 15\n13 35",
"output": "170"
},
{
"input": "20 42\n61 86 5 -87 -33 51 -79 17 -3 65 -42 74 -94 40 -35 22 58 81 -75 5\n3 6\n12 13\n3 16\n3 16\n5 7\n5 16\n2 15\n6 18\n4 18\n10 17\n14 16\n4 15\n4 11\n13 20\n5 6\n5 15\n16 17\n3 14\n9 10\n5 19\n5 14\n2 4\n17 20\n10 11\n5 18\n10 11\n1 14\n1 6\n1 10\n8 16\n11 14\n12 20\n11 13\n4 5\n2 13\n1 5\n11 15\n1 18\n3 8\n8 20\n1 4\n10 13",
"output": "1502"
},
{
"input": "64 19\n-47 13 19 51 -25 72 38 32 54 7 -49 -50 -59 73 45 -87 -15 -72 -32 -10 -7 47 -34 35 48 -73 79 25 -80 -34 4 77 60 30 61 -25 23 17 -73 -73 69 29 -50 -55 53 15 -33 7 -46 -5 85 -86 77 -51 87 -69 -64 -24 -64 29 -20 -58 11 -26\n6 53\n13 28\n15 47\n20 52\n12 22\n6 49\n31 54\n2 39\n32 49\n27 64\n22 63\n33 48\n49 58\n39 47\n6 29\n21 44\n24 59\n20 24\n39 54",
"output": "804"
},
{
"input": "1 10\n-46\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "0"
},
{
"input": "10 7\n44 18 9 -22 -23 7 -25 -2 15 35\n6 8\n6 7\n3 3\n2 6\n9 10\n2 2\n1 5",
"output": "103"
},
{
"input": "4 3\n10 -2 68 35\n4 4\n1 1\n1 3",
"output": "121"
},
{
"input": "3 6\n27 -31 -81\n2 3\n2 3\n1 1\n1 2\n1 2\n2 2",
"output": "27"
},
{
"input": "7 3\n-24 -12 16 -43 -30 31 16\n3 6\n3 4\n1 7",
"output": "0"
},
{
"input": "10 7\n-33 -24 -86 -20 5 -91 38 -12 -90 -67\n7 8\n7 10\n4 7\n1 3\n6 10\n6 6\n3 5",
"output": "26"
},
{
"input": "4 4\n95 35 96 -27\n3 4\n3 3\n4 4\n3 3",
"output": "261"
},
{
"input": "7 7\n-33 26 -25 44 -20 -50 33\n4 6\n4 4\n3 7\n5 7\n1 4\n2 5\n4 6",
"output": "81"
},
{
"input": "5 3\n-35 -39 93 59 -4\n2 2\n2 3\n2 5",
"output": "163"
},
{
"input": "3 7\n0 0 0\n1 2\n1 2\n2 3\n3 3\n1 3\n1 2\n2 3",
"output": "0"
},
{
"input": "8 2\n17 32 30 -6 -39 -15 33 74\n6 6\n8 8",
"output": "74"
},
{
"input": "8 1\n-20 -15 21 -21 1 -12 -7 9\n4 7",
"output": "0"
},
{
"input": "7 9\n-23 -4 -44 -47 -35 47 25\n1 6\n3 5\n4 7\n6 7\n2 4\n2 3\n2 7\n1 2\n5 5",
"output": "72"
},
{
"input": "8 8\n0 6 -25 -15 29 -24 31 23\n2 8\n5 5\n3 3\n2 8\n6 6\n3 6\n3 4\n2 4",
"output": "79"
},
{
"input": "4 3\n-39 -63 9 -16\n1 4\n1 3\n2 4",
"output": "0"
},
{
"input": "9 1\n-3 -13 -13 -19 -4 -11 8 -11 -3\n9 9",
"output": "0"
},
{
"input": "9 6\n25 18 -62 0 33 62 -23 4 -15\n7 9\n2 3\n1 4\n2 6\n1 6\n2 3",
"output": "127"
},
{
"input": "4 5\n-12 39 8 -12\n1 4\n3 4\n1 3\n1 3\n2 3",
"output": "140"
},
{
"input": "3 9\n-9 7 3\n1 2\n1 1\n1 3\n1 2\n2 3\n1 3\n2 2\n1 2\n3 3",
"output": "22"
},
{
"input": "10 7\n0 4 3 3 -2 -2 -4 -2 -3 -2\n5 6\n1 10\n2 10\n7 10\n1 1\n6 7\n3 4",
"output": "6"
},
{
"input": "86 30\n16 -12 11 16 8 14 7 -29 18 30 -32 -10 20 29 -14 -21 23 -19 -15 17 -2 25 -22 2 26 15 -7 -12 -4 -28 21 -4 -2 22 28 -32 9 -20 23 38 -21 21 37 -13 -30 25 31 6 18 29 29 29 27 38 -15 -32 32 -7 -8 -33 -11 24 23 -19 -36 -36 -18 9 -1 32 -34 -26 1 -1 -16 -14 17 -17 15 -24 38 5 -27 -12 8 -38\n60 66\n29 48\n32 51\n38 77\n17 79\n23 74\n39 50\n14 29\n26 76\n9 76\n2 67\n23 48\n17 68\n33 75\n59 78\n46 78\n9 69\n16 83\n18 21\n17 34\n24 61\n15 79\n4 31\n62 63\n46 76\n79 82\n25 39\n5 81\n19 77\n26 71",
"output": "3076"
},
{
"input": "33 17\n11 6 -19 14 23 -23 21 15 29 19 13 -18 -19 20 16 -10 26 -22 3 17 13 -10 19 22 -5 21 12 6 28 -13 -27 25 6\n4 17\n12 16\n9 17\n25 30\n31 32\n4 28\n11 24\n16 19\n3 27\n7 17\n1 16\n15 28\n30 33\n9 31\n14 30\n13 23\n27 27",
"output": "1366"
},
{
"input": "16 44\n32 23 -27 -2 -10 -42 32 -14 -13 4 9 -2 19 35 16 22\n6 12\n8 11\n13 15\n12 12\n3 10\n9 13\n7 15\n2 11\n1 13\n5 6\n9 14\n3 16\n10 13\n3 15\n6 10\n14 16\n4 5\n7 10\n5 14\n1 16\n2 5\n1 6\n9 10\n4 7\n4 12\n2 5\n7 10\n7 9\n2 8\n9 10\n4 10\n7 12\n10 11\n6 6\n15 15\n8 12\n9 10\n3 3\n4 15\n10 12\n7 16\n4 14\n14 16\n5 6",
"output": "777"
},
{
"input": "63 24\n-23 -46 0 33 24 13 39 -6 -4 49 19 -18 -11 -38 0 -3 -33 -17 -4 -44 -22 -12 -16 42 16 -10 7 37 -6 16 -41 -18 -20 51 -49 28 -14 -22 -37 -7 -50 31 -41 -47 18 -8 -39 -29 35 -32 14 -29 44 -29 -19 -25 -47 -8 16 11 20 12 38\n21 61\n35 61\n29 61\n21 34\n12 48\n32 33\n9 27\n4 42\n4 60\n37 61\n19 44\n46 60\n51 53\n31 34\n23 32\n5 29\n43 59\n7 31\n29 48\n15 50\n19 51\n7 28\n17 41\n1 62",
"output": "82"
},
{
"input": "6 51\n45 -33 -17 -48 2 2\n2 5\n1 1\n1 3\n5 5\n4 6\n1 2\n2 3\n3 4\n1 6\n4 6\n3 5\n1 5\n2 2\n2 6\n4 6\n1 5\n1 5\n1 5\n1 6\n6 6\n3 5\n6 6\n1 6\n3 4\n3 3\n2 4\n3 3\n1 4\n2 4\n5 6\n4 5\n2 4\n1 5\n1 2\n4 5\n1 5\n5 6\n2 2\n3 4\n1 3\n1 2\n2 5\n3 6\n4 6\n3 4\n2 4\n1 4\n1 1\n4 6\n3 5\n1 4",
"output": "140"
},
{
"input": "3 5\n2 -1 3\n2 3\n2 3\n2 3\n2 3\n1 2",
"output": "9"
},
{
"input": "4 30\n1 1 1 1\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4\n1 4",
"output": "120"
}
] | 1,690,449,590
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 11
| 31
| 0
|
# 1<= n,m <= 100
# -100 <= ai <= 100
def solve(n,m,arr,subarr):
# mood of ith flower is ai.
# If we get negative as ans then print 0
# Cuz we can always choose none.
# Choose subarrays with sum>=0
# That's all
hm = set()
for l,r in subarr :
hm.add((l-1,r-1))
ans = 0
for st in range(n):
tsum = 0
for en in range(st,n):
# We can choose that
tsum += arr[en]
if (st,en) in hm and tsum>=0 :
ans+=tsum
print(ans)
n,m = map(int,input().split())
arr= list(map(int,list(input().split())))
subarr = []
for i in range(m):
li,ri = map(int,input().split())
subarr.append([li,ri])
solve(n,m,arr,subarr)
|
Title: Alyona and flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Alyona is celebrating Happy Birthday! Her mother has an array of *n* flowers. Each flower has some mood, the mood of *i*-th flower is *a**i*. The mood can be positive, zero or negative.
Let's define a subarray as a segment of consecutive flowers. The mother suggested some set of subarrays. Alyona wants to choose several of the subarrays suggested by her mother. After that, each of the flowers will add to the girl's happiness its mood multiplied by the number of chosen subarrays the flower is in.
For example, consider the case when the mother has 5 flowers, and their moods are equal to 1,<=<=-<=2,<=1,<=3,<=<=-<=4. Suppose the mother suggested subarrays (1,<=<=-<=2), (3,<=<=-<=4), (1,<=3), (1,<=<=-<=2,<=1,<=3). Then if the girl chooses the third and the fourth subarrays then:
- the first flower adds 1·1<==<=1 to the girl's happiness, because he is in one of chosen subarrays, - the second flower adds (<=-<=2)·1<==<=<=-<=2, because he is in one of chosen subarrays, - the third flower adds 1·2<==<=2, because he is in two of chosen subarrays, - the fourth flower adds 3·2<==<=6, because he is in two of chosen subarrays, - the fifth flower adds (<=-<=4)·0<==<=0, because he is in no chosen subarrays.
Thus, in total 1<=+<=(<=-<=2)<=+<=2<=+<=6<=+<=0<==<=7 is added to the girl's happiness. Alyona wants to choose such subarrays from those suggested by the mother that the value added to her happiness would be as large as possible. Help her do this!
Alyona can choose any number of the subarrays, even 0 or all suggested by her mother.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of flowers and the number of subarrays suggested by the mother.
The second line contains the flowers moods — *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=100<=≤<=*a**i*<=≤<=100).
The next *m* lines contain the description of the subarrays suggested by the mother. The *i*-th of these lines contain two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) denoting the subarray *a*[*l**i*],<=*a*[*l**i*<=+<=1],<=...,<=*a*[*r**i*].
Each subarray can encounter more than once.
Output Specification:
Print single integer — the maximum possible value added to the Alyona's happiness.
Demo Input:
['5 4\n1 -2 1 3 -4\n1 2\n4 5\n3 4\n1 4\n', '4 3\n1 2 3 4\n1 3\n2 4\n1 1\n', '2 2\n-1 -2\n1 1\n1 2\n']
Demo Output:
['7\n', '16\n', '0\n']
Note:
The first example is the situation described in the statements.
In the second example Alyona should choose all subarrays.
The third example has answer 0 because Alyona can choose none of the subarrays.
|
```python
# 1<= n,m <= 100
# -100 <= ai <= 100
def solve(n,m,arr,subarr):
# mood of ith flower is ai.
# If we get negative as ans then print 0
# Cuz we can always choose none.
# Choose subarrays with sum>=0
# That's all
hm = set()
for l,r in subarr :
hm.add((l-1,r-1))
ans = 0
for st in range(n):
tsum = 0
for en in range(st,n):
# We can choose that
tsum += arr[en]
if (st,en) in hm and tsum>=0 :
ans+=tsum
print(ans)
n,m = map(int,input().split())
arr= list(map(int,list(input().split())))
subarr = []
for i in range(m):
li,ri = map(int,input().split())
subarr.append([li,ri])
solve(n,m,arr,subarr)
```
| 0
|
|
855
|
A
|
Tom Riddle's Diary
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
|
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
|
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
|
[
"6\ntom\nlucius\nginny\nharry\nginny\nharry\n",
"3\na\na\na\n"
] |
[
"NO\nNO\nNO\nNO\nYES\nYES\n",
"NO\nYES\nYES\n"
] |
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES".
| 500
|
[
{
"input": "6\ntom\nlucius\nginny\nharry\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nYES\nYES"
},
{
"input": "3\na\na\na",
"output": "NO\nYES\nYES"
},
{
"input": "1\nzn",
"output": "NO"
},
{
"input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth",
"output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES"
},
{
"input": "1\nz",
"output": "NO"
},
{
"input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO"
},
{
"input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr",
"output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES"
},
{
"input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES"
},
{
"input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO\nNO\nNO"
},
{
"input": "2\nab\nba",
"output": "NO\nNO"
},
{
"input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde",
"output": "NO\nYES"
},
{
"input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na",
"output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,641,352,670
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 55
| 46
| 0
|
a=int (input ())
v1=[]
for i in range (a):
b=input()
if (b in v1):
print("YES")
else:
print("NO")
v1.append(b)
|
Title: Tom Riddle's Diary
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
Input Specification:
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output Specification:
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
Demo Input:
['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n']
Demo Output:
['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n']
Note:
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES".
|
```python
a=int (input ())
v1=[]
for i in range (a):
b=input()
if (b in v1):
print("YES")
else:
print("NO")
v1.append(b)
```
| 3
|
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,588,496,058
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 109
| 0
|
n = int(input())
a = []
mid = n//2
for i in range(n):
a.append([])
x = abs(mid - i)
for j in range(n):
if j >= x and j <= n-x-1:
a[i].append('D')
else:
a[i].append('*')
for i in range(n):
print(*a[i])
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
n = int(input())
a = []
mid = n//2
for i in range(n):
a.append([])
x = abs(mid - i)
for j in range(n):
if j >= x and j <= n-x-1:
a[i].append('D')
else:
a[i].append('*')
for i in range(n):
print(*a[i])
```
| 0
|
|
514
|
A
|
Chewbaсca and Number
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
|
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
|
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
|
[
"27\n",
"4545\n"
] |
[
"22\n",
"4444\n"
] |
none
| 500
|
[
{
"input": "27",
"output": "22"
},
{
"input": "4545",
"output": "4444"
},
{
"input": "1",
"output": "1"
},
{
"input": "9",
"output": "9"
},
{
"input": "8772",
"output": "1222"
},
{
"input": "81",
"output": "11"
},
{
"input": "71723447",
"output": "21223442"
},
{
"input": "91730629",
"output": "91230320"
},
{
"input": "420062703497",
"output": "420032203402"
},
{
"input": "332711047202",
"output": "332211042202"
},
{
"input": "3395184971407775",
"output": "3304114021402224"
},
{
"input": "8464062628894325",
"output": "1434032321104324"
},
{
"input": "164324828731963982",
"output": "134324121231033012"
},
{
"input": "384979173822804784",
"output": "314020123122104214"
},
{
"input": "41312150450968417",
"output": "41312140440031412"
},
{
"input": "2156",
"output": "2143"
},
{
"input": "1932",
"output": "1032"
},
{
"input": "5902",
"output": "4002"
},
{
"input": "5728",
"output": "4221"
},
{
"input": "8537",
"output": "1432"
},
{
"input": "55403857",
"output": "44403142"
},
{
"input": "270739",
"output": "220230"
},
{
"input": "28746918",
"output": "21243011"
},
{
"input": "10279211",
"output": "10220211"
},
{
"input": "40289679",
"output": "40210320"
},
{
"input": "545203238506",
"output": "444203231403"
},
{
"input": "461117063340",
"output": "431112033340"
},
{
"input": "658492686568",
"output": "341402313431"
},
{
"input": "857373361868",
"output": "142323331131"
},
{
"input": "429325660016",
"output": "420324330013"
},
{
"input": "9894448650287940",
"output": "9104441340212040"
},
{
"input": "6354510839296263",
"output": "3344410130203233"
},
{
"input": "6873575462224593",
"output": "3123424432224403"
},
{
"input": "4237951492601449",
"output": "4232041402301440"
},
{
"input": "2680352384836991",
"output": "2310342314133001"
},
{
"input": "606187734191890310",
"output": "303112234101100310"
},
{
"input": "351499943576823355",
"output": "341400043423123344"
},
{
"input": "180593481782177068",
"output": "110403411212122031"
},
{
"input": "999999999999999999",
"output": "900000000000000000"
},
{
"input": "1000000000000000000",
"output": "1000000000000000000"
},
{
"input": "9999",
"output": "9000"
},
{
"input": "99",
"output": "90"
},
{
"input": "9991",
"output": "9001"
}
] | 1,683,282,215
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 62
| 0
|
str=input()
for it in str:
print(min(int(it), 9-int(it)), end="")
|
Title: Chewbaсca and Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
Output Specification:
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
Demo Input:
['27\n', '4545\n']
Demo Output:
['22\n', '4444\n']
Note:
none
|
```python
str=input()
for it in str:
print(min(int(it), 9-int(it)), end="")
```
| 0
|
|
1,000
|
B
|
Light It Up
|
PROGRAMMING
| 1,500
|
[
"greedy"
] | null | null |
Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp.
The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 < a_1 < a_2 < \dots < a_{|a|} < M$. All $a_i$ must be integers. Of course, preinstalled program is a good program.
The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state.
Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$.
Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up.
|
First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off.
Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 < a_1 < a_2 < \dots < a_n < M$) — initially installed program $a$.
|
Print the only integer — maximum possible total time when the lamp is lit.
|
[
"3 10\n4 6 7\n",
"2 12\n1 10\n",
"2 7\n3 4\n"
] |
[
"8\n",
"9\n",
"6\n"
] |
In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place.
In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$.
In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$.
| 0
|
[
{
"input": "3 10\n4 6 7",
"output": "8"
},
{
"input": "2 12\n1 10",
"output": "9"
},
{
"input": "2 7\n3 4",
"output": "6"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "5 10\n1 3 5 6 8",
"output": "6"
},
{
"input": "7 1000000000\n1 10001 10011 20011 20021 40021 40031",
"output": "999999969"
},
{
"input": "7 1000000000\n3 10001 10011 20011 20021 40021 40031",
"output": "999999969"
},
{
"input": "1 10\n1",
"output": "9"
},
{
"input": "1 10000000\n1",
"output": "9999999"
},
{
"input": "1 8\n1",
"output": "7"
},
{
"input": "7 17\n1 5 9 10 11 14 16",
"output": "9"
},
{
"input": "4 17\n1 5 9 10",
"output": "12"
},
{
"input": "5 12\n1 2 3 4 5",
"output": "9"
},
{
"input": "2 1000000000\n100 111",
"output": "999999989"
},
{
"input": "3 90591\n90579 90580 90581",
"output": "90589"
},
{
"input": "5 16\n1 2 3 4 5",
"output": "13"
},
{
"input": "6 981231233\n1 6 15 30 130 1875",
"output": "981229468"
},
{
"input": "1 3\n1",
"output": "2"
},
{
"input": "3 12\n4 7 11",
"output": "8"
},
{
"input": "1 100000\n1",
"output": "99999"
},
{
"input": "2 5\n1 3",
"output": "3"
},
{
"input": "1 1000000000\n1",
"output": "999999999"
},
{
"input": "1 1000000000\n999999999",
"output": "999999999"
},
{
"input": "3 4\n1 2 3",
"output": "2"
},
{
"input": "3 5\n1 2 3",
"output": "3"
},
{
"input": "1 4\n2",
"output": "3"
},
{
"input": "3 5\n1 3 4",
"output": "3"
},
{
"input": "9 20\n5 9 11 12 14 15 16 17 19",
"output": "12"
},
{
"input": "2 4\n1 2",
"output": "3"
},
{
"input": "1 10\n2",
"output": "9"
},
{
"input": "2 6\n2 4",
"output": "4"
},
{
"input": "2 4\n1 3",
"output": "2"
},
{
"input": "3 6\n1 2 4",
"output": "4"
},
{
"input": "7 9863\n65 96 97 98 101 112 1115",
"output": "9819"
}
] | 1,665,730,619
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 19
| 1,000
| 8,499,200
|
import copy
momentNum,M=map(int,input().split())
momentList=list(map(int,input().split()))
timeList=[momentList[0]]
if momentNum>1:
for i in range(1,momentNum):
timeList.append(momentList[i]-momentList[i-1])
timeList.append(M-momentList[-1])
output=sum(timeList[::2])
for i in range(len(timeList)):
if timeList[i]==1:
continue
else:
output=max(output,sum(timeList[:i:2])+timeList[i]+sum(timeList[i+i%2+1::2])-1)
print(output)
|
Title: Light It Up
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp.
The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 < a_1 < a_2 < \dots < a_{|a|} < M$. All $a_i$ must be integers. Of course, preinstalled program is a good program.
The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state.
Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$.
Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up.
Input Specification:
First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off.
Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 < a_1 < a_2 < \dots < a_n < M$) — initially installed program $a$.
Output Specification:
Print the only integer — maximum possible total time when the lamp is lit.
Demo Input:
['3 10\n4 6 7\n', '2 12\n1 10\n', '2 7\n3 4\n']
Demo Output:
['8\n', '9\n', '6\n']
Note:
In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place.
In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$.
In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$.
|
```python
import copy
momentNum,M=map(int,input().split())
momentList=list(map(int,input().split()))
timeList=[momentList[0]]
if momentNum>1:
for i in range(1,momentNum):
timeList.append(momentList[i]-momentList[i-1])
timeList.append(M-momentList[-1])
output=sum(timeList[::2])
for i in range(len(timeList)):
if timeList[i]==1:
continue
else:
output=max(output,sum(timeList[:i:2])+timeList[i]+sum(timeList[i+i%2+1::2])-1)
print(output)
```
| 0
|
|
607
|
A
|
Chain Reaction
|
PROGRAMMING
| 1,600
|
[
"binary search",
"dp"
] | null | null |
There are *n* beacons located at distinct positions on a number line. The *i*-th beacon has position *a**i* and power level *b**i*. When the *i*-th beacon is activated, it destroys all beacons to its left (direction of decreasing coordinates) within distance *b**i* inclusive. The beacon itself is not destroyed however. Saitama will activate the beacons one at a time from right to left. If a beacon is destroyed, it cannot be activated.
Saitama wants Genos to add a beacon strictly to the right of all the existing beacons, with any position and any power level, such that the least possible number of beacons are destroyed. Note that Genos's placement of the beacon means it will be the first beacon activated. Help Genos by finding the minimum number of beacons that could be destroyed.
|
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the initial number of beacons.
The *i*-th of next *n* lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=1<=000<=000, 1<=≤<=*b**i*<=≤<=1<=000<=000) — the position and power level of the *i*-th beacon respectively. No two beacons will have the same position, so *a**i*<=≠<=*a**j* if *i*<=≠<=*j*.
|
Print a single integer — the minimum number of beacons that could be destroyed if exactly one beacon is added.
|
[
"4\n1 9\n3 1\n6 1\n7 4\n",
"7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n"
] |
[
"1\n",
"3\n"
] |
For the first sample case, the minimum number of beacons destroyed is 1. One way to achieve this is to place a beacon at position 9 with power level 2.
For the second sample case, the minimum number of beacons destroyed is 3. One way to achieve this is to place a beacon at position 1337 with power level 42.
| 500
|
[
{
"input": "4\n1 9\n3 1\n6 1\n7 4",
"output": "1"
},
{
"input": "7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1",
"output": "3"
},
{
"input": "1\n0 1",
"output": "0"
},
{
"input": "1\n0 1000000",
"output": "0"
},
{
"input": "1\n1000000 1000000",
"output": "0"
},
{
"input": "7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 6\n7 7",
"output": "4"
},
{
"input": "5\n1 1\n3 1\n5 1\n7 10\n8 10",
"output": "2"
},
{
"input": "11\n110 90\n100 70\n90 10\n80 10\n70 1\n60 1\n50 10\n40 1\n30 1\n10 1\n20 1",
"output": "4"
}
] | 1,688,507,271
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 8
| 217
| 25,088,000
|
import sys
input = lambda: sys.stdin.readline().rstrip()
from collections import deque,defaultdict,Counter
from itertools import permutations,combinations
from bisect import *
from heapq import *
from math import ceil,gcd,lcm,floor,comb
alph = 'abcdefghijklmnopqrstuvwxyz'
#pow(x,mod-2,mod)
N = int(input())
A = [list(map(int,input().split())) for _ in range(N)]
dp = [0]*N
ma = [0]*N
ma[0] = 1
dp[0] = 1
l = [A[0][0]]
for i in range(1,N):
x = bisect_left(l,A[i][0]-A[i][1])
if x-1>=0 and l[x-1]<A[i][0]-A[i][1]:
dp[i] = ma[x-1]+1
ma[i] = max(ma[i],dp[i-1],dp[i])
l.append(A[i][0])
print(N-max(dp))
|
Title: Chain Reaction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* beacons located at distinct positions on a number line. The *i*-th beacon has position *a**i* and power level *b**i*. When the *i*-th beacon is activated, it destroys all beacons to its left (direction of decreasing coordinates) within distance *b**i* inclusive. The beacon itself is not destroyed however. Saitama will activate the beacons one at a time from right to left. If a beacon is destroyed, it cannot be activated.
Saitama wants Genos to add a beacon strictly to the right of all the existing beacons, with any position and any power level, such that the least possible number of beacons are destroyed. Note that Genos's placement of the beacon means it will be the first beacon activated. Help Genos by finding the minimum number of beacons that could be destroyed.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the initial number of beacons.
The *i*-th of next *n* lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=1<=000<=000, 1<=≤<=*b**i*<=≤<=1<=000<=000) — the position and power level of the *i*-th beacon respectively. No two beacons will have the same position, so *a**i*<=≠<=*a**j* if *i*<=≠<=*j*.
Output Specification:
Print a single integer — the minimum number of beacons that could be destroyed if exactly one beacon is added.
Demo Input:
['4\n1 9\n3 1\n6 1\n7 4\n', '7\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n']
Demo Output:
['1\n', '3\n']
Note:
For the first sample case, the minimum number of beacons destroyed is 1. One way to achieve this is to place a beacon at position 9 with power level 2.
For the second sample case, the minimum number of beacons destroyed is 3. One way to achieve this is to place a beacon at position 1337 with power level 42.
|
```python
import sys
input = lambda: sys.stdin.readline().rstrip()
from collections import deque,defaultdict,Counter
from itertools import permutations,combinations
from bisect import *
from heapq import *
from math import ceil,gcd,lcm,floor,comb
alph = 'abcdefghijklmnopqrstuvwxyz'
#pow(x,mod-2,mod)
N = int(input())
A = [list(map(int,input().split())) for _ in range(N)]
dp = [0]*N
ma = [0]*N
ma[0] = 1
dp[0] = 1
l = [A[0][0]]
for i in range(1,N):
x = bisect_left(l,A[i][0]-A[i][1])
if x-1>=0 and l[x-1]<A[i][0]-A[i][1]:
dp[i] = ma[x-1]+1
ma[i] = max(ma[i],dp[i-1],dp[i])
l.append(A[i][0])
print(N-max(dp))
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Let's consider one interesting word game. In this game you should transform one word into another through special operations.
Let's say we have word *w*, let's split this word into two non-empty parts *x* and *y* so, that *w*<==<=*xy*. A split operation is transforming word *w*<==<=*xy* into word *u*<==<=*yx*. For example, a split operation can transform word "wordcut" into word "cutword".
You are given two words *start* and *end*. Count in how many ways we can transform word *start* into word *end*, if we apply exactly *k* split operations consecutively to word *start*.
Two ways are considered different if the sequences of applied operations differ. Two operation sequences are different if exists such number *i* (1<=≤<=*i*<=≤<=*k*), that in the *i*-th operation of the first sequence the word splits into parts *x* and *y*, in the *i*-th operation of the second sequence the word splits into parts *a* and *b*, and additionally *x*<=≠<=*a* holds.
|
The first line contains a non-empty word *start*, the second line contains a non-empty word *end*. The words consist of lowercase Latin letters. The number of letters in word *start* equals the number of letters in word *end* and is at least 2 and doesn't exceed 1000 letters.
The third line contains integer *k* (0<=≤<=*k*<=≤<=105) — the required number of operations.
|
Print a single number — the answer to the problem. As this number can be rather large, print it modulo 1000000007 (109<=+<=7).
|
[
"ab\nab\n2\n",
"ababab\nababab\n1\n",
"ab\nba\n2\n"
] |
[
"1\n",
"2\n",
"0\n"
] |
The sought way in the first sample is:
ab → a|b → ba → b|a → ab
In the second sample the two sought ways are:
- ababab → abab|ab → ababab - ababab → ab|abab → ababab
| 0
|
[
{
"input": "ab\nab\n2",
"output": "1"
},
{
"input": "ababab\nababab\n1",
"output": "2"
},
{
"input": "ab\nba\n2",
"output": "0"
},
{
"input": "aaa\naaa\n0",
"output": "1"
},
{
"input": "hi\nhi\n1",
"output": "0"
},
{
"input": "abcd\ncbad\n5",
"output": "0"
},
{
"input": "ab\nba\n10",
"output": "0"
},
{
"input": "voodoo\ndoovoo\n100000",
"output": "792428974"
},
{
"input": "ababab\nbababa\n100000",
"output": "377286908"
},
{
"input": "abcdefgh\ncdefghab\n666",
"output": "83913683"
},
{
"input": "aaaabaaaaaaaaaaabaaaaaaa\naaaaaaaaaabaaaaaaaaabaaa\n7477",
"output": "0"
},
{
"input": "ssgqcodnqgfbhqsgineioafkkhcmmmihbiefialidgkffrhaiekebpieqgpplmsgmghphjsfgpscrbcgrssbccqroffnfgkfohljdarbpqmkolldcjcfhpodeqmgbdddlgoolesecdqsochdfgjsmorbnmiinjlpda\nljdarbpqmkolldcjcfhpodeqmgbdddlgoolesecdqsochdfgjsmorbnmiinjlpdassgqcodnqgfbhqsgineioafkkhcmmmihbiefialidgkffrhaiekebpieqgpplmsgmghphjsfgpscrbcgrssbccqroffnfgkfoh\n50897",
"output": "222669762"
},
{
"input": "jfemedqrsqaopiekdosgjnhbshanggdqqpkhepjfrkgkshepbmkdnidmpgfojjjbeddkelccoqapnpkqbimlbgagllioqbdgnsejqcbicjbbijjlrjmkkarjdoganmfsmfohlspbsoldfspdacasgsrcndlhg\nhepbmkdnidmpgfojjjbeddkelccoqapnpkqbimlbgagllioqbdgnsejqcbicjbbijjlrjmkkarjdoganmfsmfohlspbsoldfspdacasgsrcndlhgjfemedqrsqaopiekdosgjnhbshanggdqqpkhepjfrkgks\n6178",
"output": "568786732"
},
{
"input": "aaeddddadbcacbdccaeeeddecadbecbbcebdcdbcddcadcadccecccecdbabd\nadbecbbcebdcdbcddcadcadccecccecdbabdaaeddddadbcacbdccaeeeddec\n55400",
"output": "471327413"
},
{
"input": "chajciihijjbjcgaedebdcjaaeaiffiggfdfbdjhikhbiijhbjciebgkadbbekijadafhjhgiidfjkjbgcdfdgjjfficbagghkdgdhdedihifcfkedcefcdfjaagiehccjbjhihcbdakbjfjdgakkfagddhekccbdjhejhakfccgghkdc\ndafhjhgiidfjkjbgcdfdgjjfficbagghkdgdhdedihifcfkedcefcdfjaagiehccjbjhihcbdakbjfjdgakkfagddhekccbdjhejhakfccgghkdcchajciihijjbjcgaedebdcjaaeaiffiggfdfbdjhikhbiijhbjciebgkadbbekija\n67572",
"output": "18146811"
},
{
"input": "dkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjijdkjij\ndddkikjjidkkidijjjjkkjjikjdikiidijjikikjijjiijdikkjjjiddjjijkkkjkiijijkijdjjikikdjjjijdddjkjjdijjjjjjjddkjjkjjjdjjdkijjkijkkjkkkiiijdjijkkdjdjjjkkjkdddjidjjijdddkijididjdddidijjjjjdkidijjkkjiijkjjjjjjdjkkdddkjj\n31328",
"output": "0"
},
{
"input": "lnxjsxjjfbrhijshlptgogxstvaybbueilocmaqwhlauulubpwtjtsdktgrowgbkhdotemhstqtxnpspmxjxrqymonnpcvrendrfxbwqxeedyamwvyyytxtmorkovoeklkabyexrfseimlaqlibaoaaeae\nalxckgrkneuqrqstpxormswxsyhaaoebqhfspyqjbxgytrpdoybxmmenllxxrrjtxtvhaoidjmaekiflxykmpnwageytemoewalwihbunbnvomqbututijjvdsbelrxestajokwysctfptalvegdahlboo\n44031",
"output": "0"
},
{
"input": "cfacacbfaeadfdbedfdccdccdddaaa\ncbfaeadfdbedfdccdccdddaaacfaca\n15215",
"output": "668863397"
},
{
"input": "xxx\nyyy\n0",
"output": "0"
},
{
"input": "abc\ncba\n0",
"output": "0"
},
{
"input": "ab\nba\n0",
"output": "0"
},
{
"input": "abc\nabc\n1",
"output": "0"
},
{
"input": "ab\nba\n9",
"output": "1"
},
{
"input": "ab\nba\n10",
"output": "0"
},
{
"input": "aa\naa\n1",
"output": "1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n100000",
"output": "486606280"
},
{
"input": "aaaba\naaaad\n0",
"output": "0"
}
] | 1,685,537,509
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 3
| 124
| 0
|
s = list(input())
t = list(input())
k = int(input())
mod =10**9+7
n = len(s)
s += s
cnt = 0
for i in range(n):
ok = 1
for j in range(n):
ok &= s[i+j] == t[j]
cnt += ok
if len(t) == 2:
if cnt == 0:
print(0)
elif s[0] == s[1]:
print(1)
elif (s[:n] == t and k % 2 == 1) or (s[:n] != t and k % 2 == 0):
print(0)
else:
print(1)
elif s[:n] == t and k == 1:
cnt -= 1
print(cnt)
else:
print(pow(n-1, k-1, mod)*cnt)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's consider one interesting word game. In this game you should transform one word into another through special operations.
Let's say we have word *w*, let's split this word into two non-empty parts *x* and *y* so, that *w*<==<=*xy*. A split operation is transforming word *w*<==<=*xy* into word *u*<==<=*yx*. For example, a split operation can transform word "wordcut" into word "cutword".
You are given two words *start* and *end*. Count in how many ways we can transform word *start* into word *end*, if we apply exactly *k* split operations consecutively to word *start*.
Two ways are considered different if the sequences of applied operations differ. Two operation sequences are different if exists such number *i* (1<=≤<=*i*<=≤<=*k*), that in the *i*-th operation of the first sequence the word splits into parts *x* and *y*, in the *i*-th operation of the second sequence the word splits into parts *a* and *b*, and additionally *x*<=≠<=*a* holds.
Input Specification:
The first line contains a non-empty word *start*, the second line contains a non-empty word *end*. The words consist of lowercase Latin letters. The number of letters in word *start* equals the number of letters in word *end* and is at least 2 and doesn't exceed 1000 letters.
The third line contains integer *k* (0<=≤<=*k*<=≤<=105) — the required number of operations.
Output Specification:
Print a single number — the answer to the problem. As this number can be rather large, print it modulo 1000000007 (109<=+<=7).
Demo Input:
['ab\nab\n2\n', 'ababab\nababab\n1\n', 'ab\nba\n2\n']
Demo Output:
['1\n', '2\n', '0\n']
Note:
The sought way in the first sample is:
ab → a|b → ba → b|a → ab
In the second sample the two sought ways are:
- ababab → abab|ab → ababab - ababab → ab|abab → ababab
|
```python
s = list(input())
t = list(input())
k = int(input())
mod =10**9+7
n = len(s)
s += s
cnt = 0
for i in range(n):
ok = 1
for j in range(n):
ok &= s[i+j] == t[j]
cnt += ok
if len(t) == 2:
if cnt == 0:
print(0)
elif s[0] == s[1]:
print(1)
elif (s[:n] == t and k % 2 == 1) or (s[:n] != t and k % 2 == 0):
print(0)
else:
print(1)
elif s[:n] == t and k == 1:
cnt -= 1
print(cnt)
else:
print(pow(n-1, k-1, mod)*cnt)
```
| 0
|
|
999
|
E
|
Reachability from the Capital
|
PROGRAMMING
| 2,000
|
[
"dfs and similar",
"graphs",
"greedy"
] | null | null |
There are $n$ cities and $m$ roads in Berland. Each road connects a pair of cities. The roads in Berland are one-way.
What is the minimum number of new roads that need to be built to make all the cities reachable from the capital?
New roads will also be one-way.
|
The first line of input consists of three integers $n$, $m$ and $s$ ($1 \le n \le 5000, 0 \le m \le 5000, 1 \le s \le n$) — the number of cities, the number of roads and the index of the capital. Cities are indexed from $1$ to $n$.
The following $m$ lines contain roads: road $i$ is given as a pair of cities $u_i$, $v_i$ ($1 \le u_i, v_i \le n$, $u_i \ne v_i$). For each pair of cities $(u, v)$, there can be at most one road from $u$ to $v$. Roads in opposite directions between a pair of cities are allowed (i.e. from $u$ to $v$ and from $v$ to $u$).
|
Print one integer — the minimum number of extra roads needed to make all the cities reachable from city $s$. If all the cities are already reachable from $s$, print 0.
|
[
"9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1\n",
"5 4 5\n1 2\n2 3\n3 4\n4 1\n"
] |
[
"3\n",
"1\n"
] |
The first example is illustrated by the following:
For example, you can add roads ($6, 4$), ($7, 9$), ($1, 7$) to make all the cities reachable from $s = 1$.
The second example is illustrated by the following:
In this example, you can add any one of the roads ($5, 1$), ($5, 2$), ($5, 3$), ($5, 4$) to make all the cities reachable from $s = 5$.
| 0
|
[
{
"input": "9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1",
"output": "3"
},
{
"input": "5 4 5\n1 2\n2 3\n3 4\n4 1",
"output": "1"
},
{
"input": "5000 0 2956",
"output": "4999"
},
{
"input": "2 0 2",
"output": "1"
},
{
"input": "2 1 1\n1 2",
"output": "0"
},
{
"input": "2 1 2\n1 2",
"output": "1"
},
{
"input": "2 2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "5000 2 238\n3212 238\n238 3212",
"output": "4998"
},
{
"input": "5000 2 3810\n3225 1137\n1137 3225",
"output": "4998"
},
{
"input": "100 1 30\n69 81",
"output": "98"
},
{
"input": "500 1 209\n183 107",
"output": "498"
},
{
"input": "1000 1 712\n542 916",
"output": "998"
},
{
"input": "39 40 38\n4 8\n24 28\n16 17\n7 25\n4 29\n34 35\n16 24\n21 10\n23 36\n36 14\n28 16\n34 19\n15 21\n22 38\n22 37\n37 27\n28 33\n3 29\n32 22\n12 30\n9 15\n5 19\n23 27\n19 17\n25 17\n24 11\n39 10\n6 20\n16 6\n3 18\n34 21\n15 38\n11 19\n11 3\n32 4\n15 13\n16 11\n11 7\n33 7\n3 33",
"output": "12"
},
{
"input": "8 8 1\n3 2\n3 4\n4 5\n5 3\n6 4\n6 7\n7 8\n8 6",
"output": "1"
},
{
"input": "7 7 1\n2 3\n4 2\n7 4\n5 7\n4 5\n4 6\n6 4",
"output": "1"
},
{
"input": "2333 1 1\n1 2",
"output": "2331"
},
{
"input": "7 4 2\n1 2\n3 4\n5 6\n7 1",
"output": "3"
},
{
"input": "1 0 1",
"output": "0"
},
{
"input": "9 9 1\n2 3\n3 4\n4 5\n6 2\n7 6\n8 7\n6 8\n5 9\n9 2",
"output": "1"
},
{
"input": "30 30 29\n29 9\n1 3\n15 5\n14 24\n7 18\n17 12\n5 9\n22 7\n26 20\n7 29\n8 2\n10 12\n17 18\n17 24\n8 12\n23 28\n10 15\n18 2\n29 13\n25 29\n9 2\n7 13\n11 5\n19 26\n10 5\n25 5\n20 10\n5 26\n24 23\n22 8",
"output": "13"
},
{
"input": "30 30 28\n16 28\n5 30\n7 17\n6 1\n12 28\n15 28\n14 30\n25 11\n25 10\n25 8\n12 30\n27 5\n30 10\n22 14\n30 13\n20 27\n15 25\n24 20\n20 15\n1 30\n3 10\n3 4\n3 18\n15 14\n18 22\n20 26\n10 3\n15 27\n23 29\n10 24",
"output": "9"
}
] | 1,694,677,856
| 56
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 4
| 2,000
| 14,745,600
|
from queue import Queue
class Node:
def __init__(self, index):
self.index = index
self.next = []
self.value = None
def add(self, index): self.next.append(index)
def bfs(self, nodes):
q = Queue()
for i in self.next:
q.put(i)
nodes.append(i)
while not q.empty():
next_node = q.get()
next_node.value = -1
for i in next_node.next:
if (i.index != self.index and i.value != -1):
q.put(i)
nodes.append(i)
return nodes
def bfs1(self):
q = Queue()
for i in self.next:
q.put(i)
while not q.empty():
next_node = q.get()
next_node.value = -1
for i in next_node.next:
for comp in comp_sv:
if i not in comp.next: return True
q.put(i)
return False
def node_in_cycle(self):
q = Queue()
for i in self.next:
q.put(i)
while not q.empty():
next_node = q.get()
if next_node == self: return True
for i in next_node.next:
q.put(i)
return False
n, m, s = [int(x) for x in input().split()]
array_nodes = [Node(x + 1) for x in range(n)]
for i in range(m):
start_node, end_node = [int(x) for x in input().split()]
array_nodes[start_node-1].add(array_nodes[end_node-1])
array_nodes[s-1].bfs([])
for node in array_nodes:
if node.value == -1:
continue
node.value = 0
if node.index != s: a = node.bfs([])
comp_sv = [x for x in array_nodes if x.value > -1 and x.index != s]
count = 0
for node in comp_sv:
if array_nodes[s-1] in node.next: count += 1
if count == len(comp_sv):
flag = False
comp_sv = [x for x in array_nodes if x.value > -1]
for i in comp_sv:
if i.node_in_cycle():
flag = True
comp_sv = [x for x in array_nodes if x.value > -1 and x.index != s]
if array_nodes[s-1].bfs1():
flag = True
if flag: print(count)
else: print(count+1)
else: print(len(comp_sv))
|
Title: Reachability from the Capital
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are $n$ cities and $m$ roads in Berland. Each road connects a pair of cities. The roads in Berland are one-way.
What is the minimum number of new roads that need to be built to make all the cities reachable from the capital?
New roads will also be one-way.
Input Specification:
The first line of input consists of three integers $n$, $m$ and $s$ ($1 \le n \le 5000, 0 \le m \le 5000, 1 \le s \le n$) — the number of cities, the number of roads and the index of the capital. Cities are indexed from $1$ to $n$.
The following $m$ lines contain roads: road $i$ is given as a pair of cities $u_i$, $v_i$ ($1 \le u_i, v_i \le n$, $u_i \ne v_i$). For each pair of cities $(u, v)$, there can be at most one road from $u$ to $v$. Roads in opposite directions between a pair of cities are allowed (i.e. from $u$ to $v$ and from $v$ to $u$).
Output Specification:
Print one integer — the minimum number of extra roads needed to make all the cities reachable from city $s$. If all the cities are already reachable from $s$, print 0.
Demo Input:
['9 9 1\n1 2\n1 3\n2 3\n1 5\n5 6\n6 1\n1 8\n9 8\n7 1\n', '5 4 5\n1 2\n2 3\n3 4\n4 1\n']
Demo Output:
['3\n', '1\n']
Note:
The first example is illustrated by the following:
For example, you can add roads ($6, 4$), ($7, 9$), ($1, 7$) to make all the cities reachable from $s = 1$.
The second example is illustrated by the following:
In this example, you can add any one of the roads ($5, 1$), ($5, 2$), ($5, 3$), ($5, 4$) to make all the cities reachable from $s = 5$.
|
```python
from queue import Queue
class Node:
def __init__(self, index):
self.index = index
self.next = []
self.value = None
def add(self, index): self.next.append(index)
def bfs(self, nodes):
q = Queue()
for i in self.next:
q.put(i)
nodes.append(i)
while not q.empty():
next_node = q.get()
next_node.value = -1
for i in next_node.next:
if (i.index != self.index and i.value != -1):
q.put(i)
nodes.append(i)
return nodes
def bfs1(self):
q = Queue()
for i in self.next:
q.put(i)
while not q.empty():
next_node = q.get()
next_node.value = -1
for i in next_node.next:
for comp in comp_sv:
if i not in comp.next: return True
q.put(i)
return False
def node_in_cycle(self):
q = Queue()
for i in self.next:
q.put(i)
while not q.empty():
next_node = q.get()
if next_node == self: return True
for i in next_node.next:
q.put(i)
return False
n, m, s = [int(x) for x in input().split()]
array_nodes = [Node(x + 1) for x in range(n)]
for i in range(m):
start_node, end_node = [int(x) for x in input().split()]
array_nodes[start_node-1].add(array_nodes[end_node-1])
array_nodes[s-1].bfs([])
for node in array_nodes:
if node.value == -1:
continue
node.value = 0
if node.index != s: a = node.bfs([])
comp_sv = [x for x in array_nodes if x.value > -1 and x.index != s]
count = 0
for node in comp_sv:
if array_nodes[s-1] in node.next: count += 1
if count == len(comp_sv):
flag = False
comp_sv = [x for x in array_nodes if x.value > -1]
for i in comp_sv:
if i.node_in_cycle():
flag = True
comp_sv = [x for x in array_nodes if x.value > -1 and x.index != s]
if array_nodes[s-1].bfs1():
flag = True
if flag: print(count)
else: print(count+1)
else: print(len(comp_sv))
```
| 0
|
|
705
|
A
|
Hulk
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
|
Print Dr.Banner's feeling in one line.
|
[
"1\n",
"2\n",
"3\n"
] |
[
"I hate it\n",
"I hate that I love it\n",
"I hate that I love that I hate it\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "I hate it"
},
{
"input": "2",
"output": "I hate that I love it"
},
{
"input": "3",
"output": "I hate that I love that I hate it"
},
{
"input": "4",
"output": "I hate that I love that I hate that I love it"
},
{
"input": "5",
"output": "I hate that I love that I hate that I love that I hate it"
},
{
"input": "10",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "18",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "19",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "76",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "77",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "81",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "82",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "85",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "86",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "99",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "98",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "33",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "34",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "57",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
}
] | 1,694,695,828
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 46
| 0
|
n = int(input())
words = {1: 'I hate that', 0: 'I love that', 2: 'I love it', 3: 'I hate it'}
result = ''
for i in range(1, n + 1):
if i != n:
result += words[i % 2]
result += ' '
else:
result += words[i % 2 + 2]
print(result)
|
Title: Hulk
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Output Specification:
Print Dr.Banner's feeling in one line.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n']
Note:
none
|
```python
n = int(input())
words = {1: 'I hate that', 0: 'I love that', 2: 'I love it', 3: 'I hate it'}
result = ''
for i in range(1, n + 1):
if i != n:
result += words[i % 2]
result += ' '
else:
result += words[i % 2 + 2]
print(result)
```
| 3
|
|
439
|
A
|
Devu, the Singer and Churu, the Joker
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
|
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
|
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
|
[
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] |
[
"5\n",
"-1\n"
] |
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
| 500
|
[
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,587,455,691
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 93
| 0
|
n,k=map(int,input().split())
l=list(map(int,input().split()))
s=sum(l)+(5*((2*n)-1))
if(s<=k):
print((2*n)-1)
else:
print(-1)
|
Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
|
```python
n,k=map(int,input().split())
l=list(map(int,input().split()))
s=sum(l)+(5*((2*n)-1))
if(s<=k):
print((2*n)-1)
else:
print(-1)
```
| 0
|
|
450
|
B
|
Jzzhu and Sequences
|
PROGRAMMING
| 1,300
|
[
"implementation",
"math"
] | null | null |
Jzzhu has invented a kind of sequences, they meet the following property:
You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
|
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
|
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
|
[
"2 3\n3\n",
"0 -1\n2\n"
] |
[
"1\n",
"1000000006\n"
] |
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1.
In the second sample, *f*<sub class="lower-index">2</sub> = - 1; - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
| 1,000
|
[
{
"input": "2 3\n3",
"output": "1"
},
{
"input": "0 -1\n2",
"output": "1000000006"
},
{
"input": "-9 -11\n12345",
"output": "1000000005"
},
{
"input": "0 0\n1000000000",
"output": "0"
},
{
"input": "-1000000000 1000000000\n2000000000",
"output": "1000000000"
},
{
"input": "-12345678 12345678\n1912345678",
"output": "12345678"
},
{
"input": "728374857 678374857\n1928374839",
"output": "950000007"
},
{
"input": "278374837 992837483\n1000000000",
"output": "721625170"
},
{
"input": "-693849384 502938493\n982838498",
"output": "502938493"
},
{
"input": "-783928374 983738273\n992837483",
"output": "16261734"
},
{
"input": "-872837483 -682738473\n999999999",
"output": "190099010"
},
{
"input": "-892837483 -998273847\n999283948",
"output": "892837483"
},
{
"input": "-283938494 738473848\n1999999999",
"output": "716061513"
},
{
"input": "-278374857 819283838\n1",
"output": "721625150"
},
{
"input": "-1000000000 123456789\n1",
"output": "7"
},
{
"input": "-529529529 -524524524\n2",
"output": "475475483"
},
{
"input": "1 2\n2000000000",
"output": "2"
},
{
"input": "-1 -2\n2000000000",
"output": "1000000005"
},
{
"input": "1 2\n1999999999",
"output": "1"
},
{
"input": "1 2\n1999999998",
"output": "1000000006"
},
{
"input": "1 2\n1999999997",
"output": "1000000005"
},
{
"input": "1 2\n1999999996",
"output": "1000000006"
},
{
"input": "69975122 366233206\n1189460676",
"output": "703741923"
},
{
"input": "812229413 904420051\n806905621",
"output": "812229413"
},
{
"input": "872099024 962697902\n1505821695",
"output": "90598878"
},
{
"input": "887387283 909670917\n754835014",
"output": "112612724"
},
{
"input": "37759824 131342932\n854621399",
"output": "868657075"
},
{
"input": "-246822123 800496170\n626323615",
"output": "753177884"
},
{
"input": "-861439463 974126967\n349411083",
"output": "835566423"
},
{
"input": "-69811049 258093841\n1412447",
"output": "741906166"
},
{
"input": "844509330 -887335829\n123329059",
"output": "844509330"
},
{
"input": "83712471 -876177148\n1213284777",
"output": "40110388"
},
{
"input": "598730524 -718984219\n1282749880",
"output": "401269483"
},
{
"input": "-474244697 -745885656\n1517883612",
"output": "271640959"
},
{
"input": "-502583588 -894906953\n1154189557",
"output": "497416419"
},
{
"input": "-636523651 -873305815\n154879215",
"output": "763217843"
},
{
"input": "721765550 594845720\n78862386",
"output": "126919830"
},
{
"input": "364141461 158854993\n1337196589",
"output": "364141461"
},
{
"input": "878985260 677031952\n394707801",
"output": "798046699"
},
{
"input": "439527072 -24854079\n1129147002",
"output": "464381151"
},
{
"input": "840435009 -612103127\n565968986",
"output": "387896880"
},
{
"input": "875035447 -826471373\n561914518",
"output": "124964560"
},
{
"input": "-342526698 305357084\n70776744",
"output": "352116225"
},
{
"input": "-903244186 899202229\n1527859274",
"output": "899202229"
},
{
"input": "-839482546 815166320\n1127472130",
"output": "839482546"
},
{
"input": "-976992569 -958313041\n1686580818",
"output": "981320479"
},
{
"input": "-497338894 -51069176\n737081851",
"output": "502661113"
},
{
"input": "-697962643 -143148799\n1287886520",
"output": "856851208"
},
{
"input": "-982572938 -482658433\n1259858332",
"output": "982572938"
},
{
"input": "123123 78817\n2000000000",
"output": "78817"
},
{
"input": "1000000000 -1000000000\n3",
"output": "14"
},
{
"input": "-1000000000 1000000000\n6",
"output": "14"
},
{
"input": "2 3\n6",
"output": "1000000006"
},
{
"input": "0 -1\n6",
"output": "1"
},
{
"input": "500000000 -1000000000\n600000003",
"output": "500000014"
},
{
"input": "-1000000000 1000000000\n3",
"output": "999999993"
},
{
"input": "1 3\n6",
"output": "1000000005"
},
{
"input": "1 2\n12",
"output": "1000000006"
},
{
"input": "7 -1000000000\n3",
"output": "0"
},
{
"input": "-999999997 999999997\n6",
"output": "20"
},
{
"input": "3 4\n6",
"output": "1000000006"
},
{
"input": "-1 2\n6",
"output": "1000000004"
},
{
"input": "2 3\n12",
"output": "1000000006"
},
{
"input": "4 18\n6",
"output": "999999993"
},
{
"input": "1 2\n6",
"output": "1000000006"
},
{
"input": "1000000000 -1000000000\n6",
"output": "999999993"
},
{
"input": "999999999 -999999999\n3",
"output": "16"
},
{
"input": "-1 0\n1",
"output": "1000000006"
},
{
"input": "1000000000 -1000000000\n9",
"output": "14"
},
{
"input": "999999999 -1000000000\n12",
"output": "999999992"
},
{
"input": "1000000000 -7\n3",
"output": "0"
},
{
"input": "-5 5\n6",
"output": "999999997"
},
{
"input": "5 9\n6",
"output": "1000000003"
},
{
"input": "-15 -10\n1",
"output": "999999992"
}
] | 1,643,219,135
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
x, y = map(int, input().split())
n = int(input())
cur = 0
p = int(1000000007)
for i in range(2, n):
temp = y
y = y - x
x = temp
print(y)
|
Title: Jzzhu and Sequences
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jzzhu has invented a kind of sequences, they meet the following property:
You are given *x* and *y*, please calculate *f**n* modulo 1000000007 (109<=+<=7).
Input Specification:
The first line contains two integers *x* and *y* (|*x*|,<=|*y*|<=≤<=109). The second line contains a single integer *n* (1<=≤<=*n*<=≤<=2·109).
Output Specification:
Output a single integer representing *f**n* modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\n3\n', '0 -1\n2\n']
Demo Output:
['1\n', '1000000006\n']
Note:
In the first sample, *f*<sub class="lower-index">2</sub> = *f*<sub class="lower-index">1</sub> + *f*<sub class="lower-index">3</sub>, 3 = 2 + *f*<sub class="lower-index">3</sub>, *f*<sub class="lower-index">3</sub> = 1.
In the second sample, *f*<sub class="lower-index">2</sub> = - 1; - 1 modulo (10<sup class="upper-index">9</sup> + 7) equals (10<sup class="upper-index">9</sup> + 6).
|
```python
x, y = map(int, input().split())
n = int(input())
cur = 0
p = int(1000000007)
for i in range(2, n):
temp = y
y = y - x
x = temp
print(y)
```
| 0
|
|
295
|
A
|
Greg and Array
|
PROGRAMMING
| 1,400
|
[
"data structures",
"implementation"
] | null | null |
Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*.
Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array.
Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg.
|
The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array.
Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105).
Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*).
The numbers in the lines are separated by single spaces.
|
On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
|
[
"3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n",
"1 1 1\n1\n1 1 1\n1 1\n",
"4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n"
] |
[
"9 18 17\n",
"2\n",
"5 18 31 20\n"
] |
none
| 500
|
[
{
"input": "3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3",
"output": "9 18 17"
},
{
"input": "1 1 1\n1\n1 1 1\n1 1",
"output": "2"
},
{
"input": "4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3",
"output": "5 18 31 20"
},
{
"input": "1 1 1\n0\n1 1 0\n1 1",
"output": "0"
}
] | 1,685,711,087
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 592
| 34,713,600
|
import sys
input = sys.stdin.readline
# import bisect #-->For bisect.bisect_left=lower_bound and bisect_right=upper_bound
for _ in range(1):#int(input())):
n, m, k = map(int, input().split())
a = list(map(int, input().split()))
b = []
for i in range(m):
l, r, d = map(int, input().split())
b.append([l,r,d])
# print(*a)
oper = [0]*(m+1)
for i in range(k):
x, y = map(int, input().split())
oper[x-1] += 1
oper[y] -= 1
for i in range(1, m+1):
oper[i] += oper[i-1]
diff = [0]*(n+1)
for i in range(m):
x = b[i][2] * oper[i]
l, r = b[i][0]-1, b[i][1]
diff[l] += x
diff[r] -= x
for i in range(n):
x = a[i]
if (i > 0):
diff[i] += diff[i-1]
x += diff[i]
print(x, end = " ")
|
Title: Greg and Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg has an array *a*<==<=*a*1,<=*a*2,<=...,<=*a**n* and *m* operations. Each operation looks as: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*). To apply operation *i* to the array means to increase all array elements with numbers *l**i*,<=*l**i*<=+<=1,<=...,<=*r**i* by value *d**i*.
Greg wrote down *k* queries on a piece of paper. Each query has the following form: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*). That means that one should apply operations with numbers *x**i*,<=*x**i*<=+<=1,<=...,<=*y**i* to the array.
Now Greg is wondering, what the array *a* will be after all the queries are executed. Help Greg.
Input Specification:
The first line contains integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*,<=*k*<=≤<=105). The second line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105) — the initial array.
Next *m* lines contain operations, the operation number *i* is written as three integers: *l**i*, *r**i*, *d**i*, (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), (0<=≤<=*d**i*<=≤<=105).
Next *k* lines contain the queries, the query number *i* is written as two integers: *x**i*, *y**i*, (1<=≤<=*x**i*<=≤<=*y**i*<=≤<=*m*).
The numbers in the lines are separated by single spaces.
Output Specification:
On a single line print *n* integers *a*1,<=*a*2,<=...,<=*a**n* — the array after executing all the queries. Separate the printed numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
Demo Input:
['3 3 3\n1 2 3\n1 2 1\n1 3 2\n2 3 4\n1 2\n1 3\n2 3\n', '1 1 1\n1\n1 1 1\n1 1\n', '4 3 6\n1 2 3 4\n1 2 1\n2 3 2\n3 4 4\n1 2\n1 3\n2 3\n1 2\n1 3\n2 3\n']
Demo Output:
['9 18 17\n', '2\n', '5 18 31 20\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
# import bisect #-->For bisect.bisect_left=lower_bound and bisect_right=upper_bound
for _ in range(1):#int(input())):
n, m, k = map(int, input().split())
a = list(map(int, input().split()))
b = []
for i in range(m):
l, r, d = map(int, input().split())
b.append([l,r,d])
# print(*a)
oper = [0]*(m+1)
for i in range(k):
x, y = map(int, input().split())
oper[x-1] += 1
oper[y] -= 1
for i in range(1, m+1):
oper[i] += oper[i-1]
diff = [0]*(n+1)
for i in range(m):
x = b[i][2] * oper[i]
l, r = b[i][0]-1, b[i][1]
diff[l] += x
diff[r] -= x
for i in range(n):
x = a[i]
if (i > 0):
diff[i] += diff[i-1]
x += diff[i]
print(x, end = " ")
```
| 3
|
|
202
|
A
|
LLPS
|
PROGRAMMING
| 800
|
[
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null |
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
|
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
|
Print the lexicographically largest palindromic subsequence of string *s*.
|
[
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] |
[
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] |
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
| 500
|
[
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,450,735,680
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 54
| 124
| 0
|
z=input();i=max(z)
print(z.count(i)*i)
|
Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
|
```python
z=input();i=max(z)
print(z.count(i)*i)
```
| 3
|
|
749
|
A
|
Bachgold Problem
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
|
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
|
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
|
[
"5\n",
"6\n"
] |
[
"2\n2 3\n",
"3\n2 2 2\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,656,081,129
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 0
|
count=0
n=int(input())
count=(n//2)+1
if n%2==0:
print(count-1)
else:
print(count)
for i in range(count):
if i+1!=count:
print(2,end=" ")
elif(n%2!=0):
print(1)
|
Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
Output Specification:
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none
|
```python
count=0
n=int(input())
count=(n//2)+1
if n%2==0:
print(count-1)
else:
print(count)
for i in range(count):
if i+1!=count:
print(2,end=" ")
elif(n%2!=0):
print(1)
```
| 0
|
|
441
|
A
|
Valera and Antique Items
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
|
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
|
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
|
[
"3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n",
"3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n"
] |
[
"3\n1 2 3\n",
"0\n\n"
] |
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
| 500
|
[
{
"input": "3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000",
"output": "3\n1 2 3"
},
{
"input": "3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000",
"output": "0"
},
{
"input": "2 100001\n1 895737\n1 541571",
"output": "0"
},
{
"input": "1 1000000\n1 1000000",
"output": "0"
},
{
"input": "1 1000000\n1 561774",
"output": "1\n1"
},
{
"input": "3 1000000\n5 1000000 568832 1000000 1000000 1000000\n13 1000000 1000000 1000000 596527 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000\n20 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000",
"output": "2\n1 2"
},
{
"input": "3 999999\n7 1000000 1000000 1000000 999999 1000000 999999 1000000\n6 999999 1000000 999999 1000000 999999 999999\n7 999999 1000000 1000000 999999 1000000 1000000 1000000",
"output": "0"
},
{
"input": "3 999999\n22 1000000 1000000 999999 999999 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 999999 1000000 1000000 999999 1000000 1000000 1000000 352800 999999 1000000\n14 999999 999999 999999 999999 999999 1000000 999999 999999 999999 999999 702638 999999 1000000 999999\n5 999999 1000000 1000000 999999 363236",
"output": "3\n1 2 3"
},
{
"input": "1 50001\n1 50000",
"output": "1\n1"
}
] | 1,402,602,936
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 842
| 0
|
n,v=map(int,input().split())
Ans=[]
for i in range(n):
L=list(map(int,input().split()))
x=min(L[1:])
if(x<v):
Ans.append(i)
print(len(Ans))
for item in Ans:
print(item+1,end=" ")
|
Title: Valera and Antique Items
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
Input Specification:
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
Output Specification:
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
Demo Input:
['3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n', '3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n']
Demo Output:
['3\n1 2 3\n', '0\n\n']
Note:
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
|
```python
n,v=map(int,input().split())
Ans=[]
for i in range(n):
L=list(map(int,input().split()))
x=min(L[1:])
if(x<v):
Ans.append(i)
print(len(Ans))
for item in Ans:
print(item+1,end=" ")
```
| 3
|
|
851
|
A
|
Arpa and a research in Mexican wave
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Arpa is researching the Mexican wave.
There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0.
- At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits.
Arpa wants to know how many spectators are standing at time *t*.
|
The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=<<=*n*<=+<=*k*).
|
Print single integer: how many spectators are standing at time *t*.
|
[
"10 5 3\n",
"10 5 7\n",
"10 5 12\n"
] |
[
"3\n",
"5\n",
"3\n"
] |
In the following a sitting spectator is represented as -, a standing spectator is represented as ^.
- At *t* = 0 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1 ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2 ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3 ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4 ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5 ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6 -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7 --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8 ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9 ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
| 500
|
[
{
"input": "10 5 3",
"output": "3"
},
{
"input": "10 5 7",
"output": "5"
},
{
"input": "10 5 12",
"output": "3"
},
{
"input": "840585600 770678331 788528791",
"output": "770678331"
},
{
"input": "25462281 23343504 8024619",
"output": "8024619"
},
{
"input": "723717988 205757169 291917494",
"output": "205757169"
},
{
"input": "27462087 20831796 15492397",
"output": "15492397"
},
{
"input": "966696824 346707476 1196846860",
"output": "116557440"
},
{
"input": "290274403 41153108 327683325",
"output": "3744186"
},
{
"input": "170963478 151220598 222269210",
"output": "99914866"
},
{
"input": "14264008 309456 11132789",
"output": "309456"
},
{
"input": "886869816 281212106 52891064",
"output": "52891064"
},
{
"input": "330543750 243917820 205522400",
"output": "205522400"
},
{
"input": "457658451 18625039 157624558",
"output": "18625039"
},
{
"input": "385908940 143313325 509731380",
"output": "19490885"
},
{
"input": "241227633 220621961 10025257",
"output": "10025257"
},
{
"input": "474139818 268918981 388282504",
"output": "268918981"
},
{
"input": "25963410 3071034 820199",
"output": "820199"
},
{
"input": "656346757 647995766 75748423",
"output": "75748423"
},
{
"input": "588568132 411878522 521753621",
"output": "411878522"
},
{
"input": "735788762 355228487 139602545",
"output": "139602545"
},
{
"input": "860798593 463398487 506871376",
"output": "463398487"
},
{
"input": "362624055 110824996 194551217",
"output": "110824996"
},
{
"input": "211691721 195866131 313244576",
"output": "94313276"
},
{
"input": "45661815 26072719 9643822",
"output": "9643822"
},
{
"input": "757183104 590795077 709609355",
"output": "590795077"
},
{
"input": "418386749 1915035 197248338",
"output": "1915035"
},
{
"input": "763782282 297277890 246562421",
"output": "246562421"
},
{
"input": "893323188 617630677 607049638",
"output": "607049638"
},
{
"input": "506708261 356545583 296093684",
"output": "296093684"
},
{
"input": "984295813 427551190 84113823",
"output": "84113823"
},
{
"input": "774984967 61373612 96603505",
"output": "61373612"
},
{
"input": "774578969 342441237 91492393",
"output": "91492393"
},
{
"input": "76495801 8780305 56447339",
"output": "8780305"
},
{
"input": "48538385 582843 16805978",
"output": "582843"
},
{
"input": "325794610 238970909 553089099",
"output": "11676420"
},
{
"input": "834925315 316928679 711068031",
"output": "316928679"
},
{
"input": "932182199 454838315 267066713",
"output": "267066713"
},
{
"input": "627793782 552043394 67061810",
"output": "67061810"
},
{
"input": "24317170 17881607 218412",
"output": "218412"
},
{
"input": "1000000000 1000 1",
"output": "1"
},
{
"input": "1000000000 1000 2",
"output": "2"
},
{
"input": "1000000000 1 1000",
"output": "1"
},
{
"input": "100 100 100",
"output": "100"
},
{
"input": "100 100 99",
"output": "99"
},
{
"input": "100 100 101",
"output": "99"
},
{
"input": "100 100 199",
"output": "1"
},
{
"input": "1000000000 1000000000 1999999999",
"output": "1"
},
{
"input": "10 5 5",
"output": "5"
},
{
"input": "5 3 5",
"output": "3"
},
{
"input": "10 3 3",
"output": "3"
},
{
"input": "10 5 6",
"output": "5"
},
{
"input": "3 2 4",
"output": "1"
},
{
"input": "10 5 14",
"output": "1"
},
{
"input": "6 1 4",
"output": "1"
},
{
"input": "10 10 19",
"output": "1"
},
{
"input": "10 4 11",
"output": "3"
},
{
"input": "2 2 3",
"output": "1"
},
{
"input": "10 5 11",
"output": "4"
},
{
"input": "600 200 700",
"output": "100"
},
{
"input": "2000 1000 2001",
"output": "999"
},
{
"input": "1000 1000 1001",
"output": "999"
},
{
"input": "5 4 6",
"output": "3"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "10 3 10",
"output": "3"
},
{
"input": "15 10 10",
"output": "10"
},
{
"input": "10 5 13",
"output": "2"
},
{
"input": "2 2 2",
"output": "2"
},
{
"input": "5 5 6",
"output": "4"
},
{
"input": "10 6 12",
"output": "4"
},
{
"input": "7 5 8",
"output": "4"
},
{
"input": "10 4 9",
"output": "4"
},
{
"input": "9 2 6",
"output": "2"
},
{
"input": "5 2 6",
"output": "1"
},
{
"input": "6 2 6",
"output": "2"
},
{
"input": "5 5 8",
"output": "2"
},
{
"input": "3 3 5",
"output": "1"
},
{
"input": "10 2 5",
"output": "2"
},
{
"input": "5 3 7",
"output": "1"
},
{
"input": "5 4 8",
"output": "1"
},
{
"input": "10 6 11",
"output": "5"
},
{
"input": "5 3 6",
"output": "2"
},
{
"input": "10 6 14",
"output": "2"
},
{
"input": "10 10 10",
"output": "10"
},
{
"input": "1000000000 1 1000000000",
"output": "1"
},
{
"input": "20 4 22",
"output": "2"
},
{
"input": "5 4 4",
"output": "4"
},
{
"input": "4 3 6",
"output": "1"
},
{
"input": "12 8 18",
"output": "2"
},
{
"input": "10 5 10",
"output": "5"
},
{
"input": "100 50 149",
"output": "1"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "7 6 9",
"output": "4"
},
{
"input": "16 10 21",
"output": "5"
},
{
"input": "10 2 11",
"output": "1"
},
{
"input": "600 200 500",
"output": "200"
},
{
"input": "100 30 102",
"output": "28"
},
{
"input": "10 10 18",
"output": "2"
},
{
"input": "15 3 10",
"output": "3"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "5 5 5",
"output": "5"
},
{
"input": "10 3 12",
"output": "1"
},
{
"input": "747 457 789",
"output": "415"
},
{
"input": "5 4 7",
"output": "2"
},
{
"input": "15 5 11",
"output": "5"
},
{
"input": "3 2 2",
"output": "2"
},
{
"input": "7 6 8",
"output": "5"
},
{
"input": "7 4 8",
"output": "3"
},
{
"input": "10 4 13",
"output": "1"
},
{
"input": "10 3 9",
"output": "3"
},
{
"input": "20 2 21",
"output": "1"
},
{
"input": "6 5 9",
"output": "2"
},
{
"input": "10 9 18",
"output": "1"
},
{
"input": "12 4 9",
"output": "4"
},
{
"input": "10 7 15",
"output": "2"
},
{
"input": "999999999 999999998 1500000000",
"output": "499999997"
},
{
"input": "20 5 20",
"output": "5"
},
{
"input": "4745 4574 4757",
"output": "4562"
},
{
"input": "10 7 12",
"output": "5"
},
{
"input": "17 15 18",
"output": "14"
},
{
"input": "3 1 3",
"output": "1"
},
{
"input": "100 3 7",
"output": "3"
},
{
"input": "6 2 7",
"output": "1"
},
{
"input": "8 5 10",
"output": "3"
},
{
"input": "3 3 3",
"output": "3"
},
{
"input": "9 5 10",
"output": "4"
},
{
"input": "10 6 13",
"output": "3"
},
{
"input": "13 10 14",
"output": "9"
},
{
"input": "13 12 15",
"output": "10"
},
{
"input": "10 4 12",
"output": "2"
},
{
"input": "41 3 3",
"output": "3"
},
{
"input": "1000000000 1000000000 1400000000",
"output": "600000000"
},
{
"input": "10 3 11",
"output": "2"
},
{
"input": "12 7 18",
"output": "1"
},
{
"input": "15 3 17",
"output": "1"
},
{
"input": "10 2 8",
"output": "2"
},
{
"input": "1000000000 1000 1000000999",
"output": "1"
},
{
"input": "5 5 9",
"output": "1"
},
{
"input": "100 3 6",
"output": "3"
},
{
"input": "100 5 50",
"output": "5"
},
{
"input": "10000 10 10000",
"output": "10"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "6 4 4",
"output": "4"
},
{
"input": "9979797 555554 10101010",
"output": "434341"
},
{
"input": "13 5 12",
"output": "5"
},
{
"input": "9 4 10",
"output": "3"
},
{
"input": "7 5 10",
"output": "2"
},
{
"input": "100000000 10000000 100005000",
"output": "9995000"
},
{
"input": "100000 50000 100001",
"output": "49999"
},
{
"input": "15 10 20",
"output": "5"
},
{
"input": "4 4 5",
"output": "3"
},
{
"input": "5 3 3",
"output": "3"
},
{
"input": "30 5 30",
"output": "5"
},
{
"input": "200000 10 200005",
"output": "5"
},
{
"input": "10 9 12",
"output": "7"
},
{
"input": "10 6 15",
"output": "1"
},
{
"input": "1000000000 10 1000000000",
"output": "10"
},
{
"input": "7 5 11",
"output": "1"
},
{
"input": "9 4 4",
"output": "4"
},
{
"input": "14 3 15",
"output": "2"
},
{
"input": "1000000000 100000000 1000000000",
"output": "100000000"
},
{
"input": "40 10 22",
"output": "10"
},
{
"input": "50 10 51",
"output": "9"
},
{
"input": "999999997 999999995 1999999991",
"output": "1"
},
{
"input": "92 79 144",
"output": "27"
},
{
"input": "8 4 4",
"output": "4"
}
] | 1,642,670,477
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 3
| 1,000
| 87,756,800
|
n,k,t = map(int, input().split())
l = []
i=0
for i in range(n+k+1):
if i<=n:
if (i<=k):
l.append(i)
else:
l.append(k)
i+=1
else:
k=k-1
l.append(k)
tt = 0
for i in l:
tt+=1
if t==tt-1:
print(l[tt-1])
|
Title: Arpa and a research in Mexican wave
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arpa is researching the Mexican wave.
There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0.
- At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits.
Arpa wants to know how many spectators are standing at time *t*.
Input Specification:
The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=<<=*n*<=+<=*k*).
Output Specification:
Print single integer: how many spectators are standing at time *t*.
Demo Input:
['10 5 3\n', '10 5 7\n', '10 5 12\n']
Demo Output:
['3\n', '5\n', '3\n']
Note:
In the following a sitting spectator is represented as -, a standing spectator is represented as ^.
- At *t* = 0 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1 ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2 ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3 ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4 ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5 ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6 -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7 --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8 ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9 ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
|
```python
n,k,t = map(int, input().split())
l = []
i=0
for i in range(n+k+1):
if i<=n:
if (i<=k):
l.append(i)
else:
l.append(k)
i+=1
else:
k=k-1
l.append(k)
tt = 0
for i in l:
tt+=1
if t==tt-1:
print(l[tt-1])
```
| 0
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,608,733,698
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 218
| 307,200
|
u=int(input())
v=list(map(int,input().split()))
io=[0 for i in range(200)]
yo=1
for i in range(100):
io[i]=yo
yo=yo+u+1
up=[1,2,3,4,5]
j=0
for i in range(len(v)):
j=j+v[i]
for i in range(len(up)):
up[i]=up[i]+j
op=5
for i in up:
if(i in io):
op=op-1
print(op)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
u=int(input())
v=list(map(int,input().split()))
io=[0 for i in range(200)]
yo=1
for i in range(100):
io[i]=yo
yo=yo+u+1
up=[1,2,3,4,5]
j=0
for i in range(len(v)):
j=j+v[i]
for i in range(len(up)):
up[i]=up[i]+j
op=5
for i in up:
if(i in io):
op=op-1
print(op)
```
| 3
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,629,023,060
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 6,963,200
|
y, w= map(int, input().split())
m=max(y,w)
a=0
b=0
for i in range(7):
if i>m :
b+=1
if i==m:
a+=1
prob= a/b
if prob == 0:
print("0/1")
elif prob == 1:
print("1/1")
else:
print(a,'/',b)
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
y, w= map(int, input().split())
m=max(y,w)
a=0
b=0
for i in range(7):
if i>m :
b+=1
if i==m:
a+=1
prob= a/b
if prob == 0:
print("0/1")
elif prob == 1:
print("1/1")
else:
print(a,'/',b)
```
| 0
|
931
|
A
|
Friends Meeting
|
PROGRAMMING
| 800
|
[
"brute force",
"greedy",
"implementation",
"math"
] | null | null |
Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*.
Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the third — by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6.
The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point.
|
The first line contains a single integer *a* (1<=≤<=*a*<=≤<=1000) — the initial position of the first friend.
The second line contains a single integer *b* (1<=≤<=*b*<=≤<=1000) — the initial position of the second friend.
It is guaranteed that *a*<=≠<=*b*.
|
Print the minimum possible total tiredness if the friends meet in the same point.
|
[
"3\n4\n",
"101\n99\n",
"5\n10\n"
] |
[
"1\n",
"2\n",
"9\n"
] |
In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1.
In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2.
In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend — two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
| 500
|
[
{
"input": "3\n4",
"output": "1"
},
{
"input": "101\n99",
"output": "2"
},
{
"input": "5\n10",
"output": "9"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n1000",
"output": "250000"
},
{
"input": "999\n1000",
"output": "1"
},
{
"input": "1000\n999",
"output": "1"
},
{
"input": "1000\n1",
"output": "250000"
},
{
"input": "2\n1",
"output": "1"
},
{
"input": "2\n999",
"output": "249001"
},
{
"input": "2\n998",
"output": "248502"
},
{
"input": "999\n2",
"output": "249001"
},
{
"input": "998\n2",
"output": "248502"
},
{
"input": "2\n1000",
"output": "249500"
},
{
"input": "1000\n2",
"output": "249500"
},
{
"input": "1\n999",
"output": "249500"
},
{
"input": "999\n1",
"output": "249500"
},
{
"input": "188\n762",
"output": "82656"
},
{
"input": "596\n777",
"output": "8281"
},
{
"input": "773\n70",
"output": "123904"
},
{
"input": "825\n729",
"output": "2352"
},
{
"input": "944\n348",
"output": "89102"
},
{
"input": "352\n445",
"output": "2209"
},
{
"input": "529\n656",
"output": "4096"
},
{
"input": "19\n315",
"output": "22052"
},
{
"input": "138\n370",
"output": "13572"
},
{
"input": "546\n593",
"output": "576"
},
{
"input": "285\n242",
"output": "484"
},
{
"input": "773\n901",
"output": "4160"
},
{
"input": "892\n520",
"output": "34782"
},
{
"input": "864\n179",
"output": "117649"
},
{
"input": "479\n470",
"output": "25"
},
{
"input": "967\n487",
"output": "57840"
},
{
"input": "648\n106",
"output": "73712"
},
{
"input": "58\n765",
"output": "125316"
},
{
"input": "235\n56",
"output": "8100"
},
{
"input": "285\n153",
"output": "4422"
},
{
"input": "943\n13",
"output": "216690"
},
{
"input": "675\n541",
"output": "4556"
},
{
"input": "4\n912",
"output": "206570"
}
] | 1,591,975,720
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 40
| 140
| 0
|
a = int(input())
b = int(input())
x = (a + b) // 2
n1 = abs(a - x)
res1 = n1 * (n1 + 1) // 2
n2 = abs(b - x)
res2 = n2 * (n2 + 1 ) // 2
print(res1 + res2 )
|
Title: Friends Meeting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two friends are on the coordinate axis *Ox* in points with integer coordinates. One of them is in the point *x*1<==<=*a*, another one is in the point *x*2<==<=*b*.
Each of the friends can move by one along the line in any direction unlimited number of times. When a friend moves, the tiredness of a friend changes according to the following rules: the first move increases the tiredness by 1, the second move increases the tiredness by 2, the third — by 3 and so on. For example, if a friend moves first to the left, then to the right (returning to the same point), and then again to the left his tiredness becomes equal to 1<=+<=2<=+<=3<==<=6.
The friends want to meet in a integer point. Determine the minimum total tiredness they should gain, if they meet in the same point.
Input Specification:
The first line contains a single integer *a* (1<=≤<=*a*<=≤<=1000) — the initial position of the first friend.
The second line contains a single integer *b* (1<=≤<=*b*<=≤<=1000) — the initial position of the second friend.
It is guaranteed that *a*<=≠<=*b*.
Output Specification:
Print the minimum possible total tiredness if the friends meet in the same point.
Demo Input:
['3\n4\n', '101\n99\n', '5\n10\n']
Demo Output:
['1\n', '2\n', '9\n']
Note:
In the first example the first friend should move by one to the right (then the meeting happens at point 4), or the second friend should move by one to the left (then the meeting happens at point 3). In both cases, the total tiredness becomes 1.
In the second example the first friend should move by one to the left, and the second friend should move by one to the right. Then they meet in the point 100, and the total tiredness becomes 1 + 1 = 2.
In the third example one of the optimal ways is the following. The first friend should move three times to the right, and the second friend — two times to the left. Thus the friends meet in the point 8, and the total tiredness becomes 1 + 2 + 3 + 1 + 2 = 9.
|
```python
a = int(input())
b = int(input())
x = (a + b) // 2
n1 = abs(a - x)
res1 = n1 * (n1 + 1) // 2
n2 = abs(b - x)
res2 = n2 * (n2 + 1 ) // 2
print(res1 + res2 )
```
| 3
|
|
779
|
B
|
Weird Rounding
|
PROGRAMMING
| 1,100
|
[
"brute force",
"greedy"
] | null | null |
Polycarp is crazy about round numbers. He especially likes the numbers divisible by 10*k*.
In the given number of *n* Polycarp wants to remove the least number of digits to get a number that is divisible by 10*k*. For example, if *k*<==<=3, in the number 30020 it is enough to delete a single digit (2). In this case, the result is 3000 that is divisible by 103<==<=1000.
Write a program that prints the minimum number of digits to be deleted from the given integer number *n*, so that the result is divisible by 10*k*. The result should not start with the unnecessary leading zero (i.e., zero can start only the number 0, which is required to be written as exactly one digit).
It is guaranteed that the answer exists.
|
The only line of the input contains two integer numbers *n* and *k* (0<=≤<=*n*<=≤<=2<=000<=000<=000, 1<=≤<=*k*<=≤<=9).
It is guaranteed that the answer exists. All numbers in the input are written in traditional notation of integers, that is, without any extra leading zeros.
|
Print *w* — the required minimal number of digits to erase. After removing the appropriate *w* digits from the number *n*, the result should have a value that is divisible by 10*k*. The result can start with digit 0 in the single case (the result is zero and written by exactly the only digit 0).
|
[
"30020 3\n",
"100 9\n",
"10203049 2\n"
] |
[
"1\n",
"2\n",
"3\n"
] |
In the example 2 you can remove two digits: 1 and any 0. The result is number 0 which is divisible by any number.
| 1,000
|
[
{
"input": "30020 3",
"output": "1"
},
{
"input": "100 9",
"output": "2"
},
{
"input": "10203049 2",
"output": "3"
},
{
"input": "0 1",
"output": "0"
},
{
"input": "0 9",
"output": "0"
},
{
"input": "100 2",
"output": "0"
},
{
"input": "102030404 2",
"output": "2"
},
{
"input": "1000999999 3",
"output": "6"
},
{
"input": "12000000 4",
"output": "0"
},
{
"input": "1090090090 5",
"output": "2"
},
{
"input": "10 1",
"output": "0"
},
{
"input": "10 2",
"output": "1"
},
{
"input": "10 9",
"output": "1"
},
{
"input": "100 1",
"output": "0"
},
{
"input": "100 3",
"output": "2"
},
{
"input": "101010110 3",
"output": "3"
},
{
"input": "101010110 1",
"output": "0"
},
{
"input": "101010110 2",
"output": "2"
},
{
"input": "101010110 4",
"output": "4"
},
{
"input": "101010110 5",
"output": "8"
},
{
"input": "101010110 9",
"output": "8"
},
{
"input": "1234567890 1",
"output": "0"
},
{
"input": "1234567890 2",
"output": "9"
},
{
"input": "1234567890 9",
"output": "9"
},
{
"input": "2000000000 1",
"output": "0"
},
{
"input": "2000000000 2",
"output": "0"
},
{
"input": "2000000000 3",
"output": "0"
},
{
"input": "2000000000 9",
"output": "0"
},
{
"input": "1010101010 1",
"output": "0"
},
{
"input": "1010101010 2",
"output": "1"
},
{
"input": "1010101010 3",
"output": "2"
},
{
"input": "1010101010 4",
"output": "3"
},
{
"input": "1010101010 5",
"output": "4"
},
{
"input": "1010101010 6",
"output": "9"
},
{
"input": "1010101010 7",
"output": "9"
},
{
"input": "1010101010 8",
"output": "9"
},
{
"input": "1010101010 9",
"output": "9"
},
{
"input": "10001000 1",
"output": "0"
},
{
"input": "10001000 2",
"output": "0"
},
{
"input": "10001000 3",
"output": "0"
},
{
"input": "10001000 4",
"output": "1"
},
{
"input": "10001000 5",
"output": "1"
},
{
"input": "10001000 6",
"output": "1"
},
{
"input": "10001000 7",
"output": "7"
},
{
"input": "10001000 8",
"output": "7"
},
{
"input": "10001000 9",
"output": "7"
},
{
"input": "1000000001 1",
"output": "1"
},
{
"input": "1000000001 2",
"output": "1"
},
{
"input": "1000000001 3",
"output": "1"
},
{
"input": "1000000001 6",
"output": "1"
},
{
"input": "1000000001 7",
"output": "1"
},
{
"input": "1000000001 8",
"output": "1"
},
{
"input": "1000000001 9",
"output": "9"
},
{
"input": "1000 1",
"output": "0"
},
{
"input": "100001100 3",
"output": "2"
},
{
"input": "7057 6",
"output": "3"
},
{
"input": "30000000 5",
"output": "0"
},
{
"input": "470 1",
"output": "0"
},
{
"input": "500500000 4",
"output": "0"
},
{
"input": "2103 8",
"output": "3"
},
{
"input": "600000000 2",
"output": "0"
},
{
"input": "708404442 1",
"output": "4"
},
{
"input": "5000140 6",
"output": "6"
},
{
"input": "1100047 3",
"output": "2"
},
{
"input": "309500 5",
"output": "5"
},
{
"input": "70053160 4",
"output": "7"
},
{
"input": "44000 1",
"output": "0"
},
{
"input": "400370000 3",
"output": "0"
},
{
"input": "5800 6",
"output": "3"
},
{
"input": "20700050 1",
"output": "0"
},
{
"input": "650 1",
"output": "0"
},
{
"input": "320005070 6",
"output": "8"
},
{
"input": "370000 4",
"output": "0"
},
{
"input": "1011 2",
"output": "3"
},
{
"input": "1000111 5",
"output": "6"
},
{
"input": "1001111 5",
"output": "6"
},
{
"input": "99990 3",
"output": "4"
},
{
"input": "10100200 6",
"output": "7"
},
{
"input": "200 3",
"output": "2"
},
{
"input": "103055 3",
"output": "5"
},
{
"input": "1030555 3",
"output": "6"
},
{
"input": "100111 4",
"output": "5"
},
{
"input": "101 2",
"output": "2"
},
{
"input": "1001 3",
"output": "3"
},
{
"input": "100000 6",
"output": "5"
},
{
"input": "1100000 6",
"output": "6"
},
{
"input": "123450 2",
"output": "5"
},
{
"input": "1003 3",
"output": "3"
},
{
"input": "1111100 4",
"output": "6"
},
{
"input": "532415007 8",
"output": "8"
},
{
"input": "801 2",
"output": "2"
},
{
"input": "1230 2",
"output": "3"
},
{
"input": "9900 3",
"output": "3"
},
{
"input": "14540444 2",
"output": "7"
},
{
"input": "11111100 4",
"output": "7"
},
{
"input": "11001 3",
"output": "4"
},
{
"input": "1011110 3",
"output": "6"
},
{
"input": "15450112 2",
"output": "7"
},
{
"input": "2220 3",
"output": "3"
},
{
"input": "90099 3",
"output": "4"
},
{
"input": "10005 4",
"output": "4"
},
{
"input": "1010 3",
"output": "3"
},
{
"input": "444444400 3",
"output": "8"
},
{
"input": "10020 4",
"output": "4"
},
{
"input": "10303 3",
"output": "4"
},
{
"input": "123000 4",
"output": "5"
},
{
"input": "12300 3",
"output": "4"
},
{
"input": "101 1",
"output": "1"
},
{
"input": "500001 8",
"output": "5"
},
{
"input": "121002 3",
"output": "5"
},
{
"input": "10011 3",
"output": "4"
},
{
"input": "505050 4",
"output": "5"
},
{
"input": "1421011 2",
"output": "6"
},
{
"input": "1202022 3",
"output": "6"
},
{
"input": "1000023 7",
"output": "6"
},
{
"input": "110 2",
"output": "2"
},
{
"input": "111000 4",
"output": "5"
},
{
"input": "10340 3",
"output": "4"
},
{
"input": "101 9",
"output": "2"
},
{
"input": "2001 3",
"output": "3"
},
{
"input": "122320 2",
"output": "5"
},
{
"input": "22200 3",
"output": "4"
},
{
"input": "11110 2",
"output": "4"
},
{
"input": "11010 3",
"output": "4"
},
{
"input": "1000002333 6",
"output": "9"
},
{
"input": "101010 4",
"output": "5"
},
{
"input": "210 9",
"output": "2"
},
{
"input": "500555 3",
"output": "5"
},
{
"input": "1110111 3",
"output": "6"
},
{
"input": "1100000000 9",
"output": "9"
},
{
"input": "11000 4",
"output": "4"
},
{
"input": "100 4",
"output": "2"
},
{
"input": "234560 3",
"output": "5"
},
{
"input": "10230 3",
"output": "4"
},
{
"input": "10030234 5",
"output": "7"
},
{
"input": "1200 3",
"output": "3"
},
{
"input": "123400 3",
"output": "5"
},
{
"input": "1034543 4",
"output": "6"
},
{
"input": "10100 4",
"output": "4"
},
{
"input": "10 5",
"output": "1"
},
{
"input": "4501022 3",
"output": "6"
},
{
"input": "12340 2",
"output": "4"
},
{
"input": "30020 4",
"output": "4"
},
{
"input": "1111100 6",
"output": "6"
},
{
"input": "10101 5",
"output": "4"
},
{
"input": "32132100 3",
"output": "7"
},
{
"input": "1000023 6",
"output": "6"
},
{
"input": "12300 4",
"output": "4"
},
{
"input": "78400 3",
"output": "4"
},
{
"input": "10203049 5",
"output": "7"
},
{
"input": "404044 3",
"output": "5"
},
{
"input": "1024 2",
"output": "3"
},
{
"input": "505 2",
"output": "2"
},
{
"input": "20 2",
"output": "1"
},
{
"input": "1111100 3",
"output": "6"
},
{
"input": "1000 9",
"output": "3"
},
{
"input": "3333300 3",
"output": "6"
},
{
"input": "1100 3",
"output": "3"
},
{
"input": "963000 4",
"output": "5"
},
{
"input": "100457 5",
"output": "5"
},
{
"input": "10049 3",
"output": "4"
}
] | 1,534,327,415
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 93
| 0
|
n,k=map(int,input().split())
p=n%(10**k)
if n>=(10**k):
s=str(p)
print(len(s)-s.count('0'))
else :
s=str(n)
print(len(s)-1)
|
Title: Weird Rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is crazy about round numbers. He especially likes the numbers divisible by 10*k*.
In the given number of *n* Polycarp wants to remove the least number of digits to get a number that is divisible by 10*k*. For example, if *k*<==<=3, in the number 30020 it is enough to delete a single digit (2). In this case, the result is 3000 that is divisible by 103<==<=1000.
Write a program that prints the minimum number of digits to be deleted from the given integer number *n*, so that the result is divisible by 10*k*. The result should not start with the unnecessary leading zero (i.e., zero can start only the number 0, which is required to be written as exactly one digit).
It is guaranteed that the answer exists.
Input Specification:
The only line of the input contains two integer numbers *n* and *k* (0<=≤<=*n*<=≤<=2<=000<=000<=000, 1<=≤<=*k*<=≤<=9).
It is guaranteed that the answer exists. All numbers in the input are written in traditional notation of integers, that is, without any extra leading zeros.
Output Specification:
Print *w* — the required minimal number of digits to erase. After removing the appropriate *w* digits from the number *n*, the result should have a value that is divisible by 10*k*. The result can start with digit 0 in the single case (the result is zero and written by exactly the only digit 0).
Demo Input:
['30020 3\n', '100 9\n', '10203049 2\n']
Demo Output:
['1\n', '2\n', '3\n']
Note:
In the example 2 you can remove two digits: 1 and any 0. The result is number 0 which is divisible by any number.
|
```python
n,k=map(int,input().split())
p=n%(10**k)
if n>=(10**k):
s=str(p)
print(len(s)-s.count('0'))
else :
s=str(n)
print(len(s)-1)
```
| 0
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,693,031,362
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
def solve(s):
xs = {}
for c in s:
a = [i for i in range(len(s)) if s[i] == c]
if c not in xs:
xs[c] = a
last = -1
for c in 'hello':
a = [i for i in xs[c] if i > last]
if not a:
return False
last = min(a)
return True
def main():
s = input()
print(solve(s))
main()
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
def solve(s):
xs = {}
for c in s:
a = [i for i in range(len(s)) if s[i] == c]
if c not in xs:
xs[c] = a
last = -1
for c in 'hello':
a = [i for i in xs[c] if i > last]
if not a:
return False
last = min(a)
return True
def main():
s = input()
print(solve(s))
main()
```
| 0
|
262
|
B
|
Roma and Changing Signs
|
PROGRAMMING
| 1,200
|
[
"greedy"
] | null | null |
Roma works in a company that sells TVs. Now he has to prepare a report for the last year.
Roma has got a list of the company's incomes. The list is a sequence that consists of *n* integers. The total income of the company is the sum of all integers in sequence. Roma decided to perform exactly *k* changes of signs of several numbers in the sequence. He can also change the sign of a number one, two or more times.
The operation of changing a number's sign is the operation of multiplying this number by -1.
Help Roma perform the changes so as to make the total income of the company (the sum of numbers in the resulting sequence) maximum. Note that Roma should perform exactly *k* changes.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=105), showing, how many numbers are in the sequence and how many swaps are to be made.
The second line contains a non-decreasing sequence, consisting of *n* integers *a**i* (|*a**i*|<=≤<=104).
The numbers in the lines are separated by single spaces. Please note that the given sequence is sorted in non-decreasing order.
|
In the single line print the answer to the problem — the maximum total income that we can obtain after exactly *k* changes.
|
[
"3 2\n-1 -1 1\n",
"3 1\n-1 -1 1\n"
] |
[
"3\n",
"1\n"
] |
In the first sample we can get sequence [1, 1, 1], thus the total income equals 3.
In the second test, the optimal strategy is to get sequence [-1, 1, 1], thus the total income equals 1.
| 1,000
|
[
{
"input": "3 2\n-1 -1 1",
"output": "3"
},
{
"input": "3 1\n-1 -1 1",
"output": "1"
},
{
"input": "17 27\n257 320 676 1136 2068 2505 2639 4225 4951 5786 7677 7697 7851 8337 8429 8469 9343",
"output": "81852"
},
{
"input": "69 28\n-9822 -9264 -9253 -9221 -9139 -9126 -9096 -8981 -8521 -8313 -8257 -8253 -7591 -7587 -7301 -7161 -7001 -6847 -6441 -6241 -5949 -5896 -5713 -5692 -5644 -5601 -5545 -5525 -5331 -5253 -5041 -5000 -4951 -4855 -4384 -4293 -4251 -4001 -3991 -3762 -3544 -3481 -3261 -2983 -2882 -2857 -2713 -2691 -2681 -2653 -2221 -2043 -2011 -1997 -1601 -1471 -1448 -1363 -1217 -1217 -1129 -961 -926 -801 -376 -327 -305 -174 -91",
"output": "102443"
},
{
"input": "12 28\n-6652 -6621 -6471 -5559 -5326 -4551 -4401 -4326 -3294 -1175 -1069 -43",
"output": "49488"
},
{
"input": "78 13\n-9961 -9922 -9817 -9813 -9521 -9368 -9361 -9207 -9153 -9124 -9008 -8981 -8951 -8911 -8551 -8479 -8245 -8216 -7988 -7841 -7748 -7741 -7734 -7101 -6846 -6804 -6651 -6526 -6519 -6463 -6297 -6148 -6090 -5845 -5209 -5201 -5161 -5061 -4537 -4529 -4433 -4370 -4266 -4189 -4125 -3945 -3843 -3777 -3751 -3476 -3461 -3279 -3205 -3001 -2889 -2761 -2661 -2521 -2481 -2305 -2278 -2269 -2225 -1648 -1524 -1476 -1353 -1097 -867 -785 -741 -711 -692 -440 -401 -225 -65 -41",
"output": "-147832"
},
{
"input": "4 1\n218 3441 4901 7601",
"output": "15725"
},
{
"input": "73 26\n-8497 -8363 -7603 -7388 -6830 -6827 -6685 -6389 -6237 -6099 -6013 -5565 -5465 -4965 -4947 -4201 -3851 -3793 -3421 -3410 -3201 -3169 -3156 -2976 -2701 -2623 -2321 -2169 -1469 -1221 -950 -926 -9 47 236 457 773 1321 1485 1545 1671 1736 2014 2137 2174 2301 2625 3181 3536 3851 4041 4685 4981 4987 5145 5163 5209 5249 6011 6337 6790 7254 7361 7407 7969 7982 8083 8251 8407 8735 9660 9855 9957",
"output": "315919"
},
{
"input": "53 5\n-9821 -9429 -9146 -8973 -8807 -8801 -8321 -7361 -7222 -7161 -6913 -5961 -4877 -4756 -4753 -4661 -3375 -3031 -2950 -2661 -2161 -2041 -1111 -1071 -905 -697 -397 323 772 1617 1752 2736 2737 3201 3465 4029 4121 4463 4561 4637 4814 6119 6610 6641 6961 7217 7523 8045 8610 8915 9004 9265 9576",
"output": "92703"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n10000",
"output": "-10000"
},
{
"input": "1 2\n-1",
"output": "-1"
},
{
"input": "2 1\n0 1",
"output": "1"
},
{
"input": "2 2\n-1 0",
"output": "1"
},
{
"input": "5 6\n-3 -2 -1 5 6",
"output": "15"
},
{
"input": "3 3\n-50 -10 30",
"output": "70"
},
{
"input": "4 4\n-100 -90 -80 1",
"output": "269"
},
{
"input": "4 3\n-3 -2 1 2",
"output": "6"
},
{
"input": "6 4\n-6 -3 -2 1 2 3",
"output": "15"
},
{
"input": "5 6\n-10 -9 -8 1 2",
"output": "28"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "2 2\n-1 3",
"output": "2"
},
{
"input": "4 7\n-3 -2 1 6",
"output": "10"
},
{
"input": "4 3\n-7 -6 1 5",
"output": "17"
},
{
"input": "4 4\n-5 -1 1 2",
"output": "9"
}
] | 1,685,453,832
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 2
| 154
| 2,867,200
|
def main():
n, m = list(map(int , input().split()))
a = list(map(int ,input().split()))
a = sorted(a)
for el in range(m):
a[el] *= -1
print(sum(a))
main()
|
Title: Roma and Changing Signs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Roma works in a company that sells TVs. Now he has to prepare a report for the last year.
Roma has got a list of the company's incomes. The list is a sequence that consists of *n* integers. The total income of the company is the sum of all integers in sequence. Roma decided to perform exactly *k* changes of signs of several numbers in the sequence. He can also change the sign of a number one, two or more times.
The operation of changing a number's sign is the operation of multiplying this number by -1.
Help Roma perform the changes so as to make the total income of the company (the sum of numbers in the resulting sequence) maximum. Note that Roma should perform exactly *k* changes.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=105), showing, how many numbers are in the sequence and how many swaps are to be made.
The second line contains a non-decreasing sequence, consisting of *n* integers *a**i* (|*a**i*|<=≤<=104).
The numbers in the lines are separated by single spaces. Please note that the given sequence is sorted in non-decreasing order.
Output Specification:
In the single line print the answer to the problem — the maximum total income that we can obtain after exactly *k* changes.
Demo Input:
['3 2\n-1 -1 1\n', '3 1\n-1 -1 1\n']
Demo Output:
['3\n', '1\n']
Note:
In the first sample we can get sequence [1, 1, 1], thus the total income equals 3.
In the second test, the optimal strategy is to get sequence [-1, 1, 1], thus the total income equals 1.
|
```python
def main():
n, m = list(map(int , input().split()))
a = list(map(int ,input().split()))
a = sorted(a)
for el in range(m):
a[el] *= -1
print(sum(a))
main()
```
| -1
|
|
713
|
A
|
Sonya and Queries
|
PROGRAMMING
| 1,400
|
[
"data structures",
"implementation"
] | null | null |
Today Sonya learned about long integers and invited all her friends to share the fun. Sonya has an initially empty multiset with integers. Friends give her *t* queries, each of one of the following type:
1. <=+<= *a**i* — add non-negative integer *a**i* to the multiset. Note, that she has a multiset, thus there may be many occurrences of the same integer. 1. <=-<= *a**i* — delete a single occurrence of non-negative integer *a**i* from the multiset. It's guaranteed, that there is at least one *a**i* in the multiset. 1. ? *s* — count the number of integers in the multiset (with repetitions) that match some pattern *s* consisting of 0 and 1. In the pattern, 0 stands for the even digits, while 1 stands for the odd. Integer *x* matches the pattern *s*, if the parity of the *i*-th from the right digit in decimal notation matches the *i*-th from the right digit of the pattern. If the pattern is shorter than this integer, it's supplemented with 0-s from the left. Similarly, if the integer is shorter than the pattern its decimal notation is supplemented with the 0-s from the left.
For example, if the pattern is *s*<==<=010, than integers 92, 2212, 50 and 414 match the pattern, while integers 3, 110, 25 and 1030 do not.
|
The first line of the input contains an integer *t* (1<=≤<=*t*<=≤<=100<=000) — the number of operation Sonya has to perform.
Next *t* lines provide the descriptions of the queries in order they appear in the input file. The *i*-th row starts with a character *c**i* — the type of the corresponding operation. If *c**i* is equal to '+' or '-' then it's followed by a space and an integer *a**i* (0<=≤<=*a**i*<=<<=1018) given without leading zeroes (unless it's 0). If *c**i* equals '?' then it's followed by a space and a sequence of zeroes and onse, giving the pattern of length no more than 18.
It's guaranteed that there will be at least one query of type '?'.
It's guaranteed that any time some integer is removed from the multiset, there will be at least one occurrence of this integer in it.
|
For each query of the third type print the number of integers matching the given pattern. Each integer is counted as many times, as it appears in the multiset at this moment of time.
|
[
"12\n+ 1\n+ 241\n? 1\n+ 361\n- 241\n? 0101\n+ 101\n? 101\n- 101\n? 101\n+ 4000\n? 0\n",
"4\n+ 200\n+ 200\n- 200\n? 0\n"
] |
[
"2\n1\n2\n1\n1\n",
"1\n"
] |
Consider the integers matching the patterns from the queries of the third type. Queries are numbered in the order they appear in the input.
1. 1 and 241. 1. 361. 1. 101 and 361. 1. 361. 1. 4000.
| 500
|
[
{
"input": "12\n+ 1\n+ 241\n? 1\n+ 361\n- 241\n? 0101\n+ 101\n? 101\n- 101\n? 101\n+ 4000\n? 0",
"output": "2\n1\n2\n1\n1"
},
{
"input": "4\n+ 200\n+ 200\n- 200\n? 0",
"output": "1"
},
{
"input": "20\n+ 61\n+ 99\n+ 51\n+ 70\n+ 7\n+ 34\n+ 71\n+ 86\n+ 68\n+ 39\n+ 78\n+ 81\n+ 89\n? 10\n? 00\n? 10\n? 01\n? 01\n? 00\n? 00",
"output": "3\n2\n3\n4\n4\n2\n2"
},
{
"input": "20\n+ 13\n+ 50\n+ 9\n? 0\n+ 24\n? 0\n- 24\n? 0\n+ 79\n? 11\n- 13\n? 11\n- 50\n? 10\n? 1\n- 9\n? 1\n? 11\n- 79\n? 11",
"output": "0\n1\n0\n2\n1\n0\n1\n0\n1\n0"
},
{
"input": "10\n+ 870566619432760298\n+ 869797178280285214\n+ 609920823721618090\n+ 221159591436767023\n+ 730599542279836538\n? 101001100111001011\n? 001111010101010011\n? 100010100011101110\n? 100110010110001100\n? 110000011101110011",
"output": "0\n0\n0\n0\n0"
},
{
"input": "10\n+ 96135\n? 10111\n+ 63322\n? 10111\n+ 44490\n? 10111\n+ 69312\n? 10111\n? 01100\n+ 59396",
"output": "1\n1\n1\n1\n1"
},
{
"input": "10\n+ 2\n- 2\n+ 778\n+ 3\n+ 4\n- 4\n+ 1\n+ 617\n? 011\n? 011",
"output": "1\n1"
},
{
"input": "20\n+ 8\n+ 39532\n+ 813\n- 39532\n? 00011\n? 00000\n? 00011\n+ 70424\n- 8\n? 00011\n- 70424\n? 00011\n+ 29\n? 00001\n+ 6632\n+ 3319\n? 00001\n+ 3172\n? 01111\n- 29",
"output": "1\n1\n1\n1\n1\n1\n1\n1"
}
] | 1,546,947,363
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 732
| 3,891,200
|
n = int(input())
a = []
wk1 = "0" * 18
rules = str.maketrans("0123456789", "0101010101")
trans = lambda x : str.translate(x, rules)
d = {}
for _ in range(n):
x, y = input().split()
y = int(trans(y), 2)
if x == "+":
d[y] = d.get(y, 0) + 1
elif x == "-":
d[y] -= 1
elif x == "?":
print(d.get(y, 0))
|
Title: Sonya and Queries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today Sonya learned about long integers and invited all her friends to share the fun. Sonya has an initially empty multiset with integers. Friends give her *t* queries, each of one of the following type:
1. <=+<= *a**i* — add non-negative integer *a**i* to the multiset. Note, that she has a multiset, thus there may be many occurrences of the same integer. 1. <=-<= *a**i* — delete a single occurrence of non-negative integer *a**i* from the multiset. It's guaranteed, that there is at least one *a**i* in the multiset. 1. ? *s* — count the number of integers in the multiset (with repetitions) that match some pattern *s* consisting of 0 and 1. In the pattern, 0 stands for the even digits, while 1 stands for the odd. Integer *x* matches the pattern *s*, if the parity of the *i*-th from the right digit in decimal notation matches the *i*-th from the right digit of the pattern. If the pattern is shorter than this integer, it's supplemented with 0-s from the left. Similarly, if the integer is shorter than the pattern its decimal notation is supplemented with the 0-s from the left.
For example, if the pattern is *s*<==<=010, than integers 92, 2212, 50 and 414 match the pattern, while integers 3, 110, 25 and 1030 do not.
Input Specification:
The first line of the input contains an integer *t* (1<=≤<=*t*<=≤<=100<=000) — the number of operation Sonya has to perform.
Next *t* lines provide the descriptions of the queries in order they appear in the input file. The *i*-th row starts with a character *c**i* — the type of the corresponding operation. If *c**i* is equal to '+' or '-' then it's followed by a space and an integer *a**i* (0<=≤<=*a**i*<=<<=1018) given without leading zeroes (unless it's 0). If *c**i* equals '?' then it's followed by a space and a sequence of zeroes and onse, giving the pattern of length no more than 18.
It's guaranteed that there will be at least one query of type '?'.
It's guaranteed that any time some integer is removed from the multiset, there will be at least one occurrence of this integer in it.
Output Specification:
For each query of the third type print the number of integers matching the given pattern. Each integer is counted as many times, as it appears in the multiset at this moment of time.
Demo Input:
['12\n+ 1\n+ 241\n? 1\n+ 361\n- 241\n? 0101\n+ 101\n? 101\n- 101\n? 101\n+ 4000\n? 0\n', '4\n+ 200\n+ 200\n- 200\n? 0\n']
Demo Output:
['2\n1\n2\n1\n1\n', '1\n']
Note:
Consider the integers matching the patterns from the queries of the third type. Queries are numbered in the order they appear in the input.
1. 1 and 241. 1. 361. 1. 101 and 361. 1. 361. 1. 4000.
|
```python
n = int(input())
a = []
wk1 = "0" * 18
rules = str.maketrans("0123456789", "0101010101")
trans = lambda x : str.translate(x, rules)
d = {}
for _ in range(n):
x, y = input().split()
y = int(trans(y), 2)
if x == "+":
d[y] = d.get(y, 0) + 1
elif x == "-":
d[y] -= 1
elif x == "?":
print(d.get(y, 0))
```
| 3
|
|
1,005
|
C
|
Summarize to the Power of Two
|
PROGRAMMING
| 1,300
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
A sequence $a_1, a_2, \dots, a_n$ is called good if, for each element $a_i$, there exists an element $a_j$ ($i \ne j$) such that $a_i+a_j$ is a power of two (that is, $2^d$ for some non-negative integer $d$).
For example, the following sequences are good:
- $[5, 3, 11]$ (for example, for $a_1=5$ we can choose $a_2=3$. Note that their sum is a power of two. Similarly, such an element can be found for $a_2$ and $a_3$), - $[1, 1, 1, 1023]$, - $[7, 39, 89, 25, 89]$, - $[]$.
Note that, by definition, an empty sequence (with a length of $0$) is good.
For example, the following sequences are not good:
- $[16]$ (for $a_1=16$, it is impossible to find another element $a_j$ such that their sum is a power of two), - $[4, 16]$ (for $a_1=4$, it is impossible to find another element $a_j$ such that their sum is a power of two), - $[1, 3, 2, 8, 8, 8]$ (for $a_3=2$, it is impossible to find another element $a_j$ such that their sum is a power of two).
You are given a sequence $a_1, a_2, \dots, a_n$. What is the minimum number of elements you need to remove to make it good? You can delete an arbitrary set of elements.
|
The first line contains the integer $n$ ($1 \le n \le 120000$) — the length of the given sequence.
The second line contains the sequence of integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$).
|
Print the minimum number of elements needed to be removed from the given sequence in order to make it good. It is possible that you need to delete all $n$ elements, make it empty, and thus get a good sequence.
|
[
"6\n4 7 1 5 4 9\n",
"5\n1 2 3 4 5\n",
"1\n16\n",
"4\n1 1 1 1023\n"
] |
[
"1\n",
"2\n",
"1\n",
"0\n"
] |
In the first example, it is enough to delete one element $a_4=5$. The remaining elements form the sequence $[4, 7, 1, 4, 9]$, which is good.
| 0
|
[
{
"input": "6\n4 7 1 5 4 9",
"output": "1"
},
{
"input": "5\n1 2 3 4 5",
"output": "2"
},
{
"input": "1\n16",
"output": "1"
},
{
"input": "4\n1 1 1 1023",
"output": "0"
},
{
"input": "10\n2 10 9 1 10 4 7 8 5 4",
"output": "5"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n1 6",
"output": "2"
},
{
"input": "6\n1 7 7 7 7 7",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "3\n1 3 3",
"output": "0"
},
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "2\n2 2",
"output": "0"
},
{
"input": "2\n2 1",
"output": "2"
},
{
"input": "3\n1 1 3",
"output": "0"
},
{
"input": "3\n1 3 2",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
}
] | 1,633,132,629
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 3,000
| 8,089,600
|
n = int(input())
nl = list(map(int, input().split()))
a = []
for i in range(1, 31):
a.append(2**i)
k = 0
t = 0
c = 0
for i in nl:
for j in nl:
if i == j and t == 0:
t += 1
continue
else:
if ((i + j) in a) and (c == 0):
k += 1
c += 1
c = 0
t = 0
print(n-k)
# Sat Oct 02 2021 02:57:09 GMT+0300 (Москва, стандартное время)
|
Title: Summarize to the Power of Two
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A sequence $a_1, a_2, \dots, a_n$ is called good if, for each element $a_i$, there exists an element $a_j$ ($i \ne j$) such that $a_i+a_j$ is a power of two (that is, $2^d$ for some non-negative integer $d$).
For example, the following sequences are good:
- $[5, 3, 11]$ (for example, for $a_1=5$ we can choose $a_2=3$. Note that their sum is a power of two. Similarly, such an element can be found for $a_2$ and $a_3$), - $[1, 1, 1, 1023]$, - $[7, 39, 89, 25, 89]$, - $[]$.
Note that, by definition, an empty sequence (with a length of $0$) is good.
For example, the following sequences are not good:
- $[16]$ (for $a_1=16$, it is impossible to find another element $a_j$ such that their sum is a power of two), - $[4, 16]$ (for $a_1=4$, it is impossible to find another element $a_j$ such that their sum is a power of two), - $[1, 3, 2, 8, 8, 8]$ (for $a_3=2$, it is impossible to find another element $a_j$ such that their sum is a power of two).
You are given a sequence $a_1, a_2, \dots, a_n$. What is the minimum number of elements you need to remove to make it good? You can delete an arbitrary set of elements.
Input Specification:
The first line contains the integer $n$ ($1 \le n \le 120000$) — the length of the given sequence.
The second line contains the sequence of integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$).
Output Specification:
Print the minimum number of elements needed to be removed from the given sequence in order to make it good. It is possible that you need to delete all $n$ elements, make it empty, and thus get a good sequence.
Demo Input:
['6\n4 7 1 5 4 9\n', '5\n1 2 3 4 5\n', '1\n16\n', '4\n1 1 1 1023\n']
Demo Output:
['1\n', '2\n', '1\n', '0\n']
Note:
In the first example, it is enough to delete one element $a_4=5$. The remaining elements form the sequence $[4, 7, 1, 4, 9]$, which is good.
|
```python
n = int(input())
nl = list(map(int, input().split()))
a = []
for i in range(1, 31):
a.append(2**i)
k = 0
t = 0
c = 0
for i in nl:
for j in nl:
if i == j and t == 0:
t += 1
continue
else:
if ((i + j) in a) and (c == 0):
k += 1
c += 1
c = 0
t = 0
print(n-k)
# Sat Oct 02 2021 02:57:09 GMT+0300 (Москва, стандартное время)
```
| 0
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,671,302,821
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 92
| 0
|
n,k=map(int,input().split())
print('1/2')
#helllllllllllllloooooooo
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
n,k=map(int,input().split())
print('1/2')
#helllllllllllllloooooooo
```
| 0
|
591
|
B
|
Rebranding
|
PROGRAMMING
| 1,200
|
[
"implementation",
"strings"
] | null | null |
The name of one small but proud corporation consists of *n* lowercase English letters. The Corporation has decided to try rebranding — an active marketing strategy, that includes a set of measures to change either the brand (both for the company and the goods it produces) or its components: the name, the logo, the slogan. They decided to start with the name.
For this purpose the corporation has consecutively hired *m* designers. Once a company hires the *i*-th designer, he immediately contributes to the creation of a new corporation name as follows: he takes the newest version of the name and replaces all the letters *x**i* by *y**i*, and all the letters *y**i* by *x**i*. This results in the new version. It is possible that some of these letters do no occur in the string. It may also happen that *x**i* coincides with *y**i*. The version of the name received after the work of the last designer becomes the new name of the corporation.
Manager Arkady has recently got a job in this company, but is already soaked in the spirit of teamwork and is very worried about the success of the rebranding. Naturally, he can't wait to find out what is the new name the Corporation will receive.
Satisfy Arkady's curiosity and tell him the final version of the name.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the length of the initial name and the number of designers hired, respectively.
The second line consists of *n* lowercase English letters and represents the original name of the corporation.
Next *m* lines contain the descriptions of the designers' actions: the *i*-th of them contains two space-separated lowercase English letters *x**i* and *y**i*.
|
Print the new name of the corporation.
|
[
"6 1\npolice\np m\n",
"11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b\n"
] |
[
"molice\n",
"cdcbcdcfcdc\n"
] |
In the second sample the name of the corporation consecutively changes as follows:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c7648432f7138ca53234357d7e08d1d119166055.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/de89ad7bc7f27c46ec34f5e66ce0dc23bd5bc90a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/812e653c8d7ff496e6a0f04c676423806751531e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19c564fcefb8dde36256240a8b877bb6a4792bfe.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e1cafd93792430ad1a49e893e04715383bdae757.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "6 1\npolice\np m",
"output": "molice"
},
{
"input": "11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b",
"output": "cdcbcdcfcdc"
},
{
"input": "1 1\nf\nz h",
"output": "f"
},
{
"input": "1 1\na\na b",
"output": "b"
},
{
"input": "10 10\nlellelleel\ne l\ne l\ne l\ne l\ne l\ne e\nl l\nl e\nl l\ne e",
"output": "lellelleel"
}
] | 1,491,399,096
| 1,296
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 2,000
| 6,246,400
|
#!/bin/python3
import sys
n,m = map(int, input().split())
name = input()
c = [chr(ord('a') + i) for i in range(26)]
for i in range(m):
x,y = input().split()
for j in range(26):
if c[j] == x:
c[j] = y
elif c[j] == y:
c[j] = x
for i in range(n):
print(c[ord(name[i]) - ord('a')], end = '')
|
Title: Rebranding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The name of one small but proud corporation consists of *n* lowercase English letters. The Corporation has decided to try rebranding — an active marketing strategy, that includes a set of measures to change either the brand (both for the company and the goods it produces) or its components: the name, the logo, the slogan. They decided to start with the name.
For this purpose the corporation has consecutively hired *m* designers. Once a company hires the *i*-th designer, he immediately contributes to the creation of a new corporation name as follows: he takes the newest version of the name and replaces all the letters *x**i* by *y**i*, and all the letters *y**i* by *x**i*. This results in the new version. It is possible that some of these letters do no occur in the string. It may also happen that *x**i* coincides with *y**i*. The version of the name received after the work of the last designer becomes the new name of the corporation.
Manager Arkady has recently got a job in this company, but is already soaked in the spirit of teamwork and is very worried about the success of the rebranding. Naturally, he can't wait to find out what is the new name the Corporation will receive.
Satisfy Arkady's curiosity and tell him the final version of the name.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=200<=000) — the length of the initial name and the number of designers hired, respectively.
The second line consists of *n* lowercase English letters and represents the original name of the corporation.
Next *m* lines contain the descriptions of the designers' actions: the *i*-th of them contains two space-separated lowercase English letters *x**i* and *y**i*.
Output Specification:
Print the new name of the corporation.
Demo Input:
['6 1\npolice\np m\n', '11 6\nabacabadaba\na b\nb c\na d\ne g\nf a\nb b\n']
Demo Output:
['molice\n', 'cdcbcdcfcdc\n']
Note:
In the second sample the name of the corporation consecutively changes as follows:
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c7648432f7138ca53234357d7e08d1d119166055.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/de89ad7bc7f27c46ec34f5e66ce0dc23bd5bc90a.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/812e653c8d7ff496e6a0f04c676423806751531e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19c564fcefb8dde36256240a8b877bb6a4792bfe.png" style="max-width: 100.0%;max-height: 100.0%;"/>
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e1cafd93792430ad1a49e893e04715383bdae757.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
#!/bin/python3
import sys
n,m = map(int, input().split())
name = input()
c = [chr(ord('a') + i) for i in range(26)]
for i in range(m):
x,y = input().split()
for j in range(26):
if c[j] == x:
c[j] = y
elif c[j] == y:
c[j] = x
for i in range(n):
print(c[ord(name[i]) - ord('a')], end = '')
```
| 0
|
|
112
|
A
|
Petya and Strings
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Petya and Strings
|
2
|
256
|
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
|
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
|
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
|
[
"aaaa\naaaA\n",
"abs\nAbz\n",
"abcdefg\nAbCdEfF\n"
] |
[
"0\n",
"-1\n",
"1\n"
] |
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
| 500
|
[
{
"input": "aaaa\naaaA",
"output": "0"
},
{
"input": "abs\nAbz",
"output": "-1"
},
{
"input": "abcdefg\nAbCdEfF",
"output": "1"
},
{
"input": "asadasdasd\nasdwasdawd",
"output": "-1"
},
{
"input": "aslkjlkasdd\nasdlkjdajwi",
"output": "1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp",
"output": "0"
},
{
"input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH",
"output": "-1"
},
{
"input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt",
"output": "1"
},
{
"input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL",
"output": "1"
},
{
"input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo",
"output": "1"
},
{
"input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja",
"output": "-1"
},
{
"input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy",
"output": "1"
},
{
"input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR",
"output": "1"
},
{
"input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd",
"output": "1"
},
{
"input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI",
"output": "-1"
},
{
"input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC",
"output": "-1"
},
{
"input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl",
"output": "-1"
},
{
"input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo",
"output": "-1"
},
{
"input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV",
"output": "-1"
},
{
"input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ",
"output": "-1"
},
{
"input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK",
"output": "-1"
},
{
"input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys",
"output": "1"
},
{
"input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy",
"output": "-1"
},
{
"input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK",
"output": "-1"
},
{
"input": "UG\nak",
"output": "1"
},
{
"input": "JZR\nVae",
"output": "-1"
},
{
"input": "a\nZ",
"output": "-1"
},
{
"input": "rk\nkv",
"output": "1"
},
{
"input": "RvuT\nbJzE",
"output": "1"
},
{
"input": "PPS\nydq",
"output": "-1"
},
{
"input": "q\nq",
"output": "0"
},
{
"input": "peOw\nIgSJ",
"output": "1"
},
{
"input": "PyK\noKN",
"output": "1"
},
{
"input": "O\ni",
"output": "1"
},
{
"input": "NmGY\npDlP",
"output": "-1"
},
{
"input": "nG\nZf",
"output": "-1"
},
{
"input": "m\na",
"output": "1"
},
{
"input": "MWyB\nWZEV",
"output": "-1"
},
{
"input": "Gre\nfxc",
"output": "1"
},
{
"input": "Ooq\nwap",
"output": "-1"
},
{
"input": "XId\nlbB",
"output": "1"
},
{
"input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF",
"output": "0"
},
{
"input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD",
"output": "0"
},
{
"input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA",
"output": "0"
},
{
"input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ",
"output": "0"
},
{
"input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG",
"output": "0"
},
{
"input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ",
"output": "0"
},
{
"input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ",
"output": "0"
},
{
"input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi",
"output": "0"
},
{
"input": "abac\nadaa",
"output": "-1"
},
{
"input": "Bbc\nabc",
"output": "1"
},
{
"input": "aaaba\naaaab",
"output": "1"
}
] | 1,696,219,273
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 53
| 124
| 0
|
def comp(a, b):
return (a >= b) - (a <= b)
a = input()
b = input()
a1 = a.lower()
b1 = b.lower()
print(comp(a1, b1))
|
Title: Petya and Strings
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
Input Specification:
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
Output Specification:
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
Demo Input:
['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n']
Demo Output:
['0\n', '-1\n', '1\n']
Note:
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order
|
```python
def comp(a, b):
return (a >= b) - (a <= b)
a = input()
b = input()
a1 = a.lower()
b1 = b.lower()
print(comp(a1, b1))
```
| 3.969
|
282
|
A
|
Bit++
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order.
|
Print a single integer — the final value of *x*.
|
[
"1\n++X\n",
"2\nX++\n--X\n"
] |
[
"1\n",
"0\n"
] |
none
| 500
|
[
{
"input": "1\n++X",
"output": "1"
},
{
"input": "2\nX++\n--X",
"output": "0"
},
{
"input": "3\n++X\n++X\n++X",
"output": "3"
},
{
"input": "2\n--X\n--X",
"output": "-2"
},
{
"input": "5\n++X\n--X\n++X\n--X\n--X",
"output": "-1"
},
{
"input": "28\nX--\n++X\nX++\nX++\nX++\n--X\n--X\nX++\nX--\n++X\nX++\n--X\nX--\nX++\nX--\n++X\n++X\nX++\nX++\nX++\nX++\n--X\n++X\n--X\n--X\n--X\n--X\nX++",
"output": "4"
},
{
"input": "94\nX++\nX++\n++X\n++X\nX--\n--X\nX++\n--X\nX++\n++X\nX++\n++X\n--X\n--X\n++X\nX++\n--X\nX--\nX--\n--X\nX--\nX--\n--X\n++X\n--X\nX--\nX--\nX++\n++X\n--X\nX--\n++X\n--X\n--X\nX--\nX--\nX++\nX++\nX--\nX++\nX--\nX--\nX--\n--X\nX--\nX--\nX--\nX++\n++X\nX--\n++X\nX++\n--X\n--X\n--X\n--X\n++X\nX--\n--X\n--X\n++X\nX--\nX--\nX++\n++X\nX++\n++X\n--X\n--X\nX--\n++X\nX--\nX--\n++X\n++X\n++X\n++X\nX++\n++X\n--X\nX++\n--X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\nX--\nX--\n--X\n++X\nX++",
"output": "-10"
},
{
"input": "56\n--X\nX--\n--X\n--X\nX--\nX--\n--X\nX++\n++X\n--X\nX++\nX--\n--X\n++X\n--X\nX--\nX--\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\n++X\nX++\nX++\n--X\nX++\nX--\n--X\nX--\n--X\nX++\n++X\n--X\n++X\nX++\nX--\n--X\n--X\n++X\nX--\nX--\n--X\nX--\n--X\nX++\n--X\n++X\n--X",
"output": "-14"
},
{
"input": "59\nX--\n--X\nX++\n++X\nX--\n--X\n--X\n++X\n++X\n++X\n++X\nX++\n++X\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX++\n--X\n++X\nX++\n--X\n--X\nX++\nX++\n--X\nX++\nX++\nX++\nX--\nX--\n--X\nX++\nX--\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\nX--\n++X\n--X\nX++\nX++\nX--\nX++\n++X\nX--\nX++\nX--\nX--\n++X",
"output": "3"
},
{
"input": "87\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\nX--\n++X\n--X\n--X\nX++\n--X\nX--\nX++\n++X\n--X\n++X\n++X\n--X\n++X\n--X\nX--\n++X\n++X\nX--\nX++\nX++\n--X\n--X\n++X\nX--\n--X\n++X\n--X\nX++\n--X\n--X\nX--\n++X\n++X\n--X\nX--\nX--\nX--\nX--\nX--\nX++\n--X\n++X\n--X\nX++\n++X\nX++\n++X\n--X\nX++\n++X\nX--\n--X\nX++\n++X\nX++\nX++\n--X\n--X\n++X\n--X\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX--\n--X\n++X\n++X",
"output": "-5"
},
{
"input": "101\nX++\nX++\nX++\n++X\n--X\nX--\nX++\nX--\nX--\n--X\n--X\n++X\nX++\n++X\n++X\nX--\n--X\n++X\nX++\nX--\n++X\n--X\n--X\n--X\n++X\n--X\n++X\nX++\nX++\n++X\n--X\nX++\nX--\nX++\n++X\n++X\nX--\nX--\nX--\nX++\nX++\nX--\nX--\nX++\n++X\n++X\n++X\n--X\n--X\n++X\nX--\nX--\n--X\n++X\nX--\n++X\nX++\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n++X\n--X\nX++\n++X\nX--\n++X\nX--\n++X\nX++\nX--\n++X\nX++\n--X\nX++\nX++\n++X\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\n++X\n++X\n--X\nX--\nX--\nX--\nX--\n--X\n--X\n--X\n++X\n--X\n--X",
"output": "1"
},
{
"input": "63\n--X\nX--\n++X\n--X\n++X\nX++\n--X\n--X\nX++\n--X\n--X\nX++\nX--\nX--\n--X\n++X\nX--\nX--\nX++\n++X\nX++\nX++\n--X\n--X\n++X\nX--\nX--\nX--\n++X\nX++\nX--\n--X\nX--\n++X\n++X\nX++\n++X\nX++\nX++\n--X\nX--\n++X\nX--\n--X\nX--\nX--\nX--\n++X\n++X\n++X\n++X\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n++X\nX--\n++X\n++X\nX--",
"output": "1"
},
{
"input": "45\n--X\n++X\nX--\n++X\n++X\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX++\n++X\nX--\n++X\n++X\nX--\nX++\nX--\n--X\nX--\n++X\n++X\n--X\n--X\nX--\nX--\n--X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\nX--\n++X\n++X\nX++\nX++\n++X\n++X\nX++",
"output": "-3"
},
{
"input": "21\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX--\nX++\nX--\nX--\nX--\nX++\n++X\nX++\n++X\n--X\nX--\n--X\nX++\n++X",
"output": "1"
},
{
"input": "100\n--X\n++X\nX++\n++X\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\n++X\nX--\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n++X\nX++\n++X\nX--\n--X\n++X\nX--\n--X\n++X\n++X\nX--\nX++\nX++\nX++\n++X\n--X\n++X\nX++\nX--\n++X\n++X\n--X\n++X\nX--\nX--\nX--\nX++\nX--\nX--\nX++\nX++\n--X\nX++\nX++\n--X\nX--\n--X\n++X\n--X\n++X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\n++X\nX++\nX--\nX++\nX--\nX++\nX++\n--X\nX--\nX--\n++X\nX--\n--X\n--X\nX++\n--X\n--X\nX--\nX--\n++X\n++X\nX--\n++X\nX++\n--X\n++X\n++X\nX++\n--X\n--X\nX++",
"output": "8"
},
{
"input": "17\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n--X\nX--\nX++\nX--\n--X\n--X\nX--\n++X\nX--\nX++",
"output": "-1"
},
{
"input": "77\n++X\nX++\n--X\nX--\n--X\n--X\nX--\nX++\nX--\nX++\nX--\n++X\n--X\n--X\n--X\n--X\n++X\nX--\nX++\nX--\n--X\nX--\n--X\nX--\n++X\n--X\n++X\n++X\nX++\nX++\nX--\n--X\nX--\nX--\nX++\n--X\n--X\n++X\nX--\nX--\n++X\nX++\nX--\n++X\n--X\nX++\nX--\n++X\n++X\n++X\nX--\nX--\nX--\n--X\n++X\n++X\n++X\nX++\n--X\n--X\n++X\n--X\nX--\nX++\n++X\nX++\n++X\nX--\nX++\nX++\n--X\nX++\nX++\nX++\n--X\nX++\nX--",
"output": "-5"
},
{
"input": "21\nX--\n++X\n--X\nX--\n++X\nX--\n++X\nX--\n--X\n++X\nX++\n++X\nX++\n++X\nX--\n--X\nX++\nX++\nX--\n++X\nX--",
"output": "1"
},
{
"input": "1\nX--",
"output": "-1"
}
] | 1,697,863,940
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 46
| 0
|
print(sum(1 if '++' in input() else -1 for i in range(int(input()))))
|
Title: Bit++
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order.
Output Specification:
Print a single integer — the final value of *x*.
Demo Input:
['1\n++X\n', '2\nX++\n--X\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
print(sum(1 if '++' in input() else -1 for i in range(int(input()))))
```
| 3
|
|
727
|
A
|
Transformation: from A to B
|
PROGRAMMING
| 1,000
|
[
"brute force",
"dfs and similar",
"math"
] | null | null |
Vasily has a number *a*, which he wants to turn into a number *b*. For this purpose, he can do two types of operations:
- multiply the current number by 2 (that is, replace the number *x* by 2·*x*); - append the digit 1 to the right of current number (that is, replace the number *x* by 10·*x*<=+<=1).
You need to help Vasily to transform the number *a* into the number *b* using only the operations described above, or find that it is impossible.
Note that in this task you are not required to minimize the number of operations. It suffices to find any way to transform *a* into *b*.
|
The first line contains two positive integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=109) — the number which Vasily has and the number he wants to have.
|
If there is no way to get *b* from *a*, print "NO" (without quotes).
Otherwise print three lines. On the first line print "YES" (without quotes). The second line should contain single integer *k* — the length of the transformation sequence. On the third line print the sequence of transformations *x*1,<=*x*2,<=...,<=*x**k*, where:
- *x*1 should be equal to *a*, - *x**k* should be equal to *b*, - *x**i* should be obtained from *x**i*<=-<=1 using any of two described operations (1<=<<=*i*<=≤<=*k*).
If there are multiple answers, print any of them.
|
[
"2 162\n",
"4 42\n",
"100 40021\n"
] |
[
"YES\n5\n2 4 8 81 162 \n",
"NO\n",
"YES\n5\n100 200 2001 4002 40021 \n"
] |
none
| 1,000
|
[
{
"input": "2 162",
"output": "YES\n5\n2 4 8 81 162 "
},
{
"input": "4 42",
"output": "NO"
},
{
"input": "100 40021",
"output": "YES\n5\n100 200 2001 4002 40021 "
},
{
"input": "1 111111111",
"output": "YES\n9\n1 11 111 1111 11111 111111 1111111 11111111 111111111 "
},
{
"input": "1 1000000000",
"output": "NO"
},
{
"input": "999999999 1000000000",
"output": "NO"
},
{
"input": "1 2",
"output": "YES\n2\n1 2 "
},
{
"input": "1 536870912",
"output": "YES\n30\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 131072 262144 524288 1048576 2097152 4194304 8388608 16777216 33554432 67108864 134217728 268435456 536870912 "
},
{
"input": "11111 11111111",
"output": "YES\n4\n11111 111111 1111111 11111111 "
},
{
"input": "59139 946224",
"output": "YES\n5\n59139 118278 236556 473112 946224 "
},
{
"input": "9859 19718",
"output": "YES\n2\n9859 19718 "
},
{
"input": "25987 51974222",
"output": "YES\n5\n25987 259871 2598711 25987111 51974222 "
},
{
"input": "9411 188222222",
"output": "YES\n6\n9411 94111 941111 9411111 94111111 188222222 "
},
{
"input": "25539 510782222",
"output": "YES\n6\n25539 255391 2553911 25539111 255391111 510782222 "
},
{
"input": "76259 610072",
"output": "YES\n4\n76259 152518 305036 610072 "
},
{
"input": "92387 184774",
"output": "YES\n2\n92387 184774 "
},
{
"input": "8515 85151111",
"output": "YES\n5\n8515 85151 851511 8515111 85151111 "
},
{
"input": "91939 9193911",
"output": "YES\n3\n91939 919391 9193911 "
},
{
"input": "30518 610361",
"output": "YES\n3\n30518 61036 610361 "
},
{
"input": "46646 373168844",
"output": "YES\n7\n46646 466461 932922 9329221 93292211 186584422 373168844 "
},
{
"input": "30070 300701",
"output": "YES\n2\n30070 300701 "
},
{
"input": "13494 1079528",
"output": "YES\n5\n13494 134941 269882 539764 1079528 "
},
{
"input": "96918 775344422",
"output": "YES\n7\n96918 193836 1938361 3876722 38767221 387672211 775344422 "
},
{
"input": "13046 260921",
"output": "YES\n3\n13046 26092 260921 "
},
{
"input": "29174 5834811",
"output": "YES\n4\n29174 58348 583481 5834811 "
},
{
"input": "79894 319576421",
"output": "YES\n6\n79894 798941 1597882 15978821 31957642 319576421 "
},
{
"input": "96022 1920442",
"output": "YES\n3\n96022 960221 1920442 "
},
{
"input": "79446 6355681",
"output": "YES\n5\n79446 158892 317784 635568 6355681 "
},
{
"input": "5440 27853056",
"output": "YES\n11\n5440 10880 108801 217602 435204 870408 1740816 3481632 6963264 13926528 27853056 "
},
{
"input": "250000000 705032705",
"output": "NO"
},
{
"input": "17 35",
"output": "NO"
},
{
"input": "1 3",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
}
] | 1,617,661,078
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 77
| 307,200
|
n = []
def a_to_b(a, b):
if b % 2 == 0:
b = b / 2
if b >= a:
n.insert(0, int(b))
a_to_b(a, b)
elif b % 10 == 1:
b = b // 10
if b >= a:
n.insert(0, int(b))
a_to_b(a, b)
a, b = map(int, input().split())
a_to_b(a, b)
n.append(b)
if a in n:
print("YES")
print(len(n))
print(" ".join(map(str, n)))
else:
print("NO")
|
Title: Transformation: from A to B
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily has a number *a*, which he wants to turn into a number *b*. For this purpose, he can do two types of operations:
- multiply the current number by 2 (that is, replace the number *x* by 2·*x*); - append the digit 1 to the right of current number (that is, replace the number *x* by 10·*x*<=+<=1).
You need to help Vasily to transform the number *a* into the number *b* using only the operations described above, or find that it is impossible.
Note that in this task you are not required to minimize the number of operations. It suffices to find any way to transform *a* into *b*.
Input Specification:
The first line contains two positive integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=109) — the number which Vasily has and the number he wants to have.
Output Specification:
If there is no way to get *b* from *a*, print "NO" (without quotes).
Otherwise print three lines. On the first line print "YES" (without quotes). The second line should contain single integer *k* — the length of the transformation sequence. On the third line print the sequence of transformations *x*1,<=*x*2,<=...,<=*x**k*, where:
- *x*1 should be equal to *a*, - *x**k* should be equal to *b*, - *x**i* should be obtained from *x**i*<=-<=1 using any of two described operations (1<=<<=*i*<=≤<=*k*).
If there are multiple answers, print any of them.
Demo Input:
['2 162\n', '4 42\n', '100 40021\n']
Demo Output:
['YES\n5\n2 4 8 81 162 \n', 'NO\n', 'YES\n5\n100 200 2001 4002 40021 \n']
Note:
none
|
```python
n = []
def a_to_b(a, b):
if b % 2 == 0:
b = b / 2
if b >= a:
n.insert(0, int(b))
a_to_b(a, b)
elif b % 10 == 1:
b = b // 10
if b >= a:
n.insert(0, int(b))
a_to_b(a, b)
a, b = map(int, input().split())
a_to_b(a, b)
n.append(b)
if a in n:
print("YES")
print(len(n))
print(" ".join(map(str, n)))
else:
print("NO")
```
| 3
|
|
463
|
B
|
Caisa and Pylons
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math"
] | null | null |
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
|
Print a single number representing the minimum number of dollars paid by Caisa.
|
[
"5\n3 4 3 2 4\n",
"3\n4 4 4\n"
] |
[
"4\n",
"4\n"
] |
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
| 1,000
|
[
{
"input": "5\n3 4 3 2 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "99\n1401 2019 1748 3785 3236 3177 3443 3772 2138 1049 353 908 310 2388 1322 88 2160 2783 435 2248 1471 706 2468 2319 3156 3506 2794 1999 1983 2519 2597 3735 537 344 3519 3772 3872 2961 3895 2010 10 247 3269 671 2986 942 758 1146 77 1545 3745 1547 2250 2565 217 1406 2070 3010 3404 404 1528 2352 138 2065 3047 3656 2188 2919 2616 2083 1280 2977 2681 548 4000 1667 1489 1109 3164 1565 2653 3260 3463 903 1824 3679 2308 245 2689 2063 648 568 766 785 2984 3812 440 1172 2730",
"output": "4000"
},
{
"input": "68\n477 1931 3738 3921 2306 1823 3328 2057 661 3993 2967 3520 171 1739 1525 1817 209 3475 1902 2666 518 3283 3412 3040 3383 2331 1147 1460 1452 1800 1327 2280 82 1416 2200 2388 3238 1879 796 250 1872 114 121 2042 1853 1645 211 2061 1472 2464 726 1989 1746 489 1380 1128 2819 2527 2939 622 678 265 2902 1111 2032 1453 3850 1621",
"output": "3993"
},
{
"input": "30\n30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "30"
},
{
"input": "3\n3 2 1",
"output": "3"
},
{
"input": "1\n69",
"output": "69"
}
] | 1,696,827,058
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 30
| 0
|
n = int(input())
heights = input().split()
heights = [int(x) for x in heights]
left = 0
right = 1
difference = 0
while right != (len(heights) - 1):
difference += (heights[left] - heights[right])
left += 1
right = left + 1
print(heights[0] + difference)
|
Title: Caisa and Pylons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Caisa solved the problem with the sugar and now he is on the way back to home.
Caisa is playing a mobile game during his path. There are (*n*<=+<=1) pylons numbered from 0 to *n* in this game. The pylon with number 0 has zero height, the pylon with number *i* (*i*<=><=0) has height *h**i*. The goal of the game is to reach *n*-th pylon, and the only move the player can do is to jump from the current pylon (let's denote its number as *k*) to the next one (its number will be *k*<=+<=1). When the player have made such a move, its energy increases by *h**k*<=-<=*h**k*<=+<=1 (if this value is negative the player loses energy). The player must have non-negative amount of energy at any moment of the time.
Initially Caisa stand at 0 pylon and has 0 energy. The game provides a special opportunity: one can pay a single dollar and increase the height of anyone pylon by one. Caisa may use that opportunity several times, but he doesn't want to spend too much money. What is the minimal amount of money he must paid to reach the goal of the game?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105). The next line contains *n* integers *h*1, *h*2,<=..., *h**n* (1<=<=≤<=<=*h**i*<=<=≤<=<=105) representing the heights of the pylons.
Output Specification:
Print a single number representing the minimum number of dollars paid by Caisa.
Demo Input:
['5\n3 4 3 2 4\n', '3\n4 4 4\n']
Demo Output:
['4\n', '4\n']
Note:
In the first sample he can pay 4 dollars and increase the height of pylon with number 0 by 4 units. Then he can safely pass to the last pylon.
|
```python
n = int(input())
heights = input().split()
heights = [int(x) for x in heights]
left = 0
right = 1
difference = 0
while right != (len(heights) - 1):
difference += (heights[left] - heights[right])
left += 1
right = left + 1
print(heights[0] + difference)
```
| 0
|
|
253
|
C
|
Text Editor
|
PROGRAMMING
| 1,600
|
[
"data structures",
"dfs and similar",
"graphs",
"greedy",
"shortest paths"
] | null | null |
Vasya is pressing the keys on the keyboard reluctantly, squeezing out his ideas on the classical epos depicted in Homer's Odysseus... How can he explain to his literature teacher that he isn't going to become a writer? In fact, he is going to become a programmer. So, he would take great pleasure in writing a program, but none — in writing a composition.
As Vasya was fishing for a sentence in the dark pond of his imagination, he suddenly wondered: what is the least number of times he should push a key to shift the cursor from one position to another one?
Let's describe his question more formally: to type a text, Vasya is using the text editor. He has already written *n* lines, the *i*-th line contains *a**i* characters (including spaces). If some line contains *k* characters, then this line overall contains (*k*<=+<=1) positions where the cursor can stand: before some character or after all characters (at the end of the line). Thus, the cursor's position is determined by a pair of integers (*r*,<=*c*), where *r* is the number of the line and *c* is the cursor's position in the line (the positions are indexed starting from one from the beginning of the line).
Vasya doesn't use the mouse to move the cursor. He uses keys "Up", "Down", "Right" and "Left". When he pushes each of these keys, the cursor shifts in the needed direction. Let's assume that before the corresponding key is pressed, the cursor was located in the position (*r*,<=*c*), then Vasya pushed key:
- "Up": if the cursor was located in the first line (*r*<==<=1), then it does not move. Otherwise, it moves to the previous line (with number *r*<=-<=1), to the same position. At that, if the previous line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=-<=1;- "Down": if the cursor was located in the last line (*r*<==<=*n*), then it does not move. Otherwise, it moves to the next line (with number *r*<=+<=1), to the same position. At that, if the next line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=+<=1;- "Right": if the cursor can move to the right in this line (*c*<=<<=*a**r*<=+<=1), then it moves to the right (to position *c*<=+<=1). Otherwise, it is located at the end of the line and doesn't move anywhere when Vasya presses the "Right" key;- "Left": if the cursor can move to the left in this line (*c*<=><=1), then it moves to the left (to position *c*<=-<=1). Otherwise, it is located at the beginning of the line and doesn't move anywhere when Vasya presses the "Left" key.
You've got the number of lines in the text file and the number of characters, written in each line of this file. Find the least number of times Vasya should push the keys, described above, to shift the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the file. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105), separated by single spaces. The third line contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*r*2<=≤<=*n*,<=1<=≤<=*c*1<=≤<=*a**r*1<=+<=1,<=1<=≤<=*c*2<=≤<=*a**r*2<=+<=1).
|
Print a single integer — the minimum number of times Vasya should push a key to move the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
|
[
"4\n2 1 6 4\n3 4 4 2\n",
"4\n10 5 6 4\n1 11 4 2\n",
"3\n10 1 10\n1 10 1 1\n"
] |
[
"3\n",
"6\n",
"3\n"
] |
In the first sample the editor contains four lines. Let's represent the cursor's possible positions in the line as numbers. Letter *s* represents the cursor's initial position, letter *t* represents the last one. Then all possible positions of the cursor in the text editor are described by the following table.
123
12
123s567
1t345
One of the possible answers in the given sample is: "Left", "Down", "Left".
| 1,500
|
[
{
"input": "4\n2 1 6 4\n3 4 4 2",
"output": "3"
},
{
"input": "4\n10 5 6 4\n1 11 4 2",
"output": "6"
},
{
"input": "3\n10 1 10\n1 10 1 1",
"output": "3"
},
{
"input": "4\n2 1 6 4\n4 2 3 5",
"output": "4"
},
{
"input": "3\n20 3 20\n1 20 1 1",
"output": "5"
},
{
"input": "2\n10 1\n1 3 2 1",
"output": "2"
},
{
"input": "20\n3 1 9 9 6 1 3 4 5 6 7 3 1 9 9 1 9 1 5 7\n17 7 19 5",
"output": "5"
},
{
"input": "20\n81 90 11 68 23 18 78 75 45 86 58 37 21 15 98 40 53 100 10 70\n11 55 8 19",
"output": "7"
},
{
"input": "25\n55 47 5 63 55 11 8 32 0 62 41 7 17 70 33 6 41 68 37 82 33 64 28 33 12\n6 11 14 12",
"output": "19"
},
{
"input": "30\n77 38 82 87 88 1 90 3 79 69 64 36 85 12 1 19 80 89 75 56 49 28 10 31 37 65 27 84 10 72\n26 65 19 3",
"output": "15"
},
{
"input": "100\n119 384 220 357 394 123 371 57 6 221 219 79 305 292 71 113 428 326 166 235 120 404 77 223 2 171 81 1 119 307 200 323 89 294 178 421 125 197 89 154 335 46 210 311 216 182 246 262 195 99 175 153 310 302 417 167 222 349 63 325 175 345 6 78 9 147 126 308 229 295 175 368 230 116 95 254 443 15 299 265 322 171 179 184 435 115 384 324 213 359 414 159 322 49 209 296 376 173 369 302\n8 47 23 65",
"output": "73"
},
{
"input": "100\n120 336 161 474 285 126 321 63 82 303 421 110 143 279 505 231 40 413 20 421 271 30 465 186 495 156 225 445 530 156 516 305 360 261 123 5 50 377 124 8 115 529 395 408 271 166 121 240 336 348 352 359 487 471 171 379 381 182 109 425 252 434 131 430 461 386 33 189 481 461 163 89 374 505 525 526 132 468 80 88 90 538 280 281 552 415 194 41 333 296 297 205 40 79 22 219 108 213 158 410\n58 119 82 196",
"output": "186"
},
{
"input": "100\n9 8 5 2 10 6 10 10 1 9 8 5 0 9 1 6 6 2 3 9 9 3 2 7 2 7 8 10 6 6 2 8 5 0 0 8 7 3 0 4 7 5 9 0 3 6 9 6 5 0 4 9 4 7 7 1 5 8 2 4 10 3 9 8 10 6 10 7 4 9 0 1 3 6 6 2 1 1 5 7 0 9 6 0 4 6 8 4 7 6 1 9 4 3 10 9 7 0 0 7\n72 2 87 2",
"output": "16"
},
{
"input": "100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44\n6 76 89 15",
"output": "97"
},
{
"input": "100\n176 194 157 24 27 153 31 159 196 85 127 114 142 39 133 4 44 36 141 96 80 40 120 16 88 29 157 136 158 98 145 152 19 40 106 116 19 195 184 70 72 95 78 146 199 1 103 3 120 71 52 77 160 148 24 156 108 64 86 124 103 97 108 66 107 126 29 172 23 106 29 69 64 90 9 171 59 85 1 63 79 50 136 21 115 164 30 115 86 26 25 6 128 48 122 14 198 88 182 117\n71 4 85 80",
"output": "92"
},
{
"input": "100\n1622 320 1261 282 1604 57 1427 1382 904 911 1719 1682 984 1727 1301 1799 1110 1057 248 764 1642 1325 1172 1677 182 32 665 397 1146 73 412 554 973 874 774 1948 1676 1959 518 280 1467 568 613 760 594 252 224 1359 876 253 760 1566 929 1614 940 1079 288 245 1432 1647 1534 1768 1947 733 225 495 1239 644 124 522 1859 1856 1464 485 1962 131 1693 1622 242 1119 1290 538 998 1342 791 711 809 1407 1369 414 124 758 1104 1142 355 324 665 1155 551 1611\n36 1383 51 21",
"output": "47"
},
{
"input": "50\n966 151 777 841 507 884 487 813 29 230 966 819 390 482 137 365 391 693 56 756 327 500 895 22 361 619 8 516 21 770 572 53 497 682 162 32 308 309 110 470 699 318 947 658 720 679 435 645 481 42\n45 510 25 48",
"output": "59"
},
{
"input": "50\n4143 2907 2028 539 3037 1198 6597 3658 972 9809 854 4931 642 3170 9777 2992 7121 8094 6634 684 5580 4684 3397 7909 3908 3822 2137 8299 8146 2105 7578 4338 7363 8237 530 301 4566 1153 4795 5342 3257 6953 4401 8311 9977 9260 7019 7705 5416 6754\n21 3413 23 218",
"output": "112"
},
{
"input": "50\n8974 13208 81051 72024 84908 49874 22875 64935 27340 38682 28512 43441 78752 83458 63344 5723 83425 54009 61980 7824 59956 43184 49274 3896 44079 67313 68565 9138 55087 68458 43009 3685 22879 85032 84273 93643 64957 73428 57016 33405 85961 47708 90325 1352 1551 20935 76821 75406 59309 40757\n14 45232 2 6810",
"output": "1102"
},
{
"input": "100\n34 80 42 99 7 49 109 61 20 7 92 2 62 96 65 77 70 5 16 83 99 39 88 66 106 1 80 68 71 74 28 75 19 97 38 100 30 1 55 86 3 13 61 82 72 50 68 18 77 89 96 27 26 35 46 13 83 77 40 31 85 108 15 5 40 80 1 108 44 18 66 26 46 7 36 80 34 76 17 9 23 57 109 90 88 1 54 66 71 94 6 89 50 22 93 82 32 74 41 74\n91 7 56 3",
"output": "36"
},
{
"input": "100\n156 150 75 72 205 133 139 99 212 82 58 104 133 88 46 157 49 179 32 72 159 188 42 47 36 58 127 215 125 115 209 118 109 11 62 159 110 151 92 202 203 25 44 209 153 8 199 168 126 34 21 106 31 40 48 212 106 0 131 166 2 126 13 126 103 44 2 66 33 25 194 41 37 198 199 6 22 1 161 16 95 11 198 198 166 145 214 159 143 2 181 130 159 118 176 165 192 178 42 168\n49 12 66 23",
"output": "39"
},
{
"input": "100\n289 16 321 129 0 121 61 86 93 5 63 276 259 144 275 236 309 257 244 138 107 18 158 14 295 162 7 113 58 101 142 196 181 329 115 109 62 237 110 87 19 205 68 257 252 0 166 45 310 244 140 251 262 315 213 206 290 128 287 230 198 83 135 40 8 273 319 295 288 274 34 260 288 252 172 129 201 110 294 111 95 180 34 98 16 188 170 40 274 153 11 159 245 51 328 290 112 11 105 182\n99 53 21 77",
"output": "154"
},
{
"input": "10\n11284 10942 14160 10062 1858 6457 1336 13842 5498 4236\n1 7123 5 664",
"output": "681"
},
{
"input": "53\n29496 9630 10781 25744 28508 15670 8252 14284 25995 20215 24251 14240 1370 15724 28268 30377 4839 16791 33515 23776 24252 1045 15245 12839 17531 28591 13091 27339 23361 10997 30438 26977 26789 18402 32938 2106 26599 10733 29549 9760 31507 33572 16934 7273 26477 15040 23704 19905 1941 3861 5950 1265 34\n11 6571 1 3145",
"output": "1788"
},
{
"input": "31\n14324 29226 58374 19956 61695 71586 13261 11436 58443 34879 12689 62786 68194 34303 99201 67616 51364 67539 56799 60130 22021 64546 28331 75746 45036 43950 2150 61718 33030 37781 34319\n24 57393 7 6152",
"output": "4024"
},
{
"input": "23\n5397 13279 11741 20182 18311 20961 16720 11864 2486 14081 15637 16216 3736 437 16346 12449 20205 10949 14237 2213 15281 15271 19138\n5 11479 13 68",
"output": "380"
},
{
"input": "40\n41997 20736 34699 73866 45509 41964 36050 16673 10454 21166 28306 69335 6172 65943 78569 16794 10439 68061 40392 52510 78248 63851 45294 49929 22580 5574 40993 18334 73897 59148 47727 76645 4280 23651 58772 64500 13704 60366 37099 20336\n14 29991 16 11904",
"output": "1468"
},
{
"input": "16\n922 7593 4748 4103 7672 6001 1573 3973 8524 8265 4747 3202 4796 2637 889 9359\n12 2165 12 1654",
"output": "90"
},
{
"input": "18\n22746 9084 3942 1120 25391 25307 7409 1189 23473 26175 10964 13584 5541 500 24338 12272 15824 27656\n3 1395 12 90",
"output": "424"
},
{
"input": "45\n2286 4425 14666 34959 10792 3723 30132 34266 18100 22813 28627 23310 33911 27285 1211 993 15526 4751 13611 21400 25712 24437 27435 34808 33950 18373 33685 23487 5444 10249 21415 16368 35398 7889 30918 19940 1552 12164 34292 13922 10011 31377 24102 34539 11992\n20 21252 28 2058",
"output": "531"
},
{
"input": "29\n56328 80183 27682 79083 60680 12286 34299 8015 51808 50756 82133 45930 43695 65863 25178 70825 2288 15111 39667 39637 11453 62821 81484 84216 54524 53749 8396 67712 76146\n13 10739 9 3622",
"output": "1345"
},
{
"input": "46\n67864 68218 3593 30646 66413 65542 65322 26801 28984 61330 15247 16522 39142 14013 49272 41585 56739 6881 44227 7101 57657 21121 51857 39351 13500 71528 8488 66118 14756 43923 21284 20018 49049 60198 6181 62460 44141 55828 42636 14623 59758 68321 12192 29978 24745 16467\n27 5545 4 3766",
"output": "197"
},
{
"input": "70\n53691 15034 17444 13375 23285 29211 24567 21643 45514 10290 70111 24541 25072 5365 12162 34564 27535 48253 39581 13468 33718 35105 30468 50214 53365 74800 16749 33935 36346 54230 73796 26826 27866 41887 67566 40813 32267 58821 56828 26439 23708 32335 69515 33825 6092 20510 50174 11129 4592 74116 21498 77951 48056 28554 43904 21885 5967 40253 4990 70029 34374 41201 25399 6101 10354 61833 43646 20534 371 11111\n21 3911 45 1755",
"output": "1455"
},
{
"input": "10\n8121 10681 10179 10221 9410 5214 19040 17893 7862 4611\n7 7780 7 3369",
"output": "1249"
},
{
"input": "2\n1 2\n1 1 1 1",
"output": "0"
},
{
"input": "3\n1 10 20\n2 10 3 1",
"output": "4"
}
] | 1,689,349,475
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 45
| 124
| 0
|
import sys
sys.stdin = open('input.txt')
sys.stdout = open('output.txt', 'w')
n = int(input())
a = [int(x) for x in input().split()]
[r1, c1, r2, c2] = [int(x) for x in input().split()]
r1 -= 1
r2 -= 1
c1 -= 1
c2 -= 1
dr = r2 - r1
ddr = dr // abs(dr) if dr != 0 else 1
c = c1
for i in range(abs(dr)+1):
r = r1 + ddr*i
c = min(c, a[r])
pen1 = 0
for i in range(min(r1, r2)):
pen = (min(r1, r2) - i) * 2
if c > c2 and a[i] < c and a[i] <= min(a[i:min(r1, r2)]):
pen -= c - c2 - abs(a[i] - c2)
pen1 = min(pen1, pen)
pen2 = 0
for i in range(max(r1, r2)+1, n):
pen = (i - max(r1, r2)) * 2
if c > c2 and a[i] < c and a[i] <= min(a[max(r1, r2):i]):
pen -= c - c2 - abs(a[i] - c2)
pen2 = min(pen2, pen)
pen = abs(dr) + abs(c - c2)
print(min(pen + pen1, pen+ pen2))
|
Title: Text Editor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya is pressing the keys on the keyboard reluctantly, squeezing out his ideas on the classical epos depicted in Homer's Odysseus... How can he explain to his literature teacher that he isn't going to become a writer? In fact, he is going to become a programmer. So, he would take great pleasure in writing a program, but none — in writing a composition.
As Vasya was fishing for a sentence in the dark pond of his imagination, he suddenly wondered: what is the least number of times he should push a key to shift the cursor from one position to another one?
Let's describe his question more formally: to type a text, Vasya is using the text editor. He has already written *n* lines, the *i*-th line contains *a**i* characters (including spaces). If some line contains *k* characters, then this line overall contains (*k*<=+<=1) positions where the cursor can stand: before some character or after all characters (at the end of the line). Thus, the cursor's position is determined by a pair of integers (*r*,<=*c*), where *r* is the number of the line and *c* is the cursor's position in the line (the positions are indexed starting from one from the beginning of the line).
Vasya doesn't use the mouse to move the cursor. He uses keys "Up", "Down", "Right" and "Left". When he pushes each of these keys, the cursor shifts in the needed direction. Let's assume that before the corresponding key is pressed, the cursor was located in the position (*r*,<=*c*), then Vasya pushed key:
- "Up": if the cursor was located in the first line (*r*<==<=1), then it does not move. Otherwise, it moves to the previous line (with number *r*<=-<=1), to the same position. At that, if the previous line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=-<=1;- "Down": if the cursor was located in the last line (*r*<==<=*n*), then it does not move. Otherwise, it moves to the next line (with number *r*<=+<=1), to the same position. At that, if the next line was short, that is, the cursor couldn't occupy position *c* there, the cursor moves to the last position of the line with number *r*<=+<=1;- "Right": if the cursor can move to the right in this line (*c*<=<<=*a**r*<=+<=1), then it moves to the right (to position *c*<=+<=1). Otherwise, it is located at the end of the line and doesn't move anywhere when Vasya presses the "Right" key;- "Left": if the cursor can move to the left in this line (*c*<=><=1), then it moves to the left (to position *c*<=-<=1). Otherwise, it is located at the beginning of the line and doesn't move anywhere when Vasya presses the "Left" key.
You've got the number of lines in the text file and the number of characters, written in each line of this file. Find the least number of times Vasya should push the keys, described above, to shift the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the file. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=105), separated by single spaces. The third line contains four integers *r*1,<=*c*1,<=*r*2,<=*c*2 (1<=≤<=*r*1,<=*r*2<=≤<=*n*,<=1<=≤<=*c*1<=≤<=*a**r*1<=+<=1,<=1<=≤<=*c*2<=≤<=*a**r*2<=+<=1).
Output Specification:
Print a single integer — the minimum number of times Vasya should push a key to move the cursor from position (*r*1,<=*c*1) to position (*r*2,<=*c*2).
Demo Input:
['4\n2 1 6 4\n3 4 4 2\n', '4\n10 5 6 4\n1 11 4 2\n', '3\n10 1 10\n1 10 1 1\n']
Demo Output:
['3\n', '6\n', '3\n']
Note:
In the first sample the editor contains four lines. Let's represent the cursor's possible positions in the line as numbers. Letter *s* represents the cursor's initial position, letter *t* represents the last one. Then all possible positions of the cursor in the text editor are described by the following table.
123
12
123s567
1t345
One of the possible answers in the given sample is: "Left", "Down", "Left".
|
```python
import sys
sys.stdin = open('input.txt')
sys.stdout = open('output.txt', 'w')
n = int(input())
a = [int(x) for x in input().split()]
[r1, c1, r2, c2] = [int(x) for x in input().split()]
r1 -= 1
r2 -= 1
c1 -= 1
c2 -= 1
dr = r2 - r1
ddr = dr // abs(dr) if dr != 0 else 1
c = c1
for i in range(abs(dr)+1):
r = r1 + ddr*i
c = min(c, a[r])
pen1 = 0
for i in range(min(r1, r2)):
pen = (min(r1, r2) - i) * 2
if c > c2 and a[i] < c and a[i] <= min(a[i:min(r1, r2)]):
pen -= c - c2 - abs(a[i] - c2)
pen1 = min(pen1, pen)
pen2 = 0
for i in range(max(r1, r2)+1, n):
pen = (i - max(r1, r2)) * 2
if c > c2 and a[i] < c and a[i] <= min(a[max(r1, r2):i]):
pen -= c - c2 - abs(a[i] - c2)
pen2 = min(pen2, pen)
pen = abs(dr) + abs(c - c2)
print(min(pen + pen1, pen+ pen2))
```
| 3
|
|
601
|
A
|
The Two Routes
|
PROGRAMMING
| 1,600
|
[
"graphs",
"shortest paths"
] | null | null |
In Absurdistan, there are *n* towns (numbered 1 through *n*) and *m* bidirectional railways. There is also an absurdly simple road network — for each pair of different towns *x* and *y*, there is a bidirectional road between towns *x* and *y* if and only if there is no railway between them. Travelling to a different town using one railway or one road always takes exactly one hour.
A train and a bus leave town 1 at the same time. They both have the same destination, town *n*, and don't make any stops on the way (but they can wait in town *n*). The train can move only along railways and the bus can move only along roads.
You've been asked to plan out routes for the vehicles; each route can use any road/railway multiple times. One of the most important aspects to consider is safety — in order to avoid accidents at railway crossings, the train and the bus must not arrive at the same town (except town *n*) simultaneously.
Under these constraints, what is the minimum number of hours needed for both vehicles to reach town *n* (the maximum of arrival times of the bus and the train)? Note, that bus and train are not required to arrive to the town *n* at the same moment of time, but are allowed to do so.
|
The first line of the input contains two integers *n* and *m* (2<=≤<=*n*<=≤<=400, 0<=≤<=*m*<=≤<=*n*(*n*<=-<=1)<=/<=2) — the number of towns and the number of railways respectively.
Each of the next *m* lines contains two integers *u* and *v*, denoting a railway between towns *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*, *u*<=≠<=*v*).
You may assume that there is at most one railway connecting any two towns.
|
Output one integer — the smallest possible time of the later vehicle's arrival in town *n*. If it's impossible for at least one of the vehicles to reach town *n*, output <=-<=1.
|
[
"4 2\n1 3\n3 4\n",
"4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4\n",
"5 5\n4 2\n3 5\n4 5\n5 1\n1 2\n"
] |
[
"2\n",
"-1\n",
"3\n"
] |
In the first sample, the train can take the route <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c0aa60a06309ef607b7159fd7f3687ea0d943ce.png" style="max-width: 100.0%;max-height: 100.0%;"/> and the bus can take the route <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a26c2f3e93c9d9be6c21cb5d2bd6ac1f99f4ff55.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Note that they can arrive at town 4 at the same time.
In the second sample, Absurdistan is ruled by railwaymen. There are no roads, so there's no way for the bus to reach town 4.
| 500
|
[
{
"input": "4 2\n1 3\n3 4",
"output": "2"
},
{
"input": "4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4",
"output": "-1"
},
{
"input": "5 5\n4 2\n3 5\n4 5\n5 1\n1 2",
"output": "3"
},
{
"input": "5 4\n1 2\n3 2\n3 4\n5 4",
"output": "4"
},
{
"input": "3 1\n1 2",
"output": "-1"
},
{
"input": "2 1\n1 2",
"output": "-1"
},
{
"input": "2 0",
"output": "-1"
},
{
"input": "20 0",
"output": "-1"
},
{
"input": "381 0",
"output": "-1"
},
{
"input": "3 3\n1 2\n2 3\n3 1",
"output": "-1"
},
{
"input": "3 0",
"output": "-1"
},
{
"input": "3 1\n1 3",
"output": "2"
},
{
"input": "3 2\n2 3\n3 1",
"output": "-1"
},
{
"input": "4 1\n1 4",
"output": "2"
},
{
"input": "4 5\n1 3\n2 1\n3 4\n4 2\n2 3",
"output": "2"
},
{
"input": "20 1\n20 1",
"output": "2"
},
{
"input": "21 1\n21 1",
"output": "2"
},
{
"input": "100 1\n100 1",
"output": "2"
},
{
"input": "400 1\n1 400",
"output": "2"
},
{
"input": "5 5\n2 5\n1 2\n1 4\n1 3\n3 2",
"output": "2"
}
] | 1,624,554,452
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 93
| 1,843,200
|
from collections import deque
def solve(n,m,graph):
d = [float('inf')]*(n+1)
visited= [False]*(n+1)
d[1] = 0
q = deque([1])
while q:
node = q.popleft()
visited[node] = True
for v in graph[node]:
if not visited[v]:
d[v] = 1 + d[node]
q.append(v)
return d[n]
n, m = map(int, input().split())
train = [set() for _ in range(n+1)]
for _ in range(m):
a,b = map(int, input().split())
train[a].add(b)
train[b].add(a)
bus = [set() for _ in range(n+1)]
total = set(x for x in range(1,n+1))
for i in range(1,n):
bus[i] = total.difference(train[i])
first = solve(n,m,train)
second = solve(n,m,bus)
if first == float('inf') or second == float('inf'):
print(-1)
else:
print(max(first, second))
|
Title: The Two Routes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Absurdistan, there are *n* towns (numbered 1 through *n*) and *m* bidirectional railways. There is also an absurdly simple road network — for each pair of different towns *x* and *y*, there is a bidirectional road between towns *x* and *y* if and only if there is no railway between them. Travelling to a different town using one railway or one road always takes exactly one hour.
A train and a bus leave town 1 at the same time. They both have the same destination, town *n*, and don't make any stops on the way (but they can wait in town *n*). The train can move only along railways and the bus can move only along roads.
You've been asked to plan out routes for the vehicles; each route can use any road/railway multiple times. One of the most important aspects to consider is safety — in order to avoid accidents at railway crossings, the train and the bus must not arrive at the same town (except town *n*) simultaneously.
Under these constraints, what is the minimum number of hours needed for both vehicles to reach town *n* (the maximum of arrival times of the bus and the train)? Note, that bus and train are not required to arrive to the town *n* at the same moment of time, but are allowed to do so.
Input Specification:
The first line of the input contains two integers *n* and *m* (2<=≤<=*n*<=≤<=400, 0<=≤<=*m*<=≤<=*n*(*n*<=-<=1)<=/<=2) — the number of towns and the number of railways respectively.
Each of the next *m* lines contains two integers *u* and *v*, denoting a railway between towns *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*, *u*<=≠<=*v*).
You may assume that there is at most one railway connecting any two towns.
Output Specification:
Output one integer — the smallest possible time of the later vehicle's arrival in town *n*. If it's impossible for at least one of the vehicles to reach town *n*, output <=-<=1.
Demo Input:
['4 2\n1 3\n3 4\n', '4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4\n', '5 5\n4 2\n3 5\n4 5\n5 1\n1 2\n']
Demo Output:
['2\n', '-1\n', '3\n']
Note:
In the first sample, the train can take the route <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c0aa60a06309ef607b7159fd7f3687ea0d943ce.png" style="max-width: 100.0%;max-height: 100.0%;"/> and the bus can take the route <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a26c2f3e93c9d9be6c21cb5d2bd6ac1f99f4ff55.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Note that they can arrive at town 4 at the same time.
In the second sample, Absurdistan is ruled by railwaymen. There are no roads, so there's no way for the bus to reach town 4.
|
```python
from collections import deque
def solve(n,m,graph):
d = [float('inf')]*(n+1)
visited= [False]*(n+1)
d[1] = 0
q = deque([1])
while q:
node = q.popleft()
visited[node] = True
for v in graph[node]:
if not visited[v]:
d[v] = 1 + d[node]
q.append(v)
return d[n]
n, m = map(int, input().split())
train = [set() for _ in range(n+1)]
for _ in range(m):
a,b = map(int, input().split())
train[a].add(b)
train[b].add(a)
bus = [set() for _ in range(n+1)]
total = set(x for x in range(1,n+1))
for i in range(1,n):
bus[i] = total.difference(train[i])
first = solve(n,m,train)
second = solve(n,m,bus)
if first == float('inf') or second == float('inf'):
print(-1)
else:
print(max(first, second))
```
| 0
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.