contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
938
|
A
|
Word Correction
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
|
Output the word *s* after the correction.
|
[
"5\nweird\n",
"4\nword\n",
"5\naaeaa\n"
] |
[
"werd\n",
"word\n",
"a\n"
] |
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
| 0
|
[
{
"input": "5\nweird",
"output": "werd"
},
{
"input": "4\nword",
"output": "word"
},
{
"input": "5\naaeaa",
"output": "a"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyw",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyw"
},
{
"input": "69\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "12\nmmmmmmmmmmmm",
"output": "mmmmmmmmmmmm"
},
{
"input": "18\nyaywptqwuyiqypwoyw",
"output": "ywptqwuqypwow"
},
{
"input": "85\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "13\nmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmm"
},
{
"input": "10\nmmmmmmmmmm",
"output": "mmmmmmmmmm"
},
{
"input": "11\nmmmmmmmmmmm",
"output": "mmmmmmmmmmm"
},
{
"input": "15\nmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmm"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "14\nmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmm"
},
{
"input": "33\nmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm",
"output": "mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm"
},
{
"input": "79\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "90\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "2\naa",
"output": "a"
},
{
"input": "18\niuiuqpyyaoaetiwliu",
"output": "iqpytiwli"
},
{
"input": "5\nxxxxx",
"output": "xxxxx"
},
{
"input": "6\nxxxahg",
"output": "xxxahg"
},
{
"input": "3\nzcv",
"output": "zcv"
},
{
"input": "4\naepo",
"output": "apo"
},
{
"input": "5\nqqqqq",
"output": "qqqqq"
},
{
"input": "6\naaaaaa",
"output": "a"
},
{
"input": "4\naeta",
"output": "ata"
},
{
"input": "20\nttyttlwaoieulyiluuri",
"output": "ttyttlwalyluri"
},
{
"input": "1\nb",
"output": "b"
},
{
"input": "3\nanc",
"output": "anc"
},
{
"input": "1\ne",
"output": "e"
},
{
"input": "3\naie",
"output": "a"
},
{
"input": "3\nvio",
"output": "vi"
},
{
"input": "2\nea",
"output": "e"
},
{
"input": "3\nuas",
"output": "us"
},
{
"input": "2\nba",
"output": "ba"
},
{
"input": "2\naq",
"output": "aq"
},
{
"input": "2\nya",
"output": "y"
},
{
"input": "2\nou",
"output": "o"
},
{
"input": "2\nbb",
"output": "bb"
},
{
"input": "7\nayylmao",
"output": "alma"
},
{
"input": "2\nab",
"output": "ab"
},
{
"input": "19\nyuouiyaoiiweqrryqqp",
"output": "yweqrryqqp"
},
{
"input": "25\niqypwqpriiioetiuqqqttouei",
"output": "iqypwqpritiqqqtto"
},
{
"input": "100\naaaaabbbbboyoyoyoyoyacadabbbbbiuiufgiuiuaahjabbbklboyoyoyoyoyaaaaabbbbbiuiuiuiuiuaaaaabbbbbeyiyuyzyz",
"output": "abbbbbocadabbbbbifgihjabbbklbobbbbbibbbbbezyz"
},
{
"input": "17\naccccccccccccccca",
"output": "accccccccccccccca"
},
{
"input": "5\nababa",
"output": "ababa"
},
{
"input": "10\naaaaaaaaaa",
"output": "a"
},
{
"input": "22\naaaaabbbbboyoyoyoyoyac",
"output": "abbbbboc"
},
{
"input": "7\nmahmoud",
"output": "mahmod"
}
] | 1,668,339,270
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 46
| 0
|
n = int(input())
s = list(input())
v = "aeiouy"
def vowel(c):
return not v.find(c) != -1
ans = s[0]
for i in range(1, n):
if vowel(s[i-1]) or vowel(s[i]):
ans += s[i]
print(ans)
|
Title: Word Correction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Victor tries to write his own text editor, with word correction included. However, the rules of word correction are really strange.
Victor thinks that if a word contains two consecutive vowels, then it's kinda weird and it needs to be replaced. So the word corrector works in such a way: as long as there are two consecutive vowels in the word, it deletes the first vowel in a word such that there is another vowel right before it. If there are no two consecutive vowels in the word, it is considered to be correct.
You are given a word *s*. Can you predict what will it become after correction?
In this problem letters a, e, i, o, u and y are considered to be vowels.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of letters in word *s* before the correction.
The second line contains a string *s* consisting of exactly *n* lowercase Latin letters — the word before the correction.
Output Specification:
Output the word *s* after the correction.
Demo Input:
['5\nweird\n', '4\nword\n', '5\naaeaa\n']
Demo Output:
['werd\n', 'word\n', 'a\n']
Note:
Explanations of the examples:
1. There is only one replace: weird <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> werd;1. No replace needed since there are no two consecutive vowels;1. aaeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aeaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aaa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> aa <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> a.
|
```python
n = int(input())
s = list(input())
v = "aeiouy"
def vowel(c):
return not v.find(c) != -1
ans = s[0]
for i in range(1, n):
if vowel(s[i-1]) or vowel(s[i]):
ans += s[i]
print(ans)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Alyona's mother wants to present an array of *n* non-negative integers to Alyona. The array should be special.
Alyona is a capricious girl so after she gets the array, she inspects *m* of its subarrays. Subarray is a set of some subsequent elements of the array. The *i*-th subarray is described with two integers *l**i* and *r**i*, and its elements are *a*[*l**i*],<=*a*[*l**i*<=+<=1],<=...,<=*a*[*r**i*].
Alyona is going to find mex for each of the chosen subarrays. Among these *m* mexes the girl is going to find the smallest. She wants this minimum mex to be as large as possible.
You are to find an array *a* of *n* elements so that the minimum mex among those chosen by Alyona subarrays is as large as possible.
The mex of a set *S* is a minimum possible non-negative integer that is not in *S*.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105).
The next *m* lines contain information about the subarrays chosen by Alyona. The *i*-th of these lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), that describe the subarray *a*[*l**i*],<=*a*[*l**i*<=+<=1],<=...,<=*a*[*r**i*].
|
In the first line print single integer — the maximum possible minimum mex.
In the second line print *n* integers — the array *a*. All the elements in *a* should be between 0 and 109.
It is guaranteed that there is an optimal answer in which all the elements in *a* are between 0 and 109.
If there are multiple solutions, print any of them.
|
[
"5 3\n1 3\n2 5\n4 5\n",
"4 2\n1 4\n2 4\n"
] |
[
"2\n1 0 2 1 0\n",
"3\n5 2 0 1"
] |
The first example: the mex of the subarray (1, 3) is equal to 3, the mex of the subarray (2, 5) is equal to 3, the mex of the subarray (4, 5) is equal to 2 as well, thus the minumal mex among the subarrays chosen by Alyona is equal to 2.
| 0
|
[
{
"input": "5 3\n1 3\n2 5\n4 5",
"output": "2\n0 1 0 1 0"
},
{
"input": "4 2\n1 4\n2 4",
"output": "3\n0 1 2 0"
},
{
"input": "1 1\n1 1",
"output": "1\n0"
},
{
"input": "2 1\n2 2",
"output": "1\n0 0"
},
{
"input": "5 6\n2 4\n2 3\n1 4\n3 4\n2 5\n1 3",
"output": "2\n0 1 0 1 0"
},
{
"input": "8 3\n2 3\n2 8\n3 6",
"output": "2\n0 1 0 1 0 1 0 1"
},
{
"input": "10 10\n1 9\n4 8\n4 8\n5 9\n1 9\n3 8\n1 6\n1 9\n1 6\n6 9",
"output": "4\n0 1 2 3 0 1 2 3 0 1"
},
{
"input": "3 6\n1 3\n1 3\n1 1\n1 1\n3 3\n3 3",
"output": "1\n0 0 0"
},
{
"input": "3 3\n1 3\n2 2\n1 3",
"output": "1\n0 0 0"
},
{
"input": "6 8\n3 5\n3 6\n4 6\n2 5\n2 5\n1 3\n3 6\n3 5",
"output": "3\n0 1 2 0 1 2"
},
{
"input": "10 4\n4 10\n4 6\n6 8\n1 10",
"output": "3\n0 1 2 0 1 2 0 1 2 0"
},
{
"input": "9 1\n1 1",
"output": "1\n0 0 0 0 0 0 0 0 0"
},
{
"input": "3 8\n2 3\n1 3\n1 2\n2 3\n1 3\n2 2\n1 2\n1 2",
"output": "1\n0 0 0"
},
{
"input": "3 8\n1 2\n1 2\n1 1\n2 3\n2 3\n1 1\n1 3\n1 3",
"output": "1\n0 0 0"
},
{
"input": "7 3\n7 7\n3 7\n5 7",
"output": "1\n0 0 0 0 0 0 0"
},
{
"input": "9 9\n4 5\n5 8\n1 8\n4 8\n3 4\n7 8\n1 4\n7 8\n6 7",
"output": "2\n0 1 0 1 0 1 0 1 0"
},
{
"input": "10 10\n1 5\n7 10\n2 10\n2 5\n2 9\n5 9\n3 10\n4 9\n6 9\n2 7",
"output": "4\n0 1 2 3 0 1 2 3 0 1"
},
{
"input": "8 7\n5 8\n3 7\n1 8\n3 4\n2 8\n2 7\n4 6",
"output": "2\n0 1 0 1 0 1 0 1"
},
{
"input": "10 3\n2 4\n8 10\n4 6",
"output": "3\n0 1 2 0 1 2 0 1 2 0"
},
{
"input": "5 8\n3 4\n1 5\n3 4\n3 5\n3 4\n1 4\n1 5\n2 5",
"output": "2\n0 1 0 1 0"
},
{
"input": "9 4\n5 9\n3 8\n2 8\n1 4",
"output": "4\n0 1 2 3 0 1 2 3 0"
},
{
"input": "7 7\n2 4\n1 4\n3 6\n2 6\n5 7\n3 6\n1 4",
"output": "3\n0 1 2 0 1 2 0"
},
{
"input": "6 2\n4 6\n2 5",
"output": "3\n0 1 2 0 1 2"
},
{
"input": "7 9\n6 7\n1 2\n2 5\n4 7\n1 7\n5 6\n2 3\n6 7\n1 2",
"output": "2\n0 1 0 1 0 1 0"
}
] | 1,639,548,290
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
def solve(n,m):
res=n
for i in range(m):
l,r=map(int,input().split())
res=min(res,r-l+1)
ans=[i for i in range(res)]*(n//res+1)
print(res)
print(*ans)
n,m=map(int,input().split())
solve(n,m)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alyona's mother wants to present an array of *n* non-negative integers to Alyona. The array should be special.
Alyona is a capricious girl so after she gets the array, she inspects *m* of its subarrays. Subarray is a set of some subsequent elements of the array. The *i*-th subarray is described with two integers *l**i* and *r**i*, and its elements are *a*[*l**i*],<=*a*[*l**i*<=+<=1],<=...,<=*a*[*r**i*].
Alyona is going to find mex for each of the chosen subarrays. Among these *m* mexes the girl is going to find the smallest. She wants this minimum mex to be as large as possible.
You are to find an array *a* of *n* elements so that the minimum mex among those chosen by Alyona subarrays is as large as possible.
The mex of a set *S* is a minimum possible non-negative integer that is not in *S*.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105).
The next *m* lines contain information about the subarrays chosen by Alyona. The *i*-th of these lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*), that describe the subarray *a*[*l**i*],<=*a*[*l**i*<=+<=1],<=...,<=*a*[*r**i*].
Output Specification:
In the first line print single integer — the maximum possible minimum mex.
In the second line print *n* integers — the array *a*. All the elements in *a* should be between 0 and 109.
It is guaranteed that there is an optimal answer in which all the elements in *a* are between 0 and 109.
If there are multiple solutions, print any of them.
Demo Input:
['5 3\n1 3\n2 5\n4 5\n', '4 2\n1 4\n2 4\n']
Demo Output:
['2\n1 0 2 1 0\n', '3\n5 2 0 1']
Note:
The first example: the mex of the subarray (1, 3) is equal to 3, the mex of the subarray (2, 5) is equal to 3, the mex of the subarray (4, 5) is equal to 2 as well, thus the minumal mex among the subarrays chosen by Alyona is equal to 2.
|
```python
def solve(n,m):
res=n
for i in range(m):
l,r=map(int,input().split())
res=min(res,r-l+1)
ans=[i for i in range(res)]*(n//res+1)
print(res)
print(*ans)
n,m=map(int,input().split())
solve(n,m)
```
| 0
|
|
618
|
A
|
Slime Combining
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right.
|
The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000).
|
Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left.
|
[
"1\n",
"2\n",
"3\n",
"8\n"
] |
[
"1\n",
"2\n",
"2 1\n",
"4\n"
] |
In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4
| 500
|
[
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "8",
"output": "4"
},
{
"input": "100000",
"output": "17 16 11 10 8 6"
},
{
"input": "12345",
"output": "14 13 6 5 4 1"
},
{
"input": "32",
"output": "6"
},
{
"input": "70958",
"output": "17 13 11 9 6 4 3 2"
},
{
"input": "97593",
"output": "17 15 14 13 12 11 9 6 5 4 1"
},
{
"input": "91706",
"output": "17 15 14 11 10 6 5 4 2"
},
{
"input": "85371",
"output": "17 15 12 11 9 7 6 5 4 2 1"
},
{
"input": "97205",
"output": "17 15 14 13 12 10 9 8 6 5 3 1"
},
{
"input": "34768",
"output": "16 11 10 9 8 7 5"
},
{
"input": "12705",
"output": "14 13 9 8 6 1"
},
{
"input": "30151",
"output": "15 14 13 11 9 8 7 3 2 1"
},
{
"input": "4974",
"output": "13 10 9 7 6 4 3 2"
},
{
"input": "32728",
"output": "15 14 13 12 11 10 9 8 7 5 4"
},
{
"input": "8192",
"output": "14"
},
{
"input": "65536",
"output": "17"
},
{
"input": "32",
"output": "6"
},
{
"input": "256",
"output": "9"
},
{
"input": "4096",
"output": "13"
},
{
"input": "33301",
"output": "16 10 5 3 1"
},
{
"input": "16725",
"output": "15 9 7 5 3 1"
},
{
"input": "149",
"output": "8 5 3 1"
},
{
"input": "16277",
"output": "14 13 12 11 10 9 8 5 3 1"
},
{
"input": "99701",
"output": "17 16 11 9 7 6 5 3 1"
}
] | 1,549,692,527
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 93
| 0
|
f=lambda:map(int,input().split())
n=int(input())
s='1 '*n
for i in range(1,n//2):
s=s.replace(str(i)+' '+str(i),str(i+1))
print(s)
|
Title: Slime Combining
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right.
Input Specification:
The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000).
Output Specification:
Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left.
Demo Input:
['1\n', '2\n', '3\n', '8\n']
Demo Output:
['1\n', '2\n', '2 1\n', '4\n']
Note:
In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4
|
```python
f=lambda:map(int,input().split())
n=int(input())
s='1 '*n
for i in range(1,n//2):
s=s.replace(str(i)+' '+str(i),str(i+1))
print(s)
```
| 0
|
|
121
|
A
|
Lucky Sum
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Let *next*(*x*) be the minimum lucky number which is larger than or equals *x*. Petya is interested what is the value of the expression *next*(*l*)<=+<=*next*(*l*<=+<=1)<=+<=...<=+<=*next*(*r*<=-<=1)<=+<=*next*(*r*). Help him solve this problem.
|
The single line contains two integers *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=109) — the left and right interval limits.
|
In the single line print the only number — the sum *next*(*l*)<=+<=*next*(*l*<=+<=1)<=+<=...<=+<=*next*(*r*<=-<=1)<=+<=*next*(*r*).
Please do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
[
"2 7\n",
"7 7\n"
] |
[
"33\n",
"7\n"
] |
In the first sample: *next*(2) + *next*(3) + *next*(4) + *next*(5) + *next*(6) + *next*(7) = 4 + 4 + 4 + 7 + 7 + 7 = 33
In the second sample: *next*(7) = 7
| 500
|
[
{
"input": "2 7",
"output": "33"
},
{
"input": "7 7",
"output": "7"
},
{
"input": "1 9",
"output": "125"
},
{
"input": "4 7",
"output": "25"
},
{
"input": "12 47",
"output": "1593"
},
{
"input": "6 77",
"output": "4012"
},
{
"input": "1 100",
"output": "14247"
},
{
"input": "1000000000 1000000000",
"output": "4444444444"
},
{
"input": "77 77",
"output": "77"
},
{
"input": "69 788",
"output": "452195"
},
{
"input": "474 747",
"output": "202794"
},
{
"input": "4 77777",
"output": "4070145675"
},
{
"input": "1 1000000",
"output": "1394675359387"
},
{
"input": "47 744447",
"output": "381286992761"
},
{
"input": "47444 1000000000",
"output": "1394672348253941136"
},
{
"input": "48 854888",
"output": "749733199853"
},
{
"input": "854444 985555",
"output": "582719941728"
},
{
"input": "774744 774747",
"output": "3098985"
},
{
"input": "654 987654",
"output": "1339803940266"
},
{
"input": "477777 1000000000",
"output": "1394672167300009765"
},
{
"input": "77777 777777777",
"output": "407018021649898097"
},
{
"input": "963 85555574",
"output": "7526978888069560"
},
{
"input": "47 7444",
"output": "38125896"
},
{
"input": "1 1000000000",
"output": "1394672350065645019"
},
{
"input": "474 999888555",
"output": "1394177038954402791"
},
{
"input": "777 1000000000",
"output": "1394672350065239125"
},
{
"input": "7 777777774",
"output": "407018023386632646"
},
{
"input": "369 852",
"output": "606732"
},
{
"input": "47 47",
"output": "47"
},
{
"input": "747 748",
"output": "1521"
},
{
"input": "77777440 77777444",
"output": "388887220"
},
{
"input": "987545885 999875584",
"output": "54798666661186800"
},
{
"input": "2 777777776",
"output": "407018024942188226"
},
{
"input": "1 1",
"output": "4"
},
{
"input": "1 2",
"output": "8"
},
{
"input": "999999999 1000000000",
"output": "8888888888"
},
{
"input": "777777777 1000000000",
"output": "987654325123456789"
},
{
"input": "777777778 1000000000",
"output": "987654324345679012"
},
{
"input": "5 6",
"output": "14"
},
{
"input": "49 49",
"output": "74"
},
{
"input": "6 6",
"output": "7"
},
{
"input": "3 4",
"output": "8"
}
] | 1,512,192,091
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 62
| 5,632,000
|
# your code goes here
arr = input().split()
l = int(arr[0])
r = int(arr[1])
num = '4'
lucky = []
while 1:
lucky.append(int(num))
if int(num) > r:
break
n = len(num)
flag = 0
arr = list(num)
for i in range(n):
if arr[n-i-1] == '4':
flag = 1
i = n-i-1
break
if flag == 1:
arr[i] = '7'
else:
arr.insert(0, '4')
i = 0
n += 1
i += 1
while i < n:
arr[i] = '4'
i += 1
num = ''.join(arr)
# print(num)
n = len(lucky)
prev = l
ans = 0
for i in range(n):
next = lucky[i]
if next < prev:
continue
if r < next:
next = r
ans += (next - prev + 1)*lucky[i]
prev = next+1
if prev > r:
break
print(ans)
|
Title: Lucky Sum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Let *next*(*x*) be the minimum lucky number which is larger than or equals *x*. Petya is interested what is the value of the expression *next*(*l*)<=+<=*next*(*l*<=+<=1)<=+<=...<=+<=*next*(*r*<=-<=1)<=+<=*next*(*r*). Help him solve this problem.
Input Specification:
The single line contains two integers *l* and *r* (1<=≤<=*l*<=≤<=*r*<=≤<=109) — the left and right interval limits.
Output Specification:
In the single line print the only number — the sum *next*(*l*)<=+<=*next*(*l*<=+<=1)<=+<=...<=+<=*next*(*r*<=-<=1)<=+<=*next*(*r*).
Please do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specificator.
Demo Input:
['2 7\n', '7 7\n']
Demo Output:
['33\n', '7\n']
Note:
In the first sample: *next*(2) + *next*(3) + *next*(4) + *next*(5) + *next*(6) + *next*(7) = 4 + 4 + 4 + 7 + 7 + 7 = 33
In the second sample: *next*(7) = 7
|
```python
# your code goes here
arr = input().split()
l = int(arr[0])
r = int(arr[1])
num = '4'
lucky = []
while 1:
lucky.append(int(num))
if int(num) > r:
break
n = len(num)
flag = 0
arr = list(num)
for i in range(n):
if arr[n-i-1] == '4':
flag = 1
i = n-i-1
break
if flag == 1:
arr[i] = '7'
else:
arr.insert(0, '4')
i = 0
n += 1
i += 1
while i < n:
arr[i] = '4'
i += 1
num = ''.join(arr)
# print(num)
n = len(lucky)
prev = l
ans = 0
for i in range(n):
next = lucky[i]
if next < prev:
continue
if r < next:
next = r
ans += (next - prev + 1)*lucky[i]
prev = next+1
if prev > r:
break
print(ans)
```
| 3
|
|
441
|
A
|
Valera and Antique Items
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
|
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
|
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
|
[
"3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n",
"3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n"
] |
[
"3\n1 2 3\n",
"0\n\n"
] |
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
| 500
|
[
{
"input": "3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000",
"output": "3\n1 2 3"
},
{
"input": "3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000",
"output": "0"
},
{
"input": "2 100001\n1 895737\n1 541571",
"output": "0"
},
{
"input": "1 1000000\n1 1000000",
"output": "0"
},
{
"input": "1 1000000\n1 561774",
"output": "1\n1"
},
{
"input": "3 1000000\n5 1000000 568832 1000000 1000000 1000000\n13 1000000 1000000 1000000 596527 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000\n20 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000",
"output": "2\n1 2"
},
{
"input": "3 999999\n7 1000000 1000000 1000000 999999 1000000 999999 1000000\n6 999999 1000000 999999 1000000 999999 999999\n7 999999 1000000 1000000 999999 1000000 1000000 1000000",
"output": "0"
},
{
"input": "3 999999\n22 1000000 1000000 999999 999999 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 999999 1000000 1000000 999999 1000000 1000000 1000000 352800 999999 1000000\n14 999999 999999 999999 999999 999999 1000000 999999 999999 999999 999999 702638 999999 1000000 999999\n5 999999 1000000 1000000 999999 363236",
"output": "3\n1 2 3"
},
{
"input": "1 50001\n1 50000",
"output": "1\n1"
}
] | 1,610,853,050
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 77
| 1,331,200
|
import math as m
#from math import comb as nCr
t=input
'''
for _ in range(int(t())):
n=int(t())
a,b=map(int,t().split())
a=list(map(int,t().split()))
'''
ans=[]
n,v=map(int,t().split())
for _ in range(n):
a=list(map(int,t().split()))
cnt=sum(i < v for i in a[1:])
if cnt>0: ans.append(str(a[0]))
ans.sort()
print(len(ans))
print(' '.join(ans))
|
Title: Valera and Antique Items
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
Input Specification:
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
Output Specification:
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
Demo Input:
['3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n', '3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n']
Demo Output:
['3\n1 2 3\n', '0\n\n']
Note:
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
|
```python
import math as m
#from math import comb as nCr
t=input
'''
for _ in range(int(t())):
n=int(t())
a,b=map(int,t().split())
a=list(map(int,t().split()))
'''
ans=[]
n,v=map(int,t().split())
for _ in range(n):
a=list(map(int,t().split()))
cnt=sum(i < v for i in a[1:])
if cnt>0: ans.append(str(a[0]))
ans.sort()
print(len(ans))
print(' '.join(ans))
```
| 0
|
|
136
|
A
|
Presents
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
|
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
|
[
"4\n2 3 4 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] |
[
"4 1 2 3\n",
"1 3 2\n",
"1 2\n"
] |
none
| 500
|
[
{
"input": "4\n2 3 4 1",
"output": "4 1 2 3"
},
{
"input": "3\n1 3 2",
"output": "1 3 2"
},
{
"input": "2\n1 2",
"output": "1 2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 3 2 6 4 5 7 9 8 10",
"output": "1 3 2 5 6 4 7 9 8 10"
},
{
"input": "5\n5 4 3 2 1",
"output": "5 4 3 2 1"
},
{
"input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19"
},
{
"input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19",
"output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19"
},
{
"input": "10\n3 4 5 6 7 8 9 10 1 2",
"output": "9 10 1 2 3 4 5 6 7 8"
},
{
"input": "8\n1 5 3 7 2 6 4 8",
"output": "1 5 3 7 2 6 4 8"
},
{
"input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47",
"output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19"
},
{
"input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17",
"output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25"
},
{
"input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85",
"output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30"
},
{
"input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49",
"output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49"
},
{
"input": "12\n3 8 7 4 6 5 2 1 11 9 10 12",
"output": "8 7 1 4 6 5 3 2 10 11 9 12"
},
{
"input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76",
"output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4"
},
{
"input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43",
"output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1"
},
{
"input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27",
"output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3"
},
{
"input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22",
"output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53"
},
{
"input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13",
"output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24"
},
{
"input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21",
"output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61"
},
{
"input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33",
"output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14"
},
{
"input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23",
"output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21"
},
{
"input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12",
"output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9"
},
{
"input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31",
"output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13"
},
{
"input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3",
"output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16"
},
{
"input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8",
"output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6"
},
{
"input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71",
"output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90"
},
{
"input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9",
"output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9"
},
{
"input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44",
"output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20"
},
{
"input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17",
"output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28"
},
{
"input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7",
"output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5"
},
{
"input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16",
"output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43"
},
{
"input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65",
"output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43"
},
{
"input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16",
"output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45"
},
{
"input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51",
"output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64"
},
{
"input": "12\n12 3 1 5 11 6 7 10 2 8 9 4",
"output": "3 9 2 12 4 6 7 10 11 8 5 1"
},
{
"input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17",
"output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44"
},
{
"input": "8\n1 3 5 2 4 8 6 7",
"output": "1 4 2 5 3 7 8 6"
},
{
"input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14",
"output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12"
},
{
"input": "10\n2 9 4 6 10 1 7 5 3 8",
"output": "6 1 9 3 8 4 7 10 2 5"
},
{
"input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3",
"output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7"
},
{
"input": "10\n2 4 9 3 6 8 10 5 1 7",
"output": "9 1 4 2 8 5 10 6 3 7"
},
{
"input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15",
"output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23"
},
{
"input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1",
"output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27"
},
{
"input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30",
"output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23"
},
{
"input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52",
"output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50"
},
{
"input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18",
"output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98"
},
{
"input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16",
"output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25"
},
{
"input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37",
"output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54"
},
{
"input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71",
"output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71"
},
{
"input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22",
"output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8"
},
{
"input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12",
"output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51"
},
{
"input": "7\n2 1 5 7 3 4 6",
"output": "2 1 5 6 3 7 4"
},
{
"input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35",
"output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31"
},
{
"input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16",
"output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21"
},
{
"input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52",
"output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11"
},
{
"input": "9\n8 5 2 6 1 9 4 7 3",
"output": "5 3 9 7 2 4 8 1 6"
},
{
"input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27",
"output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13"
},
{
"input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34",
"output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6"
},
{
"input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29",
"output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14"
},
{
"input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7",
"output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16"
},
{
"input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34",
"output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24"
},
{
"input": "9\n4 8 6 5 3 9 2 7 1",
"output": "9 7 5 1 4 3 8 2 6"
},
{
"input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29",
"output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32"
},
{
"input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47",
"output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11"
},
{
"input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6",
"output": "10 4 1 8 6 13 12 5 3 11 9 2 7"
},
{
"input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29",
"output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37"
},
{
"input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3",
"output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25"
},
{
"input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20",
"output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24"
},
{
"input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42",
"output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59"
},
{
"input": "6\n4 3 6 5 1 2",
"output": "5 6 2 1 4 3"
},
{
"input": "9\n7 8 5 3 1 4 2 9 6",
"output": "5 7 4 6 3 9 1 2 8"
},
{
"input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37",
"output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11",
"output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13"
},
{
"input": "2\n2 1",
"output": "2 1"
},
{
"input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28",
"output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18"
},
{
"input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13",
"output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1"
},
{
"input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14",
"output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36"
},
{
"input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29",
"output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32"
},
{
"input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5",
"output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40"
},
{
"input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54",
"output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21"
},
{
"input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29",
"output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4"
},
{
"input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23",
"output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50"
},
{
"input": "10\n2 10 7 4 1 5 8 6 3 9",
"output": "5 1 9 4 6 8 3 7 10 2"
},
{
"input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13",
"output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1"
},
{
"input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2",
"output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11"
},
{
"input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53",
"output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37"
},
{
"input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53",
"output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53"
},
{
"input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64",
"output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49"
},
{
"input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86",
"output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38"
},
{
"input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75",
"output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2"
},
{
"input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53",
"output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5"
},
{
"input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39",
"output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12"
},
{
"input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87",
"output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82"
},
{
"input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25",
"output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97"
},
{
"input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61",
"output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96"
},
{
"input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92",
"output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96"
},
{
"input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6",
"output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1"
}
] | 1,682,356,116
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 60
| 0
|
n=input()
co=0
if i=='H' or i=='Q' or i=='9' :
print("YES")
else:
print("NO")
|
Title: Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Output Specification:
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
Demo Input:
['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['4 1 2 3\n', '1 3 2\n', '1 2\n']
Note:
none
|
```python
n=input()
co=0
if i=='H' or i=='Q' or i=='9' :
print("YES")
else:
print("NO")
```
| -1
|
|
265
|
A
|
Colorful Stones (Simplified Edition)
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
|
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
|
Print the final 1-based position of Liss in a single line.
|
[
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] |
[
"2\n",
"3\n",
"15\n"
] |
none
| 500
|
[
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,612,089,878
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 19
| 186
| 0
|
s = input()
t = input()
i = 0
for x in t:
if s[i] == x:
i += 1
print(i+1)
|
Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none
|
```python
s = input()
t = input()
i = 0
for x in t:
if s[i] == x:
i += 1
print(i+1)
```
| 3
|
|
279
|
B
|
Books
|
PROGRAMMING
| 1,400
|
[
"binary search",
"brute force",
"implementation",
"two pointers"
] | null | null |
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
|
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
|
Print a single integer — the maximum number of books Valera can read.
|
[
"4 5\n3 1 2 1\n",
"3 3\n2 2 3\n"
] |
[
"3\n",
"1\n"
] |
none
| 1,000
|
[
{
"input": "4 5\n3 1 2 1",
"output": "3"
},
{
"input": "3 3\n2 2 3",
"output": "1"
},
{
"input": "1 3\n5",
"output": "0"
},
{
"input": "1 10\n4",
"output": "1"
},
{
"input": "2 10\n6 4",
"output": "2"
},
{
"input": "6 10\n2 3 4 2 1 1",
"output": "4"
},
{
"input": "7 13\n6 8 14 9 4 11 10",
"output": "2"
},
{
"input": "10 15\n10 9 1 1 5 10 5 3 7 2",
"output": "3"
},
{
"input": "20 30\n8 1 2 6 9 4 1 9 9 10 4 7 8 9 5 7 1 8 7 4",
"output": "6"
},
{
"input": "30 60\n16 13 22 38 13 35 17 17 20 38 12 19 9 22 20 3 35 34 34 21 35 40 22 3 27 19 12 4 8 19",
"output": "4"
},
{
"input": "100 100\n75 92 18 6 81 67 7 92 100 65 82 32 50 67 85 31 80 91 84 63 39 52 92 81 1 98 24 12 43 48 17 86 51 72 48 95 45 50 12 66 19 79 49 89 34 1 97 75 20 33 96 27 42 23 73 71 93 1 85 19 66 14 17 61 20 39 36 33 42 61 56 64 23 91 80 99 40 74 13 18 98 85 74 39 62 84 46 74 50 23 38 11 79 14 9 25 66 100 25 52",
"output": "3"
},
{
"input": "10 1\n4418 7528 8170 1736 1317 3205 8183 4995 8039 4708",
"output": "0"
},
{
"input": "50 2\n124 214 63 73 996 760 38 571 451 300 970 1 706 937 837 494 619 88 851 411 957 990 842 613 821 649 627 34 693 678 734 116 816 985 705 940 499 493 922 967 854 439 112 644 961 438 189 572 655 550",
"output": "1"
}
] | 1,670,848,024
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 38
| 186
| 13,312,000
|
n,t=map(int,input().split())
l=list(map(int,input().split()))
sm=0
a=0
j=0
for i in range(n):
while j<n and sm+l[j]<=t:
sm+=l[j]
j+=1
a=max(a,j-i)
sm-=l[i]
print(a)
|
Title: Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
Input Specification:
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
Output Specification:
Print a single integer — the maximum number of books Valera can read.
Demo Input:
['4 5\n3 1 2 1\n', '3 3\n2 2 3\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
n,t=map(int,input().split())
l=list(map(int,input().split()))
sm=0
a=0
j=0
for i in range(n):
while j<n and sm+l[j]<=t:
sm+=l[j]
j+=1
a=max(a,j-i)
sm-=l[i]
print(a)
```
| 3
|
|
577
|
A
|
Multiplication Table
|
PROGRAMMING
| 1,000
|
[
"implementation",
"number theory"
] | null | null |
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1.
You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
|
The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table.
|
Print a single number: the number of times *x* occurs in the table.
|
[
"10 5\n",
"6 12\n",
"5 13\n"
] |
[
"2\n",
"4\n",
"0\n"
] |
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
| 500
|
[
{
"input": "10 5",
"output": "2"
},
{
"input": "6 12",
"output": "4"
},
{
"input": "5 13",
"output": "0"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "1 1000000000",
"output": "0"
},
{
"input": "100000 1000000000",
"output": "16"
},
{
"input": "100000 362880",
"output": "154"
},
{
"input": "1 4",
"output": "0"
},
{
"input": "9 12",
"output": "4"
},
{
"input": "10 123",
"output": "0"
},
{
"input": "9551 975275379",
"output": "0"
},
{
"input": "17286 948615687",
"output": "0"
},
{
"input": "58942 936593001",
"output": "0"
},
{
"input": "50000 989460910",
"output": "4"
},
{
"input": "22741 989460910",
"output": "0"
},
{
"input": "22740 989460910",
"output": "0"
},
{
"input": "100000 989460910",
"output": "4"
},
{
"input": "100000 98280",
"output": "128"
},
{
"input": "100000 997920",
"output": "222"
},
{
"input": "100000 720720",
"output": "226"
},
{
"input": "100000 2162160",
"output": "282"
},
{
"input": "100000 4324320",
"output": "320"
},
{
"input": "100000 8648640",
"output": "348"
},
{
"input": "100000 183783600",
"output": "438"
},
{
"input": "100000 551350800",
"output": "392"
},
{
"input": "40000 551350800",
"output": "150"
},
{
"input": "20000 400000000",
"output": "1"
},
{
"input": "19999 400000000",
"output": "0"
},
{
"input": "19999 399960001",
"output": "1"
},
{
"input": "31621 999887641",
"output": "1"
},
{
"input": "31622 999887641",
"output": "1"
},
{
"input": "31620 999887641",
"output": "0"
},
{
"input": "100000 999887641",
"output": "3"
},
{
"input": "100000 25",
"output": "3"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "100000 3628800",
"output": "220"
},
{
"input": "100000 39916800",
"output": "328"
},
{
"input": "100000 479001600",
"output": "254"
},
{
"input": "4 9",
"output": "1"
},
{
"input": "2 6",
"output": "0"
},
{
"input": "20 100",
"output": "3"
},
{
"input": "10 3",
"output": "2"
},
{
"input": "4 4",
"output": "3"
},
{
"input": "2 4",
"output": "1"
},
{
"input": "89874 1",
"output": "1"
}
] | 1,652,541,529
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n, x = map(int, input().split())
c = 0
for i in range(int(x**0.5), 0, -1):
if x % i == 0:
if x / i <= n:
c += 1
else:
break
if x == 1 and x == n ** 2:
print(1)
elif int(x ** 0.5) != x ** 0.5:
print(c*2 - 1)
else:
print(c * 2)
|
Title: Multiplication Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1.
You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
Input Specification:
The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table.
Output Specification:
Print a single number: the number of times *x* occurs in the table.
Demo Input:
['10 5\n', '6 12\n', '5 13\n']
Demo Output:
['2\n', '4\n', '0\n']
Note:
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
|
```python
n, x = map(int, input().split())
c = 0
for i in range(int(x**0.5), 0, -1):
if x % i == 0:
if x / i <= n:
c += 1
else:
break
if x == 1 and x == n ** 2:
print(1)
elif int(x ** 0.5) != x ** 0.5:
print(c*2 - 1)
else:
print(c * 2)
```
| 0
|
|
670
|
D2
|
Magic Powder - 2
|
PROGRAMMING
| 1,500
|
[
"binary search",
"implementation"
] | null | null |
The term of this problem is the same as the previous one, the only exception — increased restrictions.
|
The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*k*<=≤<=109) — the number of ingredients and the number of grams of the magic powder.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, needed to bake one cookie.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=109), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, which Apollinaria has.
|
Print the maximum number of cookies, which Apollinaria will be able to bake using the ingredients that she has and the magic powder.
|
[
"1 1000000000\n1\n1000000000\n",
"10 1\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1 1 1 1 1 1 1 1 1 1\n",
"3 1\n2 1 4\n11 3 16\n",
"4 3\n4 3 5 6\n11 12 14 20\n"
] |
[
"2000000000\n",
"0\n",
"4\n",
"3\n"
] |
none
| 500
|
[
{
"input": "1 1000000000\n1\n1000000000",
"output": "2000000000"
},
{
"input": "10 1\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1 1 1 1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "3 1\n2 1 4\n11 3 16",
"output": "4"
},
{
"input": "4 3\n4 3 5 6\n11 12 14 20",
"output": "3"
},
{
"input": "10 926\n5 6 8 1 2 5 1 8 4 4\n351 739 998 725 953 970 906 691 707 1000",
"output": "137"
},
{
"input": "20 925\n7 3 1 2 1 3 1 3 1 2 3 1 5 8 1 3 7 3 4 2\n837 898 965 807 786 670 626 873 968 745 878 359 760 781 829 882 777 740 907 779",
"output": "150"
},
{
"input": "30 300\n1 4 2 1 2 5 6 4 1 3 2 1 1 1 1 1 2 3 1 3 4 2 2 3 2 2 2 1 1 1\n997 817 767 860 835 809 817 565 630 804 586 953 977 356 905 890 958 916 740 583 902 945 313 956 871 729 976 707 516 788",
"output": "164"
},
{
"input": "40 538\n1 3 3 1 4 1 1 1 1 5 3 3 4 1 4 2 7 1 4 1 1 2 2 1 1 1 1 4 1 4 2 3 3 3 1 3 4 1 3 5\n975 635 795 835 982 965 639 787 688 796 988 779 839 942 491 696 396 995 718 810 796 879 957 783 844 765 968 783 647 214 995 868 318 453 989 889 504 962 945 925",
"output": "104"
},
{
"input": "1 1\n1000000000\n1000000000",
"output": "1"
},
{
"input": "50 530\n2 3 3 1 1 1 3 4 4 2 4 2 5 1 3 1 2 6 1 1 2 5 3 2 1 5 1 3 3 2 1 1 1 1 2 1 1 2 2 1 4 2 1 3 1 2 1 1 4 2\n959 972 201 990 675 679 972 268 976 886 488 924 795 959 647 994 969 862 898 646 763 797 978 763 995 641 923 856 829 921 934 883 904 986 728 980 1000 775 716 745 833 832 999 651 571 626 827 456 636 795",
"output": "133"
},
{
"input": "60 735\n3 1 4 7 1 7 3 1 1 5 4 7 3 3 3 2 5 3 1 2 3 6 1 1 1 1 1 2 5 3 2 1 3 5 2 1 2 2 2 2 1 3 3 3 6 4 3 5 1 3 2 2 1 3 1 1 1 7 1 2\n596 968 975 493 665 571 598 834 948 941 737 649 923 848 950 907 929 865 227 836 956 796 861 801 746 667 539 807 405 355 501 879 994 890 573 848 597 873 130 985 924 426 999 550 586 924 601 807 994 878 410 817 922 898 982 525 611 685 806 847",
"output": "103"
},
{
"input": "70 130\n2 1 2 2 3 3 2 5 2 2 3 3 3 1 1 4 3 5 3 2 1 3 7 1 2 7 5 2 1 6 3 4 1 2 1 1 1 1 3 6 4 2 2 8 2 2 4 1 4 2 1 4 4 3 5 1 1 1 1 1 2 3 1 5 1 3 3 4 2 2\n473 311 758 768 797 572 656 898 991 534 989 702 934 767 777 799 1000 655 806 727 718 948 834 965 832 778 706 861 799 874 745 970 772 967 984 886 835 795 832 837 950 952 475 891 947 952 903 929 689 478 725 945 585 943 771 631 729 887 557 738 824 758 999 786 669 992 918 762 964 941",
"output": "119"
},
{
"input": "80 979\n2 1 1 1 2 1 1 1 3 1 4 4 2 1 1 3 1 1 2 1 4 1 1 2 5 4 8 1 3 6 5 7 2 3 4 1 2 2 6 1 2 2 4 1 1 2 3 2 8 1 1 3 3 4 1 1 2 1 4 4 1 4 3 2 6 5 2 1 4 1 2 3 2 1 3 3 1 2 1 3\n498 976 513 869 917 914 664 656 957 893 981 947 985 693 576 958 987 822 981 718 884 729 295 683 485 998 730 894 731 975 739 854 906 740 987 976 606 689 990 775 522 994 920 893 529 651 989 799 643 215 946 987 297 868 425 810 694 908 736 903 970 751 625 904 955 945 839 777 977 974 905 900 666 680 799 873 565 919 536 686",
"output": "128"
},
{
"input": "1 1000\n1000\n1000",
"output": "2"
},
{
"input": "1 1000\n1\n1000",
"output": "2000"
},
{
"input": "1 1\n4\n6",
"output": "1"
},
{
"input": "1 1\n1\n1",
"output": "2"
},
{
"input": "1 1\n1000000000\n1",
"output": "0"
},
{
"input": "1 1000000000\n1000000000\n1000000000",
"output": "2"
},
{
"input": "1 1000000000\n100000000\n1000000000",
"output": "20"
},
{
"input": "1 1000000000\n654321\n1000000000",
"output": "3056"
},
{
"input": "1 786543211\n12345678\n987654321",
"output": "143"
},
{
"input": "20 1000000000\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "13 961166382\n312 781 329 6 813 68 872 146 33 382 134 744 353\n904116983 692808881 382512127 462746212 130261069 450407093 112139570 386577765 867425952 354457553 248439687 817592835 682387533",
"output": "714283"
},
{
"input": "1 1000000000\n1\n2",
"output": "1000000002"
},
{
"input": "6 1000000000\n1 1 1 1 1 1\n1000000000 1 1000000000 1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "2 1000000000\n1 1\n1 1",
"output": "500000001"
},
{
"input": "1 1\n10\n2",
"output": "0"
},
{
"input": "2 1\n2 2\n1 1",
"output": "0"
},
{
"input": "2 1000000000\n1 1\n1000000000 1000000000",
"output": "1500000000"
},
{
"input": "2 6\n1 3\n6 2",
"output": "2"
}
] | 1,678,051,381
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 150
| 873
| 11,673,600
|
def f(x):
L=k
for i in range(n):
if(B[i]//A[i]<x):
L=L-(A[i]*x-B[i])
if(L<0):
return True
return False
p=input()
p=p.split()
n=int(p[0])
k=int(p[1])
A=[int(i) for i in input().split()]
B=[int(i) for i in input().split()]
left=0
right=2*(10**9)+1
while(left<right-1):
mid=(left+right)//2
if(f(mid)):
right=mid
else:
left=mid
print(left)
|
Title: Magic Powder - 2
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The term of this problem is the same as the previous one, the only exception — increased restrictions.
Input Specification:
The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000,<=1<=≤<=*k*<=≤<=109) — the number of ingredients and the number of grams of the magic powder.
The second line contains the sequence *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, needed to bake one cookie.
The third line contains the sequence *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=109), where the *i*-th number is equal to the number of grams of the *i*-th ingredient, which Apollinaria has.
Output Specification:
Print the maximum number of cookies, which Apollinaria will be able to bake using the ingredients that she has and the magic powder.
Demo Input:
['1 1000000000\n1\n1000000000\n', '10 1\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000\n1 1 1 1 1 1 1 1 1 1\n', '3 1\n2 1 4\n11 3 16\n', '4 3\n4 3 5 6\n11 12 14 20\n']
Demo Output:
['2000000000\n', '0\n', '4\n', '3\n']
Note:
none
|
```python
def f(x):
L=k
for i in range(n):
if(B[i]//A[i]<x):
L=L-(A[i]*x-B[i])
if(L<0):
return True
return False
p=input()
p=p.split()
n=int(p[0])
k=int(p[1])
A=[int(i) for i in input().split()]
B=[int(i) for i in input().split()]
left=0
right=2*(10**9)+1
while(left<right-1):
mid=(left+right)//2
if(f(mid)):
right=mid
else:
left=mid
print(left)
```
| 3
|
|
224
|
A
|
Parallelepiped
|
PROGRAMMING
| 1,100
|
[
"brute force",
"geometry",
"math"
] | null | null |
You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped.
|
The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=><=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement.
|
Print a single number — the sum of all edges of the parallelepiped.
|
[
"1 1 1\n",
"4 6 6\n"
] |
[
"12\n",
"28\n"
] |
In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
| 500
|
[
{
"input": "1 1 1",
"output": "12"
},
{
"input": "4 6 6",
"output": "28"
},
{
"input": "20 10 50",
"output": "68"
},
{
"input": "9 4 36",
"output": "56"
},
{
"input": "324 9 36",
"output": "184"
},
{
"input": "1333 93 129",
"output": "308"
},
{
"input": "1022 584 112",
"output": "380"
},
{
"input": "66 174 319",
"output": "184"
},
{
"input": "912 276 1748",
"output": "444"
},
{
"input": "65 156 60",
"output": "120"
},
{
"input": "1 10000 10000",
"output": "40008"
},
{
"input": "1485 55 27",
"output": "332"
},
{
"input": "152 108 4104",
"output": "528"
},
{
"input": "1656 6900 1350",
"output": "740"
},
{
"input": "12 14 42",
"output": "60"
},
{
"input": "615 18 1230",
"output": "856"
},
{
"input": "680 60 408",
"output": "336"
},
{
"input": "644 966 6",
"output": "1308"
},
{
"input": "1 432 432",
"output": "1736"
},
{
"input": "2239 2239 1",
"output": "8964"
},
{
"input": "4106 8212 2",
"output": "16436"
},
{
"input": "10000 10000 10000",
"output": "1200"
},
{
"input": "3623 3623 1",
"output": "14500"
},
{
"input": "9801 9801 9801",
"output": "1188"
},
{
"input": "10000 1 10000",
"output": "40008"
},
{
"input": "9 9 9",
"output": "36"
},
{
"input": "9801 9702 9702",
"output": "1184"
}
] | 1,608,618,419
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 248
| 0
|
import sys
input = sys.stdin.readline
a,b,c = map(int, input().split())
z = int((b*c/a)**0.5)
x = b//z
y = a//x
print(4*(x+y+z))
|
Title: Parallelepiped
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a rectangular parallelepiped with integer edge lengths. You know the areas of its three faces that have a common vertex. Your task is to find the sum of lengths of all 12 edges of this parallelepiped.
Input Specification:
The first and the single line contains three space-separated integers — the areas of the parallelepiped's faces. The area's values are positive (<=><=0) and do not exceed 104. It is guaranteed that there exists at least one parallelepiped that satisfies the problem statement.
Output Specification:
Print a single number — the sum of all edges of the parallelepiped.
Demo Input:
['1 1 1\n', '4 6 6\n']
Demo Output:
['12\n', '28\n']
Note:
In the first sample the parallelepiped has sizes 1 × 1 × 1, in the second one — 2 × 2 × 3.
|
```python
import sys
input = sys.stdin.readline
a,b,c = map(int, input().split())
z = int((b*c/a)**0.5)
x = b//z
y = a//x
print(4*(x+y+z))
```
| 3
|
|
863
|
B
|
Kayaking
|
PROGRAMMING
| 1,500
|
[
"brute force",
"greedy",
"sortings"
] | null | null |
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
|
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
|
Print minimum possible total instability.
|
[
"2\n1 2 3 4\n",
"4\n1 3 4 6 3 4 100 200\n"
] |
[
"1\n",
"5\n"
] |
none
| 0
|
[
{
"input": "2\n1 2 3 4",
"output": "1"
},
{
"input": "4\n1 3 4 6 3 4 100 200",
"output": "5"
},
{
"input": "3\n305 139 205 406 530 206",
"output": "102"
},
{
"input": "3\n610 750 778 6 361 407",
"output": "74"
},
{
"input": "5\n97 166 126 164 154 98 221 7 51 47",
"output": "35"
},
{
"input": "50\n1 1 2 2 1 3 2 2 1 1 1 1 2 3 3 1 2 1 3 3 2 1 2 3 1 1 2 1 3 1 3 1 3 3 3 1 1 1 3 3 2 2 2 2 3 2 2 2 2 3 1 3 3 3 3 1 3 3 1 3 3 3 3 2 3 1 3 3 1 1 1 3 1 2 2 2 1 1 1 3 1 2 3 2 1 3 3 2 2 1 3 1 3 1 2 2 1 2 3 2",
"output": "0"
},
{
"input": "50\n5 5 5 5 4 2 2 3 2 2 4 1 5 5 1 2 4 2 4 2 5 2 2 2 2 3 2 4 2 5 5 4 3 1 2 3 3 5 4 2 2 5 2 4 5 5 4 4 1 5 5 3 2 2 5 1 3 3 2 4 4 5 1 2 3 4 4 1 3 3 3 5 1 2 4 4 4 4 2 5 2 5 3 2 4 5 5 2 1 1 2 4 5 3 2 1 2 4 4 4",
"output": "1"
},
{
"input": "50\n499 780 837 984 481 526 944 482 862 136 265 605 5 631 974 967 574 293 969 467 573 845 102 224 17 873 648 120 694 996 244 313 404 129 899 583 541 314 525 496 443 857 297 78 575 2 430 137 387 319 382 651 594 411 845 746 18 232 6 289 889 81 174 175 805 1000 799 950 475 713 951 685 729 925 262 447 139 217 788 514 658 572 784 185 112 636 10 251 621 218 210 89 597 553 430 532 264 11 160 476",
"output": "368"
},
{
"input": "50\n873 838 288 87 889 364 720 410 565 651 577 356 740 99 549 592 994 385 777 435 486 118 887 440 749 533 356 790 413 681 267 496 475 317 88 660 374 186 61 437 729 860 880 538 277 301 667 180 60 393 955 540 896 241 362 146 74 680 734 767 851 337 751 860 542 735 444 793 340 259 495 903 743 961 964 966 87 275 22 776 368 701 835 732 810 735 267 988 352 647 924 183 1 924 217 944 322 252 758 597",
"output": "393"
},
{
"input": "50\n297 787 34 268 439 629 600 398 425 833 721 908 830 636 64 509 420 647 499 675 427 599 396 119 798 742 577 355 22 847 389 574 766 453 196 772 808 261 106 844 726 975 173 992 874 89 775 616 678 52 69 591 181 573 258 381 665 301 589 379 362 146 790 842 765 100 229 916 938 97 340 793 758 177 736 396 247 562 571 92 923 861 165 748 345 703 431 930 101 761 862 595 505 393 126 846 431 103 596 21",
"output": "387"
},
{
"input": "50\n721 631 587 746 692 406 583 90 388 16 161 948 921 70 387 426 39 398 517 724 879 377 906 502 359 950 798 408 846 718 911 845 57 886 9 668 537 632 344 762 19 193 658 447 870 173 98 156 592 519 183 539 274 393 962 615 551 626 148 183 769 763 829 120 796 761 14 744 537 231 696 284 581 688 611 826 703 145 224 600 965 613 791 275 984 375 402 281 851 580 992 8 816 454 35 532 347 250 242 637",
"output": "376"
},
{
"input": "50\n849 475 37 120 754 183 758 374 543 198 896 691 11 607 198 343 761 660 239 669 628 259 223 182 216 158 20 565 454 884 137 923 156 22 310 77 267 707 582 169 120 308 439 309 59 152 206 696 210 177 296 887 559 22 154 553 142 247 491 692 473 572 461 206 532 319 503 164 328 365 541 366 300 392 486 257 863 432 877 404 520 69 418 99 519 239 374 927 601 103 226 316 423 219 240 26 455 101 184 61",
"output": "351"
},
{
"input": "3\n1 2 10 11 100 100",
"output": "1"
},
{
"input": "17\n814 744 145 886 751 1000 272 914 270 529 467 164 410 369 123 424 991 12 702 582 561 858 746 950 598 393 606 498 648 686 455 873 728 858",
"output": "318"
},
{
"input": "45\n476 103 187 696 463 457 588 632 763 77 391 721 95 124 378 812 980 193 694 898 859 572 721 274 605 264 929 615 257 918 42 493 1 3 697 349 990 800 82 535 382 816 943 735 11 272 562 323 653 370 766 332 666 130 704 604 645 717 267 255 37 470 925 941 376 611 332 758 504 40 477 263 708 434 38 596 650 990 714 662 572 467 949 799 648 581 545 828 508 636",
"output": "355"
},
{
"input": "2\n55 5 25 51",
"output": "4"
},
{
"input": "25\n89 50 640 463 858 301 522 241 923 378 892 822 550 17 42 66 706 779 657 840 273 222 444 459 94 925 437 159 182 727 92 851 742 215 653 891 782 533 29 128 133 883 317 475 165 994 802 434 744 973",
"output": "348"
},
{
"input": "4\n35 48 71 44 78 79 57 48",
"output": "10"
},
{
"input": "3\n58 89 73 15 5 47",
"output": "21"
},
{
"input": "2\n1 20 99 100",
"output": "1"
}
] | 1,656,180,475
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 20
| 140
| 4,505,600
|
n = int(input()) * 2
kaya = sorted(list(map(int, input().split())))
diff = float('inf')
for a in range(n):
for b in range(a+1, n):
k = [kaya[x] for x in range(n) if x != a and x != b]
s = sum([k[y+1] - k[y] for y in range(0, n - 2, 2)])
diff = min(diff, s)
print(diff)
|
Title: Kayaking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vadim is really keen on travelling. Recently he heard about kayaking activity near his town and became very excited about it, so he joined a party of kayakers.
Now the party is ready to start its journey, but firstly they have to choose kayaks. There are 2·*n* people in the group (including Vadim), and they have exactly *n*<=-<=1 tandem kayaks (each of which, obviously, can carry two people) and 2 single kayaks. *i*-th person's weight is *w**i*, and weight is an important matter in kayaking — if the difference between the weights of two people that sit in the same tandem kayak is too large, then it can crash. And, of course, people want to distribute their seats in kayaks in order to minimize the chances that kayaks will crash.
Formally, the instability of a single kayak is always 0, and the instability of a tandem kayak is the absolute difference between weights of the people that are in this kayak. Instability of the whole journey is the total instability of all kayaks.
Help the party to determine minimum possible total instability!
Input Specification:
The first line contains one number *n* (2<=≤<=*n*<=≤<=50).
The second line contains 2·*n* integer numbers *w*1, *w*2, ..., *w*2*n*, where *w**i* is weight of person *i* (1<=≤<=*w**i*<=≤<=1000).
Output Specification:
Print minimum possible total instability.
Demo Input:
['2\n1 2 3 4\n', '4\n1 3 4 6 3 4 100 200\n']
Demo Output:
['1\n', '5\n']
Note:
none
|
```python
n = int(input()) * 2
kaya = sorted(list(map(int, input().split())))
diff = float('inf')
for a in range(n):
for b in range(a+1, n):
k = [kaya[x] for x in range(n) if x != a and x != b]
s = sum([k[y+1] - k[y] for y in range(0, n - 2, 2)])
diff = min(diff, s)
print(diff)
```
| 3
|
|
595
|
A
|
Vitaly and Night
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
|
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
|
[
"2 2\n0 0 0 1\n1 0 1 1\n",
"1 3\n1 1 0 1 0 0\n"
] |
[
"3\n",
"2\n"
] |
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
| 500
|
[
{
"input": "2 2\n0 0 0 1\n1 0 1 1",
"output": "3"
},
{
"input": "1 3\n1 1 0 1 0 0",
"output": "2"
},
{
"input": "3 3\n1 1 1 1 1 1\n1 1 0 1 1 0\n1 0 0 0 1 1",
"output": "8"
},
{
"input": "1 5\n1 0 1 1 1 0 1 1 1 1",
"output": "5"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 0 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "1 100\n0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "6"
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n0 1\n1 1\n1 1\n1 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "100"
},
{
"input": "100 1\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n1 0",
"output": "8"
},
{
"input": "100 1\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "1 1\n0 0",
"output": "0"
},
{
"input": "1 1\n0 1",
"output": "1"
},
{
"input": "1 1\n1 0",
"output": "1"
},
{
"input": "1 1\n1 1",
"output": "1"
}
] | 1,598,620,499
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 109
| 307,200
|
nm = list(map(int, input().split()))
house = []
for k in range(nm[0]):
house.append(list(map(int, input().split())))
count = 0
for i in range(nm[0]):
for j in range(0, (2 * nm[1]), 2):
if house[i][j] == 1 or house[i][j + 1]:
count += 1
print(count)
|
Title: Vitaly and Night
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vitaly was going home late at night and wondering: how many people aren't sleeping at that moment? To estimate, Vitaly decided to look which windows are lit in the house he was passing by at that moment.
Vitaly sees a building of *n* floors and 2·*m* windows on each floor. On each floor there are *m* flats numbered from 1 to *m*, and two consecutive windows correspond to each flat. If we number the windows from 1 to 2·*m* from left to right, then the *j*-th flat of the *i*-th floor has windows 2·*j*<=-<=1 and 2·*j* in the corresponding row of windows (as usual, floors are enumerated from the bottom). Vitaly thinks that people in the flat aren't sleeping at that moment if at least one of the windows corresponding to this flat has lights on.
Given the information about the windows of the given house, your task is to calculate the number of flats where, according to Vitaly, people aren't sleeping.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of floors in the house and the number of flats on each floor respectively.
Next *n* lines describe the floors from top to bottom and contain 2·*m* characters each. If the *i*-th window of the given floor has lights on, then the *i*-th character of this line is '1', otherwise it is '0'.
Output Specification:
Print a single integer — the number of flats that have lights on in at least one window, that is, the flats where, according to Vitaly, people aren't sleeping.
Demo Input:
['2 2\n0 0 0 1\n1 0 1 1\n', '1 3\n1 1 0 1 0 0\n']
Demo Output:
['3\n', '2\n']
Note:
In the first test case the house has two floors, two flats on each floor. That is, in total there are 4 flats. The light isn't on only on the second floor in the left flat. That is, in both rooms of the flat the light is off.
In the second test case the house has one floor and the first floor has three flats. The light is on in the leftmost flat (in both windows) and in the middle flat (in one window). In the right flat the light is off.
|
```python
nm = list(map(int, input().split()))
house = []
for k in range(nm[0]):
house.append(list(map(int, input().split())))
count = 0
for i in range(nm[0]):
for j in range(0, (2 * nm[1]), 2):
if house[i][j] == 1 or house[i][j + 1]:
count += 1
print(count)
```
| 3
|
|
514
|
C
|
Watto and Mechanism
|
PROGRAMMING
| 2,000
|
[
"binary search",
"data structures",
"hashing",
"string suffix structures",
"strings"
] | null | null |
Watto, the owner of a spare parts store, has recently got an order for the mechanism that can process strings in a certain way. Initially the memory of the mechanism is filled with *n* strings. Then the mechanism should be able to process queries of the following type: "Given string *s*, determine if the memory of the mechanism contains string *t* that consists of the same number of characters as *s* and differs from *s* in exactly one position".
Watto has already compiled the mechanism, all that's left is to write a program for it and check it on the data consisting of *n* initial lines and *m* queries. He decided to entrust this job to you.
|
The first line contains two non-negative numbers *n* and *m* (0<=≤<=*n*<=≤<=3·105, 0<=≤<=*m*<=≤<=3·105) — the number of the initial strings and the number of queries, respectively.
Next follow *n* non-empty strings that are uploaded to the memory of the mechanism.
Next follow *m* non-empty strings that are the queries to the mechanism.
The total length of lines in the input doesn't exceed 6·105. Each line consists only of letters 'a', 'b', 'c'.
|
For each query print on a single line "YES" (without the quotes), if the memory of the mechanism contains the required string, otherwise print "NO" (without the quotes).
|
[
"2 3\naaaaa\nacacaca\naabaa\nccacacc\ncaaac\n"
] |
[
"YES\nNO\nNO\n"
] |
none
| 2,000
|
[
{
"input": "2 3\naaaaa\nacacaca\naabaa\nccacacc\ncaaac",
"output": "YES\nNO\nNO"
},
{
"input": "1 5\nacbacbacb\ncbacbacb\nacbacbac\naacbacbacb\nacbacbacbb\nacbaabacb",
"output": "NO\nNO\nNO\nNO\nYES"
},
{
"input": "5 4\nab\ncacab\ncbabc\nacc\ncacab\nabc\naa\nacbca\ncb",
"output": "YES\nYES\nNO\nYES"
},
{
"input": "9 9\ncaccbcacabccba\naacbcbcaabacbcbcba\nbabccaaacccacbb\ncaaabcaacbababbabbb\nabbaccacabacaaaa\nbccbccababcaacb\ncaacbcaacbababbabbb\nbcacababbbcaaca\nccbbcbababbccaab\nbbcbccababcaacb\naacccbabbacbabacaca\nbbcbcccbabcaacb\nacbacacbcacc\ncaaabcaaabacabbabbb\nabbbabaaaba\naacccbcaabacbcbcba\nabbaccacabbcaaaa\naaccbbcabbacbcbcba",
"output": "YES\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO"
},
{
"input": "1 1\nbbbbbbbaaaabbbbbaabbbba\naaabbbabbbbbbbaabbabbbb",
"output": "NO"
}
] | 1,688,960,678
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 5
| 358
| 18,944,000
|
import sys
input=sys.stdin.readline
from hashlib import md5
def hash1(s):
h = md5()
h.update(s.encode())
hash = h.hexdigest()
return hash
n,m=map(int,input().split())
s=set()
for i in range(n):
x=input()
for i in range(len(x)-1):
s.add(hash1((x[:i]+x[i+1:])))
for i in range(m):
x=input()
for i in range(len(x)-1):
if hash1((x[:i]+x[i+1:])) in s:
print("YES")
break
else:
print("NO")
|
Title: Watto and Mechanism
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Watto, the owner of a spare parts store, has recently got an order for the mechanism that can process strings in a certain way. Initially the memory of the mechanism is filled with *n* strings. Then the mechanism should be able to process queries of the following type: "Given string *s*, determine if the memory of the mechanism contains string *t* that consists of the same number of characters as *s* and differs from *s* in exactly one position".
Watto has already compiled the mechanism, all that's left is to write a program for it and check it on the data consisting of *n* initial lines and *m* queries. He decided to entrust this job to you.
Input Specification:
The first line contains two non-negative numbers *n* and *m* (0<=≤<=*n*<=≤<=3·105, 0<=≤<=*m*<=≤<=3·105) — the number of the initial strings and the number of queries, respectively.
Next follow *n* non-empty strings that are uploaded to the memory of the mechanism.
Next follow *m* non-empty strings that are the queries to the mechanism.
The total length of lines in the input doesn't exceed 6·105. Each line consists only of letters 'a', 'b', 'c'.
Output Specification:
For each query print on a single line "YES" (without the quotes), if the memory of the mechanism contains the required string, otherwise print "NO" (without the quotes).
Demo Input:
['2 3\naaaaa\nacacaca\naabaa\nccacacc\ncaaac\n']
Demo Output:
['YES\nNO\nNO\n']
Note:
none
|
```python
import sys
input=sys.stdin.readline
from hashlib import md5
def hash1(s):
h = md5()
h.update(s.encode())
hash = h.hexdigest()
return hash
n,m=map(int,input().split())
s=set()
for i in range(n):
x=input()
for i in range(len(x)-1):
s.add(hash1((x[:i]+x[i+1:])))
for i in range(m):
x=input()
for i in range(len(x)-1):
if hash1((x[:i]+x[i+1:])) in s:
print("YES")
break
else:
print("NO")
```
| 0
|
|
393
|
A
|
Nineteen
|
PROGRAMMING
| 0
|
[] | null | null |
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
|
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
|
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
|
[
"nniinneetteeeenn\n",
"nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n",
"nineteenineteen\n"
] |
[
"2",
"2",
"2"
] |
none
| 500
|
[
{
"input": "nniinneetteeeenn",
"output": "2"
},
{
"input": "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii",
"output": "2"
},
{
"input": "nineteenineteen",
"output": "2"
},
{
"input": "nssemsnnsitjtihtthij",
"output": "0"
},
{
"input": "eehihnttehtherjsihihnrhimihrjinjiehmtjimnrss",
"output": "1"
},
{
"input": "rrrteiehtesisntnjirtitijnjjjthrsmhtneirjimniemmnrhirssjnhetmnmjejjnjjritjttnnrhnjs",
"output": "2"
},
{
"input": "mmrehtretseihsrjmtsenemniehssnisijmsnntesismmtmthnsieijjjnsnhisi",
"output": "2"
},
{
"input": "hshretttnntmmiertrrnjihnrmshnthirnnirrheinnnrjiirshthsrsijtrrtrmnjrrjnresnintnmtrhsnjrinsseimn",
"output": "1"
},
{
"input": "snmmensntritetnmmmerhhrmhnehehtesmhthseemjhmnrti",
"output": "2"
},
{
"input": "rmeetriiitijmrenmeiijt",
"output": "0"
},
{
"input": "ihimeitimrmhriemsjhrtjtijtesmhemnmmrsetmjttthtjhnnmirtimne",
"output": "1"
},
{
"input": "rhtsnmnesieernhstjnmmirthhieejsjttsiierhihhrrijhrrnejsjer",
"output": "2"
},
{
"input": "emmtjsjhretehmiiiestmtmnmissjrstnsnjmhimjmststsitemtttjrnhsrmsenjtjim",
"output": "2"
},
{
"input": "nmehhjrhirniitshjtrrtitsjsntjhrstjehhhrrerhemehjeermhmhjejjesnhsiirheijjrnrjmminneeehtm",
"output": "3"
},
{
"input": "hsntijjetmehejtsitnthietssmeenjrhhetsnjrsethisjrtrhrierjtmimeenjnhnijeesjttrmn",
"output": "3"
},
{
"input": "jnirirhmirmhisemittnnsmsttesjhmjnsjsmntisheneiinsrjsjirnrmnjmjhmistntersimrjni",
"output": "1"
},
{
"input": "neithjhhhtmejjnmieishethmtetthrienrhjmjenrmtejerernmthmsnrthhtrimmtmshm",
"output": "2"
},
{
"input": "sithnrsnemhijsnjitmijjhejjrinejhjinhtisttteermrjjrtsirmessejireihjnnhhemiirmhhjeet",
"output": "3"
},
{
"input": "jrjshtjstteh",
"output": "0"
},
{
"input": "jsihrimrjnnmhttmrtrenetimemjnshnimeiitmnmjishjjneisesrjemeshjsijithtn",
"output": "2"
},
{
"input": "hhtjnnmsemermhhtsstejehsssmnesereehnnsnnremjmmieethmirjjhn",
"output": "2"
},
{
"input": "tmnersmrtsehhntsietttrehrhneiireijnijjejmjhei",
"output": "1"
},
{
"input": "mtstiresrtmesritnjriirehtermtrtseirtjrhsejhhmnsineinsjsin",
"output": "2"
},
{
"input": "ssitrhtmmhtnmtreijteinimjemsiiirhrttinsnneshintjnin",
"output": "1"
},
{
"input": "rnsrsmretjiitrjthhritniijhjmm",
"output": "0"
},
{
"input": "hntrteieimrimteemenserntrejhhmijmtjjhnsrsrmrnsjseihnjmehtthnnithirnhj",
"output": "3"
},
{
"input": "nmmtsmjrntrhhtmimeresnrinstjnhiinjtnjjjnthsintmtrhijnrnmtjihtinmni",
"output": "0"
},
{
"input": "eihstiirnmteejeehimttrijittjsntjejmessstsemmtristjrhenithrrsssihnthheehhrnmimssjmejjreimjiemrmiis",
"output": "2"
},
{
"input": "srthnimimnemtnmhsjmmmjmmrsrisehjseinemienntetmitjtnnneseimhnrmiinsismhinjjnreehseh",
"output": "3"
},
{
"input": "etrsmrjehntjjimjnmsresjnrthjhehhtreiijjminnheeiinseenmmethiemmistsei",
"output": "3"
},
{
"input": "msjeshtthsieshejsjhsnhejsihisijsertenrshhrthjhiirijjneinjrtrmrs",
"output": "1"
},
{
"input": "mehsmstmeejrhhsjihntjmrjrihssmtnensttmirtieehimj",
"output": "1"
},
{
"input": "mmmsermimjmrhrhejhrrejermsneheihhjemnehrhihesnjsehthjsmmjeiejmmnhinsemjrntrhrhsmjtttsrhjjmejj",
"output": "2"
},
{
"input": "rhsmrmesijmmsnsmmhertnrhsetmisshriirhetmjihsmiinimtrnitrseii",
"output": "1"
},
{
"input": "iihienhirmnihh",
"output": "0"
},
{
"input": "ismtthhshjmhisssnmnhe",
"output": "0"
},
{
"input": "rhsmnrmhejshinnjrtmtsssijimimethnm",
"output": "0"
},
{
"input": "eehnshtiriejhiirntminrirnjihmrnittnmmnjejjhjtennremrnssnejtntrtsiejjijisermj",
"output": "3"
},
{
"input": "rnhmeesnhttrjintnhnrhristjrthhrmehrhjmjhjehmstrijemjmmistes",
"output": "2"
},
{
"input": "ssrmjmjeeetrnimemrhimes",
"output": "0"
},
{
"input": "n",
"output": "0"
},
{
"input": "ni",
"output": "0"
},
{
"input": "nine",
"output": "0"
},
{
"input": "nineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteen",
"output": "13"
},
{
"input": "ninetee",
"output": "0"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwynd",
"output": "0"
},
{
"input": "zenudggmyopddhszhrbmftgzmjorabhgojdtfnzxjkayjlkgczsyshczutkdch",
"output": "0"
},
{
"input": "rtzxovxqfapkdmelxiyjroohufhbakpmmvaxq",
"output": "0"
},
{
"input": "zninetneeineteeniwnteeennieteenineteenineteenineteenineteenineteenineteenineteenineteeninetzeenz",
"output": "13"
},
{
"input": "nnnnnnniiiiiiiiiiiitttttttttteeeeeeeeeeeeeeeeee",
"output": "3"
},
{
"input": "ttttiiiieeeeeeeeeeeennnnnnnnn",
"output": "4"
},
{
"input": "ttttttttteeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiinnnnnnn",
"output": "3"
},
{
"input": "nnnnnnnnnneeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiiiiitttttttttttttttttttt",
"output": "4"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiittttttttttttttttnnnnnnn",
"output": "3"
},
{
"input": "nineeen",
"output": "0"
},
{
"input": "nineteeeeeeeeeeeeeeeeettttttttttttttttttiiiiiiiiiiiiiiiiii",
"output": "0"
},
{
"input": "nineteenieteenieteenieteenieteenieteenieteen",
"output": "4"
},
{
"input": "nineteenineteenineteenineteenineteen",
"output": "5"
}
] | 1,586,302,354
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 93
| 0
|
nineteen = str(input())
dict = {}
for i in nineteen:
if i in dict:
dict[i] += 1
else:
dict[i] = 1
#print(dict) #nineteen 2n, 1i, 1t, 3,e
x = min(min(min(dict['n']/2, dict['i']), dict['t']), dict['e']/3)
print(x)
|
Title: Nineteen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
Input Specification:
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
Output Specification:
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
Demo Input:
['nniinneetteeeenn\n', 'nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n', 'nineteenineteen\n']
Demo Output:
['2', '2', '2']
Note:
none
|
```python
nineteen = str(input())
dict = {}
for i in nineteen:
if i in dict:
dict[i] += 1
else:
dict[i] = 1
#print(dict) #nineteen 2n, 1i, 1t, 3,e
x = min(min(min(dict['n']/2, dict['i']), dict['t']), dict['e']/3)
print(x)
```
| 0
|
|
691
|
C
|
Exponential notation
|
PROGRAMMING
| 1,800
|
[
"implementation",
"strings"
] | null | null |
You are given a positive decimal number *x*.
Your task is to convert it to the "simple exponential notation".
Let *x*<==<=*a*·10*b*, where 1<=≤<=*a*<=<<=10, then in general case the "simple exponential notation" looks like "aEb". If *b* equals to zero, the part "Eb" should be skipped. If *a* is an integer, it should be written without decimal point. Also there should not be extra zeroes in *a* and *b*.
|
The only line contains the positive decimal number *x*. The length of the line will not exceed 106. Note that you are given too large number, so you can't use standard built-in data types "float", "double" and other.
|
Print the only line — the "simple exponential notation" of the given number *x*.
|
[
"16\n",
"01.23400\n",
".100\n",
"100.\n"
] |
[
"1.6E1\n",
"1.234\n",
"1E-1\n",
"1E2\n"
] |
none
| 0
|
[
{
"input": "16",
"output": "1.6E1"
},
{
"input": "01.23400",
"output": "1.234"
},
{
"input": ".100",
"output": "1E-1"
},
{
"input": "100.",
"output": "1E2"
},
{
"input": "9000",
"output": "9E3"
},
{
"input": "0.0012",
"output": "1.2E-3"
},
{
"input": "0001100",
"output": "1.1E3"
},
{
"input": "1",
"output": "1"
},
{
"input": "1.0000",
"output": "1"
},
{
"input": "2206815224318443962208128404511577750057653265995300414539703580103256087275661997018352502651118684",
"output": "2.206815224318443962208128404511577750057653265995300414539703580103256087275661997018352502651118684E99"
},
{
"input": ".642190250125247518637240673193254850619739079359757454472743329719747684651927659872735961709249479",
"output": "6.42190250125247518637240673193254850619739079359757454472743329719747684651927659872735961709249479E-1"
},
{
"input": "143529100720960530144687499862369157252883621496987867683546098241081752607457981824764693332677189.",
"output": "1.43529100720960530144687499862369157252883621496987867683546098241081752607457981824764693332677189E98"
},
{
"input": "5649388306043547446322173224045662327678394712363.27277681139968970424738731716530805786323956813790",
"output": "5.6493883060435474463221732240456623276783947123632727768113996897042473873171653080578632395681379E48"
},
{
"input": "0.1",
"output": "1E-1"
},
{
"input": ".1",
"output": "1E-1"
},
{
"input": "1.",
"output": "1"
},
{
"input": "0.111",
"output": "1.11E-1"
},
{
"input": ".111",
"output": "1.11E-1"
},
{
"input": "1.1",
"output": "1.1"
},
{
"input": "01.1",
"output": "1.1"
},
{
"input": "1.10",
"output": "1.1"
},
{
"input": "01.10",
"output": "1.1"
},
{
"input": "10.0",
"output": "1E1"
},
{
"input": "16.00",
"output": "1.6E1"
},
{
"input": "0016.",
"output": "1.6E1"
},
{
"input": ".000016",
"output": "1.6E-5"
},
{
"input": "16000.000",
"output": "1.6E4"
},
{
"input": "016.00",
"output": "1.6E1"
},
{
"input": "0016.00",
"output": "1.6E1"
},
{
"input": "0.16",
"output": "1.6E-1"
},
{
"input": "00.16",
"output": "1.6E-1"
},
{
"input": "00.160",
"output": "1.6E-1"
}
] | 1,587,121,379
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 44
| 124
| 6,451,200
|
s = input()
if not '.' in s: s += '.'
a,b = s.strip('0').split('.')
if len(a) > 0:
b = (a[1:] + b).rstrip('0')
le = len(a)-1
a = a[0]
else:
le = len(b.strip('0')) - len(b) - 1
b = b.strip('0').rstrip('0')
a = b[0]
b = b[1:]
print(a,end='')
if len(b): print('.' + b,end='')
if le : print('E'+str(le))
|
Title: Exponential notation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a positive decimal number *x*.
Your task is to convert it to the "simple exponential notation".
Let *x*<==<=*a*·10*b*, where 1<=≤<=*a*<=<<=10, then in general case the "simple exponential notation" looks like "aEb". If *b* equals to zero, the part "Eb" should be skipped. If *a* is an integer, it should be written without decimal point. Also there should not be extra zeroes in *a* and *b*.
Input Specification:
The only line contains the positive decimal number *x*. The length of the line will not exceed 106. Note that you are given too large number, so you can't use standard built-in data types "float", "double" and other.
Output Specification:
Print the only line — the "simple exponential notation" of the given number *x*.
Demo Input:
['16\n', '01.23400\n', '.100\n', '100.\n']
Demo Output:
['1.6E1\n', '1.234\n', '1E-1\n', '1E2\n']
Note:
none
|
```python
s = input()
if not '.' in s: s += '.'
a,b = s.strip('0').split('.')
if len(a) > 0:
b = (a[1:] + b).rstrip('0')
le = len(a)-1
a = a[0]
else:
le = len(b.strip('0')) - len(b) - 1
b = b.strip('0').rstrip('0')
a = b[0]
b = b[1:]
print(a,end='')
if len(b): print('.' + b,end='')
if le : print('E'+str(le))
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,574,619,237
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 109
| 0
|
n=input()
h=0
e=0
l=0
o=0
if len(n)<=5 or "h" not in n or "e" not in n or "l" not in n or "o" not in n:
print("NO")
elif "h" in n and "e" in n and "l" in n and "o" in n:
for i in range (len(n)):
if n[i]=="h":
h+=1
if n[i]=="e":
e+=1
if n[i]=="l":
l+=1
if n[i]=="o":
o+=1
if (h>=1 and e>=1 and l>=2 and o>=1) and (len(n)>5):
print("YES")
else:
print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n=input()
h=0
e=0
l=0
o=0
if len(n)<=5 or "h" not in n or "e" not in n or "l" not in n or "o" not in n:
print("NO")
elif "h" in n and "e" in n and "l" in n and "o" in n:
for i in range (len(n)):
if n[i]=="h":
h+=1
if n[i]=="e":
e+=1
if n[i]=="l":
l+=1
if n[i]=="o":
o+=1
if (h>=1 and e>=1 and l>=2 and o>=1) and (len(n)>5):
print("YES")
else:
print("NO")
```
| 0
|
742
|
A
|
Arpa’s hard exam and Mehrdad’s naive cheat
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math",
"number theory"
] | null | null |
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
|
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
|
Print single integer — the last digit of 1378*n*.
|
[
"1\n",
"2\n"
] |
[
"8",
"4"
] |
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
| 500
|
[
{
"input": "1",
"output": "8"
},
{
"input": "2",
"output": "4"
},
{
"input": "1000",
"output": "6"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "6"
},
{
"input": "1000000000",
"output": "6"
},
{
"input": "5",
"output": "8"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "2"
},
{
"input": "1378",
"output": "4"
},
{
"input": "13781378",
"output": "4"
},
{
"input": "51202278",
"output": "4"
},
{
"input": "999999998",
"output": "4"
},
{
"input": "999999997",
"output": "8"
},
{
"input": "12193721",
"output": "8"
},
{
"input": "0",
"output": "1"
},
{
"input": "989898989",
"output": "8"
},
{
"input": "7",
"output": "2"
},
{
"input": "8",
"output": "6"
},
{
"input": "9",
"output": "8"
},
{
"input": "10",
"output": "4"
},
{
"input": "11",
"output": "2"
},
{
"input": "12",
"output": "6"
},
{
"input": "13",
"output": "8"
},
{
"input": "14",
"output": "4"
},
{
"input": "15",
"output": "2"
},
{
"input": "16",
"output": "6"
},
{
"input": "999999996",
"output": "6"
},
{
"input": "999999995",
"output": "2"
},
{
"input": "999999994",
"output": "4"
}
] | 1,683,531,640
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 0
|
n=int(input())
x=n%4
y=pow(8,x)
print(str(y)[-1])
|
Title: Arpa’s hard exam and Mehrdad’s naive cheat
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There exists an island called Arpa’s land, some beautiful girls live there, as ugly ones do.
Mehrdad wants to become minister of Arpa’s land. Arpa has prepared an exam. Exam has only one question, given *n*, print the last digit of 1378*n*.
Mehrdad has become quite confused and wants you to help him. Please help, although it's a naive cheat.
Input Specification:
The single line of input contains one integer *n* (0<=<=≤<=<=*n*<=<=≤<=<=109).
Output Specification:
Print single integer — the last digit of 1378*n*.
Demo Input:
['1\n', '2\n']
Demo Output:
['8', '4']
Note:
In the first example, last digit of 1378<sup class="upper-index">1</sup> = 1378 is 8.
In the second example, last digit of 1378<sup class="upper-index">2</sup> = 1378·1378 = 1898884 is 4.
|
```python
n=int(input())
x=n%4
y=pow(8,x)
print(str(y)[-1])
```
| 0
|
|
245
|
A
|
System Administrator
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarpus is a system administrator. There are two servers under his strict guidance — *a* and *b*. To stay informed about the servers' performance, Polycarpus executes commands "ping a" and "ping b". Each ping command sends exactly ten packets to the server specified in the argument of the command. Executing a program results in two integers *x* and *y* (*x*<=+<=*y*<==<=10; *x*,<=*y*<=≥<=0). These numbers mean that *x* packets successfully reached the corresponding server through the network and *y* packets were lost.
Today Polycarpus has performed overall *n* ping commands during his workday. Now for each server Polycarpus wants to know whether the server is "alive" or not. Polycarpus thinks that the server is "alive", if at least half of the packets that we send to this server reached it successfully along the network.
Help Polycarpus, determine for each server, whether it is "alive" or not by the given commands and their results.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of commands Polycarpus has fulfilled. Each of the following *n* lines contains three integers — the description of the commands. The *i*-th of these lines contains three space-separated integers *t**i*, *x**i*, *y**i* (1<=≤<=*t**i*<=≤<=2; *x**i*,<=*y**i*<=≥<=0; *x**i*<=+<=*y**i*<==<=10). If *t**i*<==<=1, then the *i*-th command is "ping a", otherwise the *i*-th command is "ping b". Numbers *x**i*, *y**i* represent the result of executing this command, that is, *x**i* packets reached the corresponding server successfully and *y**i* packets were lost.
It is guaranteed that the input has at least one "ping a" command and at least one "ping b" command.
|
In the first line print string "LIVE" (without the quotes) if server *a* is "alive", otherwise print "DEAD" (without the quotes).
In the second line print the state of server *b* in the similar format.
|
[
"2\n1 5 5\n2 6 4\n",
"3\n1 0 10\n2 0 10\n1 10 0\n"
] |
[
"LIVE\nLIVE\n",
"LIVE\nDEAD\n"
] |
Consider the first test case. There 10 packets were sent to server *a*, 5 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall there were 10 packets sent to server *b*, 6 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network.
Consider the second test case. There were overall 20 packages sent to server *a*, 10 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall 10 packets were sent to server *b*, 0 of them reached it. Therefore, less than half of all packets sent to this server successfully reached it through the network.
| 0
|
[
{
"input": "2\n1 5 5\n2 6 4",
"output": "LIVE\nLIVE"
},
{
"input": "3\n1 0 10\n2 0 10\n1 10 0",
"output": "LIVE\nDEAD"
},
{
"input": "10\n1 3 7\n2 4 6\n1 2 8\n2 5 5\n2 10 0\n2 10 0\n1 8 2\n2 2 8\n2 10 0\n1 1 9",
"output": "DEAD\nLIVE"
},
{
"input": "11\n1 8 2\n1 6 4\n1 9 1\n1 7 3\n2 0 10\n2 0 10\n1 8 2\n2 2 8\n2 6 4\n2 7 3\n2 9 1",
"output": "LIVE\nDEAD"
},
{
"input": "12\n1 5 5\n1 0 10\n1 4 6\n1 2 8\n1 2 8\n1 5 5\n1 9 1\n2 9 1\n1 5 5\n1 1 9\n2 9 1\n2 7 3",
"output": "DEAD\nLIVE"
},
{
"input": "13\n1 8 2\n1 4 6\n1 5 5\n1 5 5\n2 10 0\n2 9 1\n1 3 7\n2 6 4\n2 6 4\n2 5 5\n1 7 3\n2 3 7\n2 9 1",
"output": "LIVE\nLIVE"
},
{
"input": "14\n1 7 3\n1 0 10\n1 7 3\n1 1 9\n2 2 8\n2 0 10\n1 1 9\n2 8 2\n2 6 4\n1 3 7\n1 3 7\n2 6 4\n2 1 9\n2 7 3",
"output": "DEAD\nDEAD"
}
] | 1,622,133,566
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 122
| 0
|
n=int(input())
s1=0
s11=0
s2=0
s22=0
for i in range(n):
t,x,y=map(int,input().split())
if t==1:
s1+=x
s11+=y
else:
s2+=x
s22+=y
if s1>=(s11)/2:
print("LIVE")
else:
print("DEAD")
if s2>=s22/2:
print("LIVE")
else:
print("DEAD")
|
Title: System Administrator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus is a system administrator. There are two servers under his strict guidance — *a* and *b*. To stay informed about the servers' performance, Polycarpus executes commands "ping a" and "ping b". Each ping command sends exactly ten packets to the server specified in the argument of the command. Executing a program results in two integers *x* and *y* (*x*<=+<=*y*<==<=10; *x*,<=*y*<=≥<=0). These numbers mean that *x* packets successfully reached the corresponding server through the network and *y* packets were lost.
Today Polycarpus has performed overall *n* ping commands during his workday. Now for each server Polycarpus wants to know whether the server is "alive" or not. Polycarpus thinks that the server is "alive", if at least half of the packets that we send to this server reached it successfully along the network.
Help Polycarpus, determine for each server, whether it is "alive" or not by the given commands and their results.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of commands Polycarpus has fulfilled. Each of the following *n* lines contains three integers — the description of the commands. The *i*-th of these lines contains three space-separated integers *t**i*, *x**i*, *y**i* (1<=≤<=*t**i*<=≤<=2; *x**i*,<=*y**i*<=≥<=0; *x**i*<=+<=*y**i*<==<=10). If *t**i*<==<=1, then the *i*-th command is "ping a", otherwise the *i*-th command is "ping b". Numbers *x**i*, *y**i* represent the result of executing this command, that is, *x**i* packets reached the corresponding server successfully and *y**i* packets were lost.
It is guaranteed that the input has at least one "ping a" command and at least one "ping b" command.
Output Specification:
In the first line print string "LIVE" (without the quotes) if server *a* is "alive", otherwise print "DEAD" (without the quotes).
In the second line print the state of server *b* in the similar format.
Demo Input:
['2\n1 5 5\n2 6 4\n', '3\n1 0 10\n2 0 10\n1 10 0\n']
Demo Output:
['LIVE\nLIVE\n', 'LIVE\nDEAD\n']
Note:
Consider the first test case. There 10 packets were sent to server *a*, 5 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall there were 10 packets sent to server *b*, 6 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network.
Consider the second test case. There were overall 20 packages sent to server *a*, 10 of them reached it. Therefore, at least half of all packets sent to this server successfully reached it through the network. Overall 10 packets were sent to server *b*, 0 of them reached it. Therefore, less than half of all packets sent to this server successfully reached it through the network.
|
```python
n=int(input())
s1=0
s11=0
s2=0
s22=0
for i in range(n):
t,x,y=map(int,input().split())
if t==1:
s1+=x
s11+=y
else:
s2+=x
s22+=y
if s1>=(s11)/2:
print("LIVE")
else:
print("DEAD")
if s2>=s22/2:
print("LIVE")
else:
print("DEAD")
```
| 0
|
|
440
|
A
|
Forgotten Episode
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarpus adores TV series. Right now he is ready to finish watching a season of a popular sitcom "Graph Theory". In total, the season has *n* episodes, numbered with integers from 1 to *n*.
Polycarpus watches episodes not one by one but in a random order. He has already watched all the episodes except for one. Which episode has Polycaprus forgotten to watch?
|
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100000) — the number of episodes in a season. Assume that the episodes are numbered by integers from 1 to *n*.
The second line contains *n*<=-<=1 integer *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the numbers of episodes that Polycarpus has watched. All values of *a**i* are distinct.
|
Print the number of the episode that Polycarpus hasn't watched.
|
[
"10\n3 8 10 1 7 9 6 5 2\n"
] |
[
"4\n"
] |
none
| 500
|
[
{
"input": "10\n3 8 10 1 7 9 6 5 2",
"output": "4"
},
{
"input": "5\n4 3 2 1",
"output": "5"
},
{
"input": "2\n1",
"output": "2"
},
{
"input": "2\n2",
"output": "1"
},
{
"input": "3\n1 2",
"output": "3"
},
{
"input": "3\n1 3",
"output": "2"
},
{
"input": "3\n2 3",
"output": "1"
},
{
"input": "3\n2 1",
"output": "3"
},
{
"input": "3\n3 1",
"output": "2"
},
{
"input": "3\n3 2",
"output": "1"
},
{
"input": "5\n2 3 4 5",
"output": "1"
},
{
"input": "5\n5 4 3 2",
"output": "1"
},
{
"input": "5\n5 2 4 3",
"output": "1"
},
{
"input": "5\n1 2 3 4",
"output": "5"
},
{
"input": "5\n2 1 3 4",
"output": "5"
},
{
"input": "5\n1 5 3 4",
"output": "2"
},
{
"input": "5\n1 4 5 2",
"output": "3"
},
{
"input": "5\n2 1 5 3",
"output": "4"
},
{
"input": "5\n2 3 4 5",
"output": "1"
}
] | 1,616,786,834
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 93
| 7,065,600
|
n = int(input())
arr = list(map(int, input().split()))
ans = n *(n+1)//2 - sum(arr)
print(ans)
|
Title: Forgotten Episode
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus adores TV series. Right now he is ready to finish watching a season of a popular sitcom "Graph Theory". In total, the season has *n* episodes, numbered with integers from 1 to *n*.
Polycarpus watches episodes not one by one but in a random order. He has already watched all the episodes except for one. Which episode has Polycaprus forgotten to watch?
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100000) — the number of episodes in a season. Assume that the episodes are numbered by integers from 1 to *n*.
The second line contains *n*<=-<=1 integer *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the numbers of episodes that Polycarpus has watched. All values of *a**i* are distinct.
Output Specification:
Print the number of the episode that Polycarpus hasn't watched.
Demo Input:
['10\n3 8 10 1 7 9 6 5 2\n']
Demo Output:
['4\n']
Note:
none
|
```python
n = int(input())
arr = list(map(int, input().split()))
ans = n *(n+1)//2 - sum(arr)
print(ans)
```
| 3
|
|
698
|
A
|
Vacations
|
PROGRAMMING
| 1,400
|
[
"dp"
] | null | null |
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
|
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
|
[
"4\n1 3 2 0\n",
"7\n1 3 3 2 1 2 3\n",
"2\n2 2\n"
] |
[
"2\n",
"0\n",
"1\n"
] |
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
| 500
|
[
{
"input": "4\n1 3 2 0",
"output": "2"
},
{
"input": "7\n1 3 3 2 1 2 3",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "10\n0 0 1 1 0 0 0 0 1 0",
"output": "8"
},
{
"input": "100\n3 2 3 3 3 2 3 1 3 2 2 3 2 3 3 3 3 3 3 1 2 2 3 1 3 3 2 2 2 3 1 0 3 3 3 2 3 3 1 1 3 1 3 3 3 1 3 1 3 0 1 3 2 3 2 1 1 3 2 3 3 3 2 3 1 3 3 3 3 2 2 2 1 3 1 3 3 3 3 1 3 2 3 3 0 3 3 3 3 3 1 0 2 1 3 3 0 2 3 3",
"output": "16"
},
{
"input": "10\n2 3 0 1 3 1 2 2 1 0",
"output": "3"
},
{
"input": "45\n3 3 2 3 2 3 3 3 0 3 3 3 3 3 3 3 1 3 2 3 2 3 2 2 2 3 2 3 3 3 3 3 1 2 3 3 2 2 2 3 3 3 3 1 3",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1 3",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n3 3",
"output": "0"
},
{
"input": "3\n3 3 3",
"output": "0"
},
{
"input": "2\n3 2",
"output": "0"
},
{
"input": "2\n0 2",
"output": "1"
},
{
"input": "10\n2 2 3 3 3 3 2 1 3 2",
"output": "2"
},
{
"input": "15\n0 1 0 0 0 2 0 1 0 0 0 2 0 0 0",
"output": "11"
},
{
"input": "15\n1 3 2 2 2 3 3 3 3 2 3 2 2 1 1",
"output": "4"
},
{
"input": "15\n3 1 3 2 3 2 2 2 3 3 3 3 2 3 2",
"output": "3"
},
{
"input": "20\n0 2 0 1 0 0 0 1 2 0 1 1 1 0 1 1 0 1 1 0",
"output": "12"
},
{
"input": "20\n2 3 2 3 3 3 3 2 0 3 1 1 2 3 0 3 2 3 0 3",
"output": "5"
},
{
"input": "20\n3 3 3 3 2 3 3 2 1 3 3 2 2 2 3 2 2 2 2 2",
"output": "4"
},
{
"input": "25\n0 0 1 0 0 1 0 0 1 0 0 1 0 2 0 0 2 0 0 1 0 2 0 1 1",
"output": "16"
},
{
"input": "25\n1 3 3 2 2 3 3 3 3 3 1 2 2 3 2 0 2 1 0 1 3 2 2 3 3",
"output": "5"
},
{
"input": "25\n2 3 1 3 3 2 1 3 3 3 1 3 3 1 3 2 3 3 1 3 3 3 2 3 3",
"output": "3"
},
{
"input": "30\n0 0 1 0 1 0 1 1 0 0 0 0 0 0 1 0 0 1 1 0 0 2 0 0 1 1 2 0 0 0",
"output": "22"
},
{
"input": "30\n1 1 3 2 2 0 3 2 3 3 1 2 0 1 1 2 3 3 2 3 1 3 2 3 0 2 0 3 3 2",
"output": "9"
},
{
"input": "30\n1 2 3 2 2 3 3 3 3 3 3 3 3 3 3 1 2 2 3 2 3 3 3 2 1 3 3 3 1 3",
"output": "2"
},
{
"input": "35\n0 1 1 0 0 2 0 0 1 0 0 0 1 0 1 0 1 0 0 0 1 2 1 0 2 2 1 0 1 0 1 1 1 0 0",
"output": "21"
},
{
"input": "35\n2 2 0 3 2 2 0 3 3 1 1 3 3 1 2 2 0 2 2 2 2 3 1 0 2 1 3 2 2 3 2 3 3 1 2",
"output": "11"
},
{
"input": "35\n1 2 2 3 3 3 3 3 2 2 3 3 2 3 3 2 3 2 3 3 2 2 2 3 3 2 3 3 3 1 3 3 2 2 2",
"output": "7"
},
{
"input": "40\n2 0 1 1 0 0 0 0 2 0 1 1 1 0 0 1 0 0 0 0 0 2 0 0 0 2 1 1 1 3 0 0 0 0 0 0 0 1 1 0",
"output": "28"
},
{
"input": "40\n2 2 3 2 0 2 3 2 1 2 3 0 2 3 2 1 1 3 1 1 0 2 3 1 3 3 1 1 3 3 2 2 1 3 3 3 2 3 3 1",
"output": "10"
},
{
"input": "40\n1 3 2 3 3 2 3 3 2 2 3 1 2 1 2 2 3 1 2 2 1 2 2 2 1 2 2 3 2 3 2 3 2 3 3 3 1 3 2 3",
"output": "8"
},
{
"input": "45\n2 1 0 0 0 2 1 0 1 0 0 2 2 1 1 0 0 2 0 0 0 0 0 0 1 0 0 2 0 0 1 1 0 0 1 0 0 1 1 2 0 0 2 0 2",
"output": "29"
},
{
"input": "45\n3 3 2 3 3 3 2 2 3 2 3 1 3 2 3 2 2 1 1 3 2 3 2 1 3 1 2 3 2 2 0 3 3 2 3 2 3 2 3 2 0 3 1 1 3",
"output": "8"
},
{
"input": "50\n3 0 0 0 2 0 0 0 0 0 0 0 2 1 0 2 0 1 0 1 3 0 2 1 1 0 0 1 1 0 0 1 2 1 1 2 1 1 0 0 0 0 0 0 0 1 2 2 0 0",
"output": "32"
},
{
"input": "50\n3 3 3 3 1 0 3 3 0 2 3 1 1 1 3 2 3 3 3 3 3 1 0 1 2 2 3 3 2 3 0 0 0 2 1 0 1 2 2 2 2 0 2 2 2 1 2 3 3 2",
"output": "16"
},
{
"input": "50\n3 2 3 1 2 1 2 3 3 2 3 3 2 1 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 2 3 3 3 3 2 3 1 2 3 3 2 3 3 1 2 2 1 1 3 3",
"output": "7"
},
{
"input": "55\n0 0 1 1 0 1 0 0 1 0 1 0 0 0 2 0 0 1 0 0 0 1 0 0 0 0 3 1 0 0 0 1 0 0 0 0 2 0 0 0 2 0 2 1 0 0 0 0 0 0 0 0 2 0 0",
"output": "40"
},
{
"input": "55\n3 0 3 3 3 2 0 2 3 0 3 2 3 3 0 3 3 1 3 3 1 2 3 2 0 3 3 2 1 2 3 2 3 0 3 2 2 1 2 3 2 2 1 3 2 2 3 1 3 2 2 3 3 2 2",
"output": "13"
},
{
"input": "55\n3 3 1 3 2 3 2 3 2 2 3 3 3 3 3 1 1 3 3 2 3 2 3 2 0 1 3 3 3 3 2 3 2 3 1 1 2 2 2 3 3 3 3 3 2 2 2 3 2 3 3 3 3 1 3",
"output": "7"
},
{
"input": "60\n0 1 0 0 0 0 0 0 0 2 1 1 3 0 0 0 0 0 1 0 1 1 0 0 0 3 0 1 0 1 0 2 0 0 0 0 0 1 0 0 0 0 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 0 0",
"output": "44"
},
{
"input": "60\n3 2 1 3 2 2 3 3 3 1 1 3 2 2 3 3 1 3 2 2 3 3 2 2 2 2 0 2 2 3 2 3 0 3 3 3 2 3 3 0 1 3 2 1 3 1 1 2 1 3 1 1 2 2 1 3 3 3 2 2",
"output": "15"
},
{
"input": "60\n3 2 2 3 2 3 2 3 3 2 3 2 3 3 2 3 3 3 3 3 3 2 3 3 1 2 3 3 3 2 1 3 3 1 3 1 3 0 3 3 3 2 3 2 3 2 3 3 1 1 2 3 3 3 3 2 1 3 2 3",
"output": "8"
},
{
"input": "65\n1 0 2 1 1 0 1 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 0 1 2 0 2 1 0 2 1 0 1 0 1 1 0 1 1 1 2 1 0 1 0 0 0 0 1 2 2 1 0 0 1 2 1 2 0 2 0 0 0 1 1",
"output": "35"
},
{
"input": "65\n2 2 2 3 0 2 1 2 3 3 1 3 1 2 1 3 2 3 2 2 2 1 2 0 3 1 3 1 1 3 1 3 3 3 3 3 1 3 0 3 1 3 1 2 2 3 2 0 3 1 3 2 1 2 2 2 3 3 2 3 3 3 2 2 3",
"output": "13"
},
{
"input": "65\n3 2 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 3 3 2 2 2 3 3 2 3 3 2 3 3 3 3 2 3 3 3 2 2 3 3 3 3 3 3 2 2 3 3 2 3 3 1 3 3 3 3",
"output": "6"
},
{
"input": "70\n1 0 0 0 1 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 1 1 1 3 1 1 0 1 2 0 2 1 0 0 0 1 1 1 1 1 0 0 1 0 0 0 1 1 1 3 0 0 1 0 0 0 1 0 0 0 0 0 1 0 1 1",
"output": "43"
},
{
"input": "70\n2 3 3 3 1 3 3 1 2 1 1 2 2 3 0 2 3 3 1 3 3 2 2 3 3 3 2 2 2 2 1 3 3 0 2 1 1 3 2 3 3 2 2 3 1 3 1 2 3 2 3 3 2 2 2 3 1 1 2 1 3 3 2 2 3 3 3 1 1 1",
"output": "16"
},
{
"input": "70\n3 3 2 2 1 2 1 2 2 2 2 2 3 3 2 3 3 3 3 2 2 2 2 3 3 3 1 3 3 3 2 3 3 3 3 2 3 3 1 3 1 3 2 3 3 2 3 3 3 2 3 2 3 3 1 2 3 3 2 2 2 3 2 3 3 3 3 3 3 1",
"output": "10"
},
{
"input": "75\n1 0 0 1 1 0 0 1 0 1 2 0 0 2 1 1 0 0 0 0 0 0 2 1 1 0 0 0 0 1 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 0 0 1 2 1 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 1 1 1 0 1 0",
"output": "51"
},
{
"input": "75\n1 3 3 3 1 1 3 2 3 3 1 3 3 3 2 1 3 2 2 3 1 1 1 1 1 1 2 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 2 2 2 1 2 3 3 2 2 3 0 1 1 3 3 0 0 1 1 3 2 3 3 3 3 1 2 2 3 3 3 3 1",
"output": "16"
},
{
"input": "75\n3 3 3 3 2 2 3 2 2 3 2 2 1 2 3 3 2 2 3 3 1 2 2 2 1 3 3 3 1 2 2 3 3 3 2 3 2 2 2 3 3 1 3 2 2 3 3 3 0 3 2 1 3 3 2 3 3 3 3 1 2 3 3 3 2 2 3 3 3 3 2 2 3 3 1",
"output": "11"
},
{
"input": "80\n0 0 0 0 2 0 1 1 1 1 1 0 0 0 0 2 0 0 1 0 0 0 0 1 1 0 2 2 1 1 0 1 0 1 0 1 1 1 0 1 2 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0 2 2 0 1 1 0 0 0 0 0 0 0 0 1",
"output": "56"
},
{
"input": "80\n2 2 3 3 2 1 0 1 0 3 2 2 3 2 1 3 1 3 3 2 3 3 3 2 3 3 3 2 1 3 3 1 3 3 3 3 3 3 2 2 2 1 3 2 1 3 2 1 1 0 1 1 2 1 3 0 1 2 3 2 2 3 2 3 1 3 3 2 1 1 0 3 3 3 3 1 2 1 2 0",
"output": "17"
},
{
"input": "80\n2 3 3 2 2 2 3 3 2 3 3 3 3 3 2 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 1 3 2 3 3 0 3 1 2 3 3 1 2 3 2 3 3 2 3 3 3 3 3 2 2 3 0 3 3 3 3 3 2 2 3 2 3 3 3 3 3 2 3 2 3 3 3 3 2 3",
"output": "9"
},
{
"input": "85\n0 1 1 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 2 0 1 0 0 2 0 1 1 0 0 0 0 2 2 0 0 0 1 0 0 0 1 2 0 1 0 0 0 2 1 1 2 0 3 1 0 2 2 1 0 0 1 1 0 0 0 0 1 0 2 1 1 2 1 0 0 1 2 1 2 0 0 1 0 1 0",
"output": "54"
},
{
"input": "85\n2 3 1 3 2 3 1 3 3 2 1 2 1 2 2 3 2 2 3 2 0 3 3 2 1 2 2 2 3 3 2 3 3 3 2 1 1 3 1 3 2 2 2 3 3 2 3 2 3 1 1 3 2 3 1 3 3 2 3 3 2 2 3 0 1 1 2 2 2 2 1 2 3 1 3 3 1 3 2 2 3 2 3 3 3",
"output": "19"
},
{
"input": "85\n1 2 1 2 3 2 3 3 3 3 3 3 3 2 1 3 2 3 3 3 3 2 3 3 3 1 3 3 3 3 2 3 3 3 3 3 3 2 2 1 3 3 3 3 2 2 3 1 1 2 3 3 3 2 3 3 3 3 3 2 3 3 3 2 2 3 3 1 1 1 3 3 3 3 1 3 3 3 1 3 3 1 3 2 3",
"output": "9"
},
{
"input": "90\n2 0 1 0 0 0 0 0 0 1 1 2 0 0 0 0 0 0 0 2 2 0 2 0 0 2 1 0 2 0 1 0 1 0 0 1 2 2 0 0 1 0 0 1 0 1 0 2 0 1 1 1 0 1 1 0 1 0 2 0 1 0 1 0 0 0 1 0 0 1 2 0 0 0 1 0 0 2 2 0 0 0 0 0 1 3 1 1 0 1",
"output": "57"
},
{
"input": "90\n2 3 3 3 2 3 2 1 3 0 3 2 3 3 2 1 3 3 2 3 2 3 3 2 1 3 1 3 3 1 2 2 3 3 2 1 2 3 2 3 0 3 3 2 2 3 1 0 3 3 1 3 3 3 3 2 1 2 2 1 3 2 1 3 3 1 2 0 2 2 3 2 2 3 3 3 1 3 2 1 2 3 3 2 3 2 3 3 2 1",
"output": "17"
},
{
"input": "90\n2 3 2 3 2 2 3 3 2 3 2 1 2 3 3 3 2 3 2 3 3 2 3 3 3 1 3 3 1 3 2 3 2 2 1 3 3 3 3 3 3 3 3 3 3 2 3 2 3 2 1 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 1 3 2 3 3 3 2 2 3 2 3 2 1 3 2",
"output": "9"
},
{
"input": "95\n0 0 3 0 2 0 1 0 0 2 0 0 0 0 0 0 0 1 0 0 0 2 0 0 0 0 0 1 0 0 2 1 0 0 1 0 0 0 1 0 0 0 0 1 0 1 0 0 1 0 1 2 0 1 2 2 0 0 1 0 2 0 0 0 1 0 2 1 2 1 0 1 0 0 0 1 0 0 1 1 2 1 1 1 1 2 0 0 0 0 0 1 1 0 1",
"output": "61"
},
{
"input": "95\n2 3 3 2 1 1 3 3 3 2 3 3 3 2 3 2 3 3 3 2 3 2 2 3 3 2 1 2 3 3 3 1 3 0 3 3 1 3 3 1 0 1 3 3 3 0 2 1 3 3 3 3 0 1 3 2 3 3 2 1 3 1 2 1 1 2 3 0 3 3 2 1 3 2 1 3 3 3 2 2 3 2 3 3 3 2 1 3 3 3 2 3 3 1 2",
"output": "15"
},
{
"input": "95\n2 3 3 2 3 2 2 1 3 1 2 1 2 3 1 2 3 3 1 3 3 3 1 2 3 2 2 2 2 3 3 3 2 2 3 3 3 3 3 1 2 2 3 3 3 3 2 3 2 2 2 3 3 2 3 3 3 3 3 3 3 0 3 2 0 3 3 1 3 3 3 2 3 2 3 2 3 3 3 3 2 2 1 1 3 3 3 3 3 1 3 3 3 3 2",
"output": "14"
},
{
"input": "100\n1 0 2 0 0 0 0 2 0 0 0 1 0 1 0 0 1 0 1 2 0 1 1 0 0 1 0 1 1 0 0 0 2 0 1 0 0 2 0 0 0 0 0 1 1 1 0 0 1 0 2 0 0 0 0 1 0 1 0 1 0 1 0 1 2 2 0 0 2 0 1 0 1 0 1 0 0 0 1 0 0 2 1 1 1 0 0 1 0 0 0 2 0 0 2 1 1 0 0 2",
"output": "63"
},
{
"input": "100\n3 2 1 3 2 3 2 3 2 2 3 1 3 3 3 3 3 2 2 3 2 2 3 2 3 3 3 2 3 1 2 1 3 3 3 3 1 3 3 3 3 3 2 3 2 1 3 3 1 2 2 3 1 3 3 1 2 2 1 3 1 3 2 2 3 3 1 3 2 3 1 2 1 2 3 3 2 2 1 2 3 3 3 3 3 1 3 3 3 3 2 1 3 0 3 3 3 2 3 3",
"output": "15"
},
{
"input": "100\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "0"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "49"
},
{
"input": "100\n2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "2\n0 3",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "1"
},
{
"input": "2\n2 1",
"output": "0"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "2\n3 0",
"output": "1"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "100\n3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0",
"output": "50"
}
] | 1,497,172,204
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 62
| 307,200
|
import sys
import math
inf = 100000000
n = int(input())
a = [int(e) for e in input().split()]
f = [[0, 0, 0] for i in range(n)]
m = inf
f[0][0] = 1
if a[0] == 1 or a[0] == 3:
f[0][1] = 0
else:
f[0][1] = inf
if a[0] == 2 or a[0] == 3:
f[0][2] = 0
else:
f[0][2] = inf
if a[0] == 3:
f[0][1] = f[0][2] = inf
for i in range(1, n):
f[i][0] = min(f[i - 1]) + 1
if a[i] == 1 or a[i] == 3:
f[i][1] = min(f[i-1][0], f[i-1][2])
else:
f[i][1] = inf
if a[i] == 2 or a[i] == 3:
f[i][2] = min(f[i-1][0], f[i-1][1])
else:
f[i][2] = inf
if a[i] == 0:
f[i][1] = f[i][2] = inf
m = min(f[i])
print(m)
|
Title: Vacations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
Output Specification:
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
Demo Input:
['4\n1 3 2 0\n', '7\n1 3 3 2 1 2 3\n', '2\n2 2\n']
Demo Output:
['2\n', '0\n', '1\n']
Note:
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
|
```python
import sys
import math
inf = 100000000
n = int(input())
a = [int(e) for e in input().split()]
f = [[0, 0, 0] for i in range(n)]
m = inf
f[0][0] = 1
if a[0] == 1 or a[0] == 3:
f[0][1] = 0
else:
f[0][1] = inf
if a[0] == 2 or a[0] == 3:
f[0][2] = 0
else:
f[0][2] = inf
if a[0] == 3:
f[0][1] = f[0][2] = inf
for i in range(1, n):
f[i][0] = min(f[i - 1]) + 1
if a[i] == 1 or a[i] == 3:
f[i][1] = min(f[i-1][0], f[i-1][2])
else:
f[i][1] = inf
if a[i] == 2 or a[i] == 3:
f[i][2] = min(f[i-1][0], f[i-1][1])
else:
f[i][2] = inf
if a[i] == 0:
f[i][1] = f[i][2] = inf
m = min(f[i])
print(m)
```
| 0
|
|
851
|
A
|
Arpa and a research in Mexican wave
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Arpa is researching the Mexican wave.
There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0.
- At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits.
Arpa wants to know how many spectators are standing at time *t*.
|
The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=<<=*n*<=+<=*k*).
|
Print single integer: how many spectators are standing at time *t*.
|
[
"10 5 3\n",
"10 5 7\n",
"10 5 12\n"
] |
[
"3\n",
"5\n",
"3\n"
] |
In the following a sitting spectator is represented as -, a standing spectator is represented as ^.
- At *t* = 0 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1 ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2 ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3 ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4 ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5 ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6 -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7 --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8 ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9 ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
| 500
|
[
{
"input": "10 5 3",
"output": "3"
},
{
"input": "10 5 7",
"output": "5"
},
{
"input": "10 5 12",
"output": "3"
},
{
"input": "840585600 770678331 788528791",
"output": "770678331"
},
{
"input": "25462281 23343504 8024619",
"output": "8024619"
},
{
"input": "723717988 205757169 291917494",
"output": "205757169"
},
{
"input": "27462087 20831796 15492397",
"output": "15492397"
},
{
"input": "966696824 346707476 1196846860",
"output": "116557440"
},
{
"input": "290274403 41153108 327683325",
"output": "3744186"
},
{
"input": "170963478 151220598 222269210",
"output": "99914866"
},
{
"input": "14264008 309456 11132789",
"output": "309456"
},
{
"input": "886869816 281212106 52891064",
"output": "52891064"
},
{
"input": "330543750 243917820 205522400",
"output": "205522400"
},
{
"input": "457658451 18625039 157624558",
"output": "18625039"
},
{
"input": "385908940 143313325 509731380",
"output": "19490885"
},
{
"input": "241227633 220621961 10025257",
"output": "10025257"
},
{
"input": "474139818 268918981 388282504",
"output": "268918981"
},
{
"input": "25963410 3071034 820199",
"output": "820199"
},
{
"input": "656346757 647995766 75748423",
"output": "75748423"
},
{
"input": "588568132 411878522 521753621",
"output": "411878522"
},
{
"input": "735788762 355228487 139602545",
"output": "139602545"
},
{
"input": "860798593 463398487 506871376",
"output": "463398487"
},
{
"input": "362624055 110824996 194551217",
"output": "110824996"
},
{
"input": "211691721 195866131 313244576",
"output": "94313276"
},
{
"input": "45661815 26072719 9643822",
"output": "9643822"
},
{
"input": "757183104 590795077 709609355",
"output": "590795077"
},
{
"input": "418386749 1915035 197248338",
"output": "1915035"
},
{
"input": "763782282 297277890 246562421",
"output": "246562421"
},
{
"input": "893323188 617630677 607049638",
"output": "607049638"
},
{
"input": "506708261 356545583 296093684",
"output": "296093684"
},
{
"input": "984295813 427551190 84113823",
"output": "84113823"
},
{
"input": "774984967 61373612 96603505",
"output": "61373612"
},
{
"input": "774578969 342441237 91492393",
"output": "91492393"
},
{
"input": "76495801 8780305 56447339",
"output": "8780305"
},
{
"input": "48538385 582843 16805978",
"output": "582843"
},
{
"input": "325794610 238970909 553089099",
"output": "11676420"
},
{
"input": "834925315 316928679 711068031",
"output": "316928679"
},
{
"input": "932182199 454838315 267066713",
"output": "267066713"
},
{
"input": "627793782 552043394 67061810",
"output": "67061810"
},
{
"input": "24317170 17881607 218412",
"output": "218412"
},
{
"input": "1000000000 1000 1",
"output": "1"
},
{
"input": "1000000000 1000 2",
"output": "2"
},
{
"input": "1000000000 1 1000",
"output": "1"
},
{
"input": "100 100 100",
"output": "100"
},
{
"input": "100 100 99",
"output": "99"
},
{
"input": "100 100 101",
"output": "99"
},
{
"input": "100 100 199",
"output": "1"
},
{
"input": "1000000000 1000000000 1999999999",
"output": "1"
},
{
"input": "10 5 5",
"output": "5"
},
{
"input": "5 3 5",
"output": "3"
},
{
"input": "10 3 3",
"output": "3"
},
{
"input": "10 5 6",
"output": "5"
},
{
"input": "3 2 4",
"output": "1"
},
{
"input": "10 5 14",
"output": "1"
},
{
"input": "6 1 4",
"output": "1"
},
{
"input": "10 10 19",
"output": "1"
},
{
"input": "10 4 11",
"output": "3"
},
{
"input": "2 2 3",
"output": "1"
},
{
"input": "10 5 11",
"output": "4"
},
{
"input": "600 200 700",
"output": "100"
},
{
"input": "2000 1000 2001",
"output": "999"
},
{
"input": "1000 1000 1001",
"output": "999"
},
{
"input": "5 4 6",
"output": "3"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "10 3 10",
"output": "3"
},
{
"input": "15 10 10",
"output": "10"
},
{
"input": "10 5 13",
"output": "2"
},
{
"input": "2 2 2",
"output": "2"
},
{
"input": "5 5 6",
"output": "4"
},
{
"input": "10 6 12",
"output": "4"
},
{
"input": "7 5 8",
"output": "4"
},
{
"input": "10 4 9",
"output": "4"
},
{
"input": "9 2 6",
"output": "2"
},
{
"input": "5 2 6",
"output": "1"
},
{
"input": "6 2 6",
"output": "2"
},
{
"input": "5 5 8",
"output": "2"
},
{
"input": "3 3 5",
"output": "1"
},
{
"input": "10 2 5",
"output": "2"
},
{
"input": "5 3 7",
"output": "1"
},
{
"input": "5 4 8",
"output": "1"
},
{
"input": "10 6 11",
"output": "5"
},
{
"input": "5 3 6",
"output": "2"
},
{
"input": "10 6 14",
"output": "2"
},
{
"input": "10 10 10",
"output": "10"
},
{
"input": "1000000000 1 1000000000",
"output": "1"
},
{
"input": "20 4 22",
"output": "2"
},
{
"input": "5 4 4",
"output": "4"
},
{
"input": "4 3 6",
"output": "1"
},
{
"input": "12 8 18",
"output": "2"
},
{
"input": "10 5 10",
"output": "5"
},
{
"input": "100 50 149",
"output": "1"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "7 6 9",
"output": "4"
},
{
"input": "16 10 21",
"output": "5"
},
{
"input": "10 2 11",
"output": "1"
},
{
"input": "600 200 500",
"output": "200"
},
{
"input": "100 30 102",
"output": "28"
},
{
"input": "10 10 18",
"output": "2"
},
{
"input": "15 3 10",
"output": "3"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "5 5 5",
"output": "5"
},
{
"input": "10 3 12",
"output": "1"
},
{
"input": "747 457 789",
"output": "415"
},
{
"input": "5 4 7",
"output": "2"
},
{
"input": "15 5 11",
"output": "5"
},
{
"input": "3 2 2",
"output": "2"
},
{
"input": "7 6 8",
"output": "5"
},
{
"input": "7 4 8",
"output": "3"
},
{
"input": "10 4 13",
"output": "1"
},
{
"input": "10 3 9",
"output": "3"
},
{
"input": "20 2 21",
"output": "1"
},
{
"input": "6 5 9",
"output": "2"
},
{
"input": "10 9 18",
"output": "1"
},
{
"input": "12 4 9",
"output": "4"
},
{
"input": "10 7 15",
"output": "2"
},
{
"input": "999999999 999999998 1500000000",
"output": "499999997"
},
{
"input": "20 5 20",
"output": "5"
},
{
"input": "4745 4574 4757",
"output": "4562"
},
{
"input": "10 7 12",
"output": "5"
},
{
"input": "17 15 18",
"output": "14"
},
{
"input": "3 1 3",
"output": "1"
},
{
"input": "100 3 7",
"output": "3"
},
{
"input": "6 2 7",
"output": "1"
},
{
"input": "8 5 10",
"output": "3"
},
{
"input": "3 3 3",
"output": "3"
},
{
"input": "9 5 10",
"output": "4"
},
{
"input": "10 6 13",
"output": "3"
},
{
"input": "13 10 14",
"output": "9"
},
{
"input": "13 12 15",
"output": "10"
},
{
"input": "10 4 12",
"output": "2"
},
{
"input": "41 3 3",
"output": "3"
},
{
"input": "1000000000 1000000000 1400000000",
"output": "600000000"
},
{
"input": "10 3 11",
"output": "2"
},
{
"input": "12 7 18",
"output": "1"
},
{
"input": "15 3 17",
"output": "1"
},
{
"input": "10 2 8",
"output": "2"
},
{
"input": "1000000000 1000 1000000999",
"output": "1"
},
{
"input": "5 5 9",
"output": "1"
},
{
"input": "100 3 6",
"output": "3"
},
{
"input": "100 5 50",
"output": "5"
},
{
"input": "10000 10 10000",
"output": "10"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "6 4 4",
"output": "4"
},
{
"input": "9979797 555554 10101010",
"output": "434341"
},
{
"input": "13 5 12",
"output": "5"
},
{
"input": "9 4 10",
"output": "3"
},
{
"input": "7 5 10",
"output": "2"
},
{
"input": "100000000 10000000 100005000",
"output": "9995000"
},
{
"input": "100000 50000 100001",
"output": "49999"
},
{
"input": "15 10 20",
"output": "5"
},
{
"input": "4 4 5",
"output": "3"
},
{
"input": "5 3 3",
"output": "3"
},
{
"input": "30 5 30",
"output": "5"
},
{
"input": "200000 10 200005",
"output": "5"
},
{
"input": "10 9 12",
"output": "7"
},
{
"input": "10 6 15",
"output": "1"
},
{
"input": "1000000000 10 1000000000",
"output": "10"
},
{
"input": "7 5 11",
"output": "1"
},
{
"input": "9 4 4",
"output": "4"
},
{
"input": "14 3 15",
"output": "2"
},
{
"input": "1000000000 100000000 1000000000",
"output": "100000000"
},
{
"input": "40 10 22",
"output": "10"
},
{
"input": "50 10 51",
"output": "9"
},
{
"input": "999999997 999999995 1999999991",
"output": "1"
},
{
"input": "92 79 144",
"output": "27"
},
{
"input": "8 4 4",
"output": "4"
}
] | 1,650,016,685
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 166
| 46
| 0
|
n, k, t = map(int, input().split())
print(t if t <= k else k if k < t < n else n+k-t)
|
Title: Arpa and a research in Mexican wave
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arpa is researching the Mexican wave.
There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0.
- At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits.
Arpa wants to know how many spectators are standing at time *t*.
Input Specification:
The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=<<=*n*<=+<=*k*).
Output Specification:
Print single integer: how many spectators are standing at time *t*.
Demo Input:
['10 5 3\n', '10 5 7\n', '10 5 12\n']
Demo Output:
['3\n', '5\n', '3\n']
Note:
In the following a sitting spectator is represented as -, a standing spectator is represented as ^.
- At *t* = 0 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1 ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2 ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3 ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4 ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5 ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6 -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7 --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8 ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9 ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
|
```python
n, k, t = map(int, input().split())
print(t if t <= k else k if k < t < n else n+k-t)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,552,334,858
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 218
| 0
|
#!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Mon Mar 11 14:00:39 2019
@author: wuser
"""
P = input()
low=0
May=0
for x in P:
if x == x.lower():
low+=1
else :
May+=1
if May > low:
print(P.upper())
else:
print(P.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
#!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Mon Mar 11 14:00:39 2019
@author: wuser
"""
P = input()
low=0
May=0
for x in P:
if x == x.lower():
low+=1
else :
May+=1
if May > low:
print(P.upper())
else:
print(P.lower())
```
| 3.9455
|
835
|
A
|
Key races
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
|
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
|
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
|
[
"5 1 2 1 2\n",
"3 3 1 1 1\n",
"4 5 3 1 5\n"
] |
[
"First\n",
"Second\n",
"Friendship\n"
] |
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
| 500
|
[
{
"input": "5 1 2 1 2",
"output": "First"
},
{
"input": "3 3 1 1 1",
"output": "Second"
},
{
"input": "4 5 3 1 5",
"output": "Friendship"
},
{
"input": "1000 1000 1000 1000 1000",
"output": "Friendship"
},
{
"input": "1 1 1 1 1",
"output": "Friendship"
},
{
"input": "8 8 1 1 1",
"output": "Second"
},
{
"input": "15 14 32 65 28",
"output": "First"
},
{
"input": "894 197 325 232 902",
"output": "First"
},
{
"input": "1 2 8 8 5",
"output": "Friendship"
},
{
"input": "37 261 207 1 1000",
"output": "Friendship"
},
{
"input": "29 344 406 900 1",
"output": "Friendship"
},
{
"input": "1 2 8 9 8",
"output": "First"
},
{
"input": "2 9 8 8 9",
"output": "Friendship"
},
{
"input": "213 480 811 134 745",
"output": "First"
},
{
"input": "2 313 856 964 421",
"output": "Friendship"
},
{
"input": "1 10 2 6 10",
"output": "Friendship"
},
{
"input": "2 7 6 2 3",
"output": "Friendship"
},
{
"input": "637 324 69 612 998",
"output": "Second"
},
{
"input": "13 849 819 723 918",
"output": "Friendship"
},
{
"input": "9 5 7 8 7",
"output": "First"
},
{
"input": "6 5 7 10 4",
"output": "Friendship"
},
{
"input": "61 464 623 89 548",
"output": "First"
},
{
"input": "641 31 29 161 802",
"output": "Friendship"
},
{
"input": "3 3 1 6 9",
"output": "Friendship"
},
{
"input": "2 3 9 8 2",
"output": "Friendship"
},
{
"input": "485 117 368 567 609",
"output": "First"
},
{
"input": "4 202 512 995 375",
"output": "Friendship"
},
{
"input": "424 41 41 909 909",
"output": "Friendship"
},
{
"input": "884 913 263 641 265",
"output": "Second"
},
{
"input": "12 462 8 311 327",
"output": "Second"
},
{
"input": "436 306 266 493 580",
"output": "Second"
},
{
"input": "69 1 2 1 2",
"output": "First"
}
] | 1,567,178,855
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 109
| 0
|
(k,m,n,o,x)=map(int,input().split())
count1=k*m+2*o
count2=k*n+2*x
if count2>count1:
print("First")
if count1>count2:
print("Second")
if count1==count2:
print("Friendship")
|
Title: Key races
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
Input Specification:
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
Output Specification:
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
Demo Input:
['5 1 2 1 2\n', '3 3 1 1 1\n', '4 5 3 1 5\n']
Demo Output:
['First\n', 'Second\n', 'Friendship\n']
Note:
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
|
```python
(k,m,n,o,x)=map(int,input().split())
count1=k*m+2*o
count2=k*n+2*x
if count2>count1:
print("First")
if count1>count2:
print("Second")
if count1==count2:
print("Friendship")
```
| 3
|
|
272
|
A
|
Dima and Friends
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
|
In a single line print the answer to the problem.
|
[
"1\n1\n",
"1\n2\n",
"2\n3 5\n"
] |
[
"3\n",
"2\n",
"3\n"
] |
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
| 500
|
[
{
"input": "1\n1",
"output": "3"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "2\n3 5",
"output": "3"
},
{
"input": "1\n5",
"output": "3"
},
{
"input": "5\n4 4 3 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 2 1 3",
"output": "4"
},
{
"input": "8\n2 2 5 3 4 3 3 2",
"output": "4"
},
{
"input": "7\n4 1 3 2 2 4 5",
"output": "4"
},
{
"input": "3\n3 5 1",
"output": "4"
},
{
"input": "95\n4 2 3 4 4 5 2 2 4 4 3 5 3 3 3 5 4 2 5 4 2 1 1 3 4 2 1 3 5 4 2 1 1 5 1 1 2 2 4 4 5 4 5 5 2 1 2 2 2 4 5 5 2 4 3 4 4 3 5 2 4 1 5 4 5 1 3 2 4 2 2 1 5 3 1 5 3 4 3 3 2 1 2 2 1 3 1 5 2 3 1 1 2 5 2",
"output": "5"
},
{
"input": "31\n3 2 3 3 3 3 4 4 1 5 5 4 2 4 3 2 2 1 4 4 1 2 3 1 1 5 5 3 4 4 1",
"output": "4"
},
{
"input": "42\n3 1 2 2 5 1 2 2 4 5 4 5 2 5 4 5 4 4 1 4 3 3 4 4 4 4 3 2 1 3 4 5 5 2 1 2 1 5 5 2 4 4",
"output": "5"
},
{
"input": "25\n4 5 5 5 3 1 1 4 4 4 3 5 4 4 1 4 4 1 2 4 2 5 4 5 3",
"output": "5"
},
{
"input": "73\n3 4 3 4 5 1 3 4 2 1 4 2 2 3 5 3 1 4 2 3 2 1 4 5 3 5 2 2 4 3 2 2 5 3 2 3 5 1 3 1 1 4 5 2 4 2 5 1 4 3 1 3 1 4 2 3 3 3 3 5 5 2 5 2 5 4 3 1 1 5 5 2 3",
"output": "4"
},
{
"input": "46\n1 4 4 5 4 5 2 3 5 5 3 2 5 4 1 3 2 2 1 4 3 1 5 5 2 2 2 2 4 4 1 1 4 3 4 3 1 4 2 2 4 2 3 2 5 2",
"output": "4"
},
{
"input": "23\n5 2 1 1 4 2 5 5 3 5 4 5 5 1 1 5 2 4 5 3 4 4 3",
"output": "5"
},
{
"input": "6\n4 2 3 1 3 5",
"output": "4"
},
{
"input": "15\n5 5 5 3 5 4 1 3 3 4 3 4 1 4 4",
"output": "5"
},
{
"input": "93\n1 3 1 4 3 3 5 3 1 4 5 4 3 2 2 4 3 1 4 1 2 3 3 3 2 5 1 3 1 4 5 1 1 1 4 2 1 2 3 1 1 1 5 1 5 5 1 2 5 4 3 2 2 4 4 2 5 4 5 5 3 1 3 1 2 1 3 1 1 2 3 4 4 5 5 3 2 1 3 3 5 1 3 5 4 4 1 3 3 4 2 3 2",
"output": "5"
},
{
"input": "96\n1 5 1 3 2 1 2 2 2 2 3 4 1 1 5 4 4 1 2 3 5 1 4 4 4 1 3 3 1 4 5 4 1 3 5 3 4 4 3 2 1 1 4 4 5 1 1 2 5 1 2 3 1 4 1 2 2 2 3 2 3 3 2 5 2 2 3 3 3 3 2 1 2 4 5 5 1 5 3 2 1 4 3 5 5 5 3 3 5 3 4 3 4 2 1 3",
"output": "5"
},
{
"input": "49\n1 4 4 3 5 2 2 1 5 1 2 1 2 5 1 4 1 4 5 2 4 5 3 5 2 4 2 1 3 4 2 1 4 2 1 1 3 3 2 3 5 4 3 4 2 4 1 4 1",
"output": "5"
},
{
"input": "73\n4 1 3 3 3 1 5 2 1 4 1 1 3 5 1 1 4 5 2 1 5 4 1 5 3 1 5 2 4 5 1 4 3 3 5 2 2 3 3 2 5 1 4 5 2 3 1 4 4 3 5 2 3 5 1 4 3 5 1 2 4 1 3 3 5 4 2 4 2 4 1 2 5",
"output": "5"
},
{
"input": "41\n5 3 5 4 2 5 4 3 1 1 1 5 4 3 4 3 5 4 2 5 4 1 1 3 2 4 5 3 5 1 5 5 1 1 1 4 4 1 2 4 3",
"output": "5"
},
{
"input": "100\n3 3 1 4 2 4 4 3 1 5 1 1 4 4 3 4 4 3 5 4 5 2 4 3 4 1 2 4 5 4 2 1 5 4 1 1 4 3 2 4 1 2 1 4 4 5 5 4 4 5 3 2 5 1 4 2 2 1 1 2 5 2 5 1 5 3 1 4 3 2 4 3 2 2 4 5 5 1 2 3 1 4 1 2 2 2 5 5 2 3 2 4 3 1 1 2 1 2 1 2",
"output": "5"
},
{
"input": "100\n2 1 1 3 5 4 4 2 3 4 3 4 5 4 5 4 2 4 5 3 4 5 4 1 1 4 4 1 1 2 5 4 2 4 5 3 2 5 4 3 4 5 1 3 4 2 5 4 5 4 5 2 4 1 2 5 3 1 4 4 5 3 4 3 1 2 5 4 2 5 4 1 5 3 5 4 1 2 5 3 1 1 1 1 5 3 4 3 5 1 1 5 5 1 1 2 2 1 5 1",
"output": "5"
},
{
"input": "100\n4 4 3 3 2 5 4 4 2 1 4 4 4 5 4 1 2 1 5 2 4 3 4 1 4 1 2 5 1 4 5 4 2 1 2 5 3 4 5 5 2 1 2 2 2 2 2 3 2 5 1 2 2 3 2 5 5 1 3 4 5 2 1 3 4 2 2 4 4 3 3 3 2 3 2 1 5 5 5 2 1 4 2 3 5 1 4 4 2 3 2 5 5 4 3 5 1 3 5 5",
"output": "5"
},
{
"input": "100\n4 4 2 5 4 2 2 3 4 4 3 2 3 3 1 3 4 3 3 4 1 3 1 4 5 3 4 3 1 1 1 3 3 2 3 4 3 4 2 2 1 5 1 4 5 1 1 1 3 3 1 1 3 2 5 4 2 5 2 4 5 4 4 1 1 2 1 1 4 5 1 1 5 3 3 2 5 5 5 1 4 1 4 1 1 3 2 3 4 4 2 5 5 2 5 1 1 3 5 3",
"output": "5"
},
{
"input": "100\n4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 4",
"output": "4"
},
{
"input": "100\n5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5",
"output": "5"
}
] | 1,606,199,335
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 216
| 307,200
|
n = int(input())
f = list(map(int,input().split()))
fr = len(f)+1
ways = [1,2,3,4,5]
ss = sum(f)
r = list(range(1,ss+6))
for _ in range(0,len(r),fr):
r[_]=''
c = 0
for i in range(len(r)):
if r[i]!='' and r[i]>ss:
c+=1
print(c)
|
Title: Dima and Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima and his friends have been playing hide and seek at Dima's place all night. As a result, Dima's place got messy. In the morning they decided that they need to clean the place.
To decide who exactly would clean the apartment, the friends want to play a counting-out game. First, all the guys stand in a circle, and then each of them shows some number of fingers on one hand (one to five), and then the boys count in a circle, starting from Dima, the number of people, respective to the total number of fingers shown. The person on who the countdown stops will clean the apartment.
For example, if Dima and one of his friends played hide and seek, and 7 fingers were shown during the counting-out, then Dima would clean the place. If there were 2 or say, 8 fingers shown, then his friend would clean the place.
Dima knows how many fingers each of his friends will show during the counting-out. Now he is interested in the number of ways to show some number of fingers on one hand (one to five), so that he did not have to clean the place. Help Dima.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of Dima's friends. Dima himself isn't considered to be his own friend. The second line contains *n* positive integers, not exceeding 5, representing, how many fingers the Dima's friends will show.
The numbers in the lines are separated by a single space.
Output Specification:
In a single line print the answer to the problem.
Demo Input:
['1\n1\n', '1\n2\n', '2\n3 5\n']
Demo Output:
['3\n', '2\n', '3\n']
Note:
In the first sample Dima can show 1, 3 or 5 fingers. If Dima shows 3 fingers, then the counting-out will go like that: Dima, his friend, Dima, his friend.
In the second sample Dima can show 2 or 4 fingers.
|
```python
n = int(input())
f = list(map(int,input().split()))
fr = len(f)+1
ways = [1,2,3,4,5]
ss = sum(f)
r = list(range(1,ss+6))
for _ in range(0,len(r),fr):
r[_]=''
c = 0
for i in range(len(r)):
if r[i]!='' and r[i]>ss:
c+=1
print(c)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Andryusha goes through a park each day. The squares and paths between them look boring to Andryusha, so he decided to decorate them.
The park consists of *n* squares connected with (*n*<=-<=1) bidirectional paths in such a way that any square is reachable from any other using these paths. Andryusha decided to hang a colored balloon at each of the squares. The baloons' colors are described by positive integers, starting from 1. In order to make the park varicolored, Andryusha wants to choose the colors in a special way. More precisely, he wants to use such colors that if *a*, *b* and *c* are distinct squares that *a* and *b* have a direct path between them, and *b* and *c* have a direct path between them, then balloon colors on these three squares are distinct.
Andryusha wants to use as little different colors as possible. Help him to choose the colors!
|
The first line contains single integer *n* (3<=≤<=*n*<=≤<=2·105) — the number of squares in the park.
Each of the next (*n*<=-<=1) lines contains two integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*) — the indices of two squares directly connected by a path.
It is guaranteed that any square is reachable from any other using the paths.
|
In the first line print single integer *k* — the minimum number of colors Andryusha has to use.
In the second line print *n* integers, the *i*-th of them should be equal to the balloon color on the *i*-th square. Each of these numbers should be within range from 1 to *k*.
|
[
"3\n2 3\n1 3\n",
"5\n2 3\n5 3\n4 3\n1 3\n",
"5\n2 1\n3 2\n4 3\n5 4\n"
] |
[
"3\n1 3 2 ",
"5\n1 3 2 5 4 ",
"3\n1 2 3 1 2 "
] |
In the first sample the park consists of three squares: 1 → 3 → 2. Thus, the balloon colors have to be distinct.
In the second example there are following triples of consequently connected squares:
- 1 → 3 → 2 - 1 → 3 → 4 - 1 → 3 → 5 - 2 → 3 → 4 - 2 → 3 → 5 - 4 → 3 → 5
In the third example there are following triples:
- 1 → 2 → 3 - 2 → 3 → 4 - 3 → 4 → 5
| 0
|
[
{
"input": "3\n2 3\n1 3",
"output": "3\n1 3 2 "
},
{
"input": "5\n2 3\n5 3\n4 3\n1 3",
"output": "5\n1 3 2 5 4 "
},
{
"input": "5\n2 1\n3 2\n4 3\n5 4",
"output": "3\n1 2 3 1 2 "
},
{
"input": "10\n5 3\n9 2\n7 1\n3 8\n4 1\n1 9\n10 1\n8 9\n6 2",
"output": "5\n1 2 1 3 2 1 2 3 4 5 "
},
{
"input": "3\n2 1\n3 2",
"output": "3\n1 2 3 "
},
{
"input": "10\n2 7\n8 2\n9 8\n1 9\n4 1\n3 4\n6 3\n10 6\n5 10",
"output": "3\n1 1 2 3 2 1 2 3 2 3 "
},
{
"input": "5\n4 2\n3 1\n3 4\n3 5",
"output": "4\n1 1 2 3 4 "
},
{
"input": "7\n3 6\n3 1\n3 2\n3 5\n3 4\n3 7",
"output": "7\n1 4 2 6 5 3 7 "
},
{
"input": "10\n8 6\n10 5\n8 4\n2 7\n3 8\n10 3\n3 9\n2 1\n3 2",
"output": "5\n1 2 4 3 1 2 3 1 5 3 "
},
{
"input": "50\n45 2\n4 48\n16 4\n17 29\n29 33\n31 2\n47 41\n41 33\n22 6\n44 40\n32 24\n12 40\n28 16\n18 30\n20 41\n25 45\n35 29\n10 32\n1 48\n15 50\n6 9\n43 2\n33 2\n38 33\n8 2\n36 7\n26 48\n50 8\n34 31\n48 33\n13 45\n37 33\n7 6\n40 32\n3 6\n30 49\n49 33\n11 40\n19 40\n24 2\n14 50\n5 50\n42 16\n23 2\n9 45\n39 6\n46 48\n27 13\n21 2",
"output": "9\n1 4 4 3 4 2 3 6 5 2 5 4 3 3 2 1 2 2 6 2 9 1 8 7 2 4 2 2 1 1 2 1 5 1 3 1 7 6 6 3 3 4 3 2 1 6 1 2 8 1 "
},
{
"input": "50\n8 37\n40 8\n38 40\n10 38\n29 10\n33 29\n17 33\n25 17\n19 25\n3 19\n13 3\n24 13\n12 24\n5 12\n41 5\n11 41\n27 11\n45 27\n6 45\n35 6\n9 35\n50 9\n32 50\n21 32\n22 21\n1 22\n31 1\n28 31\n4 28\n30 4\n7 30\n48 7\n46 48\n16 46\n49 16\n39 49\n18 39\n14 18\n34 14\n23 34\n20 23\n15 20\n44 15\n42 44\n2 42\n36 2\n43 36\n26 43\n47 26",
"output": "3\n1 3 2 1 1 2 2 2 3 2 2 2 1 1 3 2 2 2 3 1 3 2 2 3 1 3 1 2 1 3 3 1 3 3 1 2 3 3 3 1 3 1 1 2 3 3 2 1 1 2 "
},
{
"input": "50\n7 5\n6 40\n49 43\n48 2\n44 11\n10 3\n46 49\n22 18\n17 33\n4 29\n48 4\n47 41\n24 19\n48 8\n1 21\n2 17\n17 34\n16 10\n17 20\n1 22\n44 32\n6 28\n7 1\n47 26\n28 44\n23 50\n21 15\n1 30\n7 27\n28 25\n17 23\n14 42\n6 46\n5 24\n44 9\n25 39\n46 47\n21 35\n7 16\n34 12\n45 14\n35 36\n28 13\n6 48\n46 37\n39 45\n40 7\n2 31\n30 38",
"output": "6\n1 2 2 3 2 1 4 5 5 1 1 2 5 3 3 5 1 2 3 5 2 3 6 1 4 2 3 2 1 5 3 4 3 4 4 1 5 2 1 6 1 1 1 3 2 3 4 4 2 2 "
}
] | 1,488,722,502
| 3,402
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 40
| 2,000
| 56,115,200
|
import sys
def input():
return sys.stdin.readline()
n = int(input())
colors = [0 for _ in range(n+1)]
children = [list() for _ in range(n+1)]
for _ in range(n-1):
a, b = map(int, input().split())
children[a].append(b)
children[b].append(a)
# находим какую-нибудь вершину с одним ребенком
# она гарантированно существует
start = 0
for i in range(1, n+1):
if len(children[i]) == 1:
start = i
break
colors[start] = 1
colors[children[start][0]] = 2
node = children[start][0]
Q = [node]
while len(Q):
nd = Q.pop()
banned_colors = [colors[nd]]
for c in children[nd]:
if colors[c] != 0:
banned_colors.append(colors[c])
for c in children[nd]:
if colors[c] == 0:
t = 0
for i in range(1, n+1):
if i not in banned_colors:
t = i
break
colors[c] = t
banned_colors.append(t)
Q.append(c)
print(max(colors))
print(*colors[1:], sep=' ')
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andryusha goes through a park each day. The squares and paths between them look boring to Andryusha, so he decided to decorate them.
The park consists of *n* squares connected with (*n*<=-<=1) bidirectional paths in such a way that any square is reachable from any other using these paths. Andryusha decided to hang a colored balloon at each of the squares. The baloons' colors are described by positive integers, starting from 1. In order to make the park varicolored, Andryusha wants to choose the colors in a special way. More precisely, he wants to use such colors that if *a*, *b* and *c* are distinct squares that *a* and *b* have a direct path between them, and *b* and *c* have a direct path between them, then balloon colors on these three squares are distinct.
Andryusha wants to use as little different colors as possible. Help him to choose the colors!
Input Specification:
The first line contains single integer *n* (3<=≤<=*n*<=≤<=2·105) — the number of squares in the park.
Each of the next (*n*<=-<=1) lines contains two integers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*) — the indices of two squares directly connected by a path.
It is guaranteed that any square is reachable from any other using the paths.
Output Specification:
In the first line print single integer *k* — the minimum number of colors Andryusha has to use.
In the second line print *n* integers, the *i*-th of them should be equal to the balloon color on the *i*-th square. Each of these numbers should be within range from 1 to *k*.
Demo Input:
['3\n2 3\n1 3\n', '5\n2 3\n5 3\n4 3\n1 3\n', '5\n2 1\n3 2\n4 3\n5 4\n']
Demo Output:
['3\n1 3 2 ', '5\n1 3 2 5 4 ', '3\n1 2 3 1 2 ']
Note:
In the first sample the park consists of three squares: 1 → 3 → 2. Thus, the balloon colors have to be distinct.
In the second example there are following triples of consequently connected squares:
- 1 → 3 → 2 - 1 → 3 → 4 - 1 → 3 → 5 - 2 → 3 → 4 - 2 → 3 → 5 - 4 → 3 → 5
In the third example there are following triples:
- 1 → 2 → 3 - 2 → 3 → 4 - 3 → 4 → 5
|
```python
import sys
def input():
return sys.stdin.readline()
n = int(input())
colors = [0 for _ in range(n+1)]
children = [list() for _ in range(n+1)]
for _ in range(n-1):
a, b = map(int, input().split())
children[a].append(b)
children[b].append(a)
# находим какую-нибудь вершину с одним ребенком
# она гарантированно существует
start = 0
for i in range(1, n+1):
if len(children[i]) == 1:
start = i
break
colors[start] = 1
colors[children[start][0]] = 2
node = children[start][0]
Q = [node]
while len(Q):
nd = Q.pop()
banned_colors = [colors[nd]]
for c in children[nd]:
if colors[c] != 0:
banned_colors.append(colors[c])
for c in children[nd]:
if colors[c] == 0:
t = 0
for i in range(1, n+1):
if i not in banned_colors:
t = i
break
colors[c] = t
banned_colors.append(t)
Q.append(c)
print(max(colors))
print(*colors[1:], sep=' ')
```
| 0
|
|
316
|
A2
|
Special Task
|
PROGRAMMING
| 1,400
|
[
"math"
] | null | null |
Special Agent Smart Beaver works in a secret research department of ABBYY. He's been working there for a long time and is satisfied with his job, as it allows him to eat out in the best restaurants and order the most expensive and exotic wood types there.
The content special agent has got an important task: to get the latest research by British scientists on the English Language. These developments are encoded and stored in a large safe. The Beaver's teeth are strong enough, so the authorities assured that upon arriving at the place the beaver won't have any problems with opening the safe.
And he finishes his aspen sprig and leaves for this important task. Of course, the Beaver arrived at the location without any problems, but alas. He can't open the safe with his strong and big teeth. At this point, the Smart Beaver get a call from the headquarters and learns that opening the safe with the teeth is not necessary, as a reliable source has sent the following information: the safe code consists of digits and has no leading zeroes. There also is a special hint, which can be used to open the safe. The hint is string *s* with the following structure:
- if *s**i* = "?", then the digit that goes *i*-th in the safe code can be anything (between 0 to 9, inclusively); - if *s**i* is a digit (between 0 to 9, inclusively), then it means that there is digit *s**i* on position *i* in code; - if the string contains letters from "A" to "J", then all positions with the same letters must contain the same digits and the positions with distinct letters must contain distinct digits. - The length of the safe code coincides with the length of the hint.
For example, hint "?JGJ9" has such matching safe code variants: "51919", "55959", "12329", "93539" and so on, and has wrong variants such as: "56669", "00111", "03539" and "13666".
After receiving such information, the authorities change the plan and ask the special agents to work quietly and gently and not to try to open the safe by mechanical means, and try to find the password using the given hint.
At a special agent school the Smart Beaver was the fastest in his platoon finding codes for such safes, but now he is not in that shape: the years take their toll ... Help him to determine the number of possible variants of the code to the safe, matching the given hint. After receiving this information, and knowing his own speed of entering codes, the Smart Beaver will be able to determine whether he will have time for tonight's show "Beavers are on the trail" on his favorite TV channel, or he should work for a sleepless night...
|
The first line contains string *s* — the hint to the safe code. String *s* consists of the following characters: ?, 0-9, A-J. It is guaranteed that the first character of string *s* doesn't equal to character 0.
The input limits for scoring 30 points are (subproblem A1):
- 1<=≤<=|*s*|<=≤<=5.
The input limits for scoring 100 points are (subproblems A1+A2):
- 1<=≤<=|*s*|<=≤<=105.
Here |*s*| means the length of string *s*.
|
Print the number of codes that match the given hint.
|
[
"AJ\n",
"1?AA\n"
] |
[
"81\n",
"100\n"
] |
none
| 70
|
[
{
"input": "AJ",
"output": "81"
},
{
"input": "1?AA",
"output": "100"
},
{
"input": "?",
"output": "9"
},
{
"input": "7",
"output": "1"
},
{
"input": "A",
"output": "9"
},
{
"input": "BBB?",
"output": "90"
},
{
"input": "BC??",
"output": "8100"
},
{
"input": "CC",
"output": "9"
},
{
"input": "CB?",
"output": "810"
},
{
"input": "B??C?",
"output": "81000"
},
{
"input": "BB?C?",
"output": "8100"
},
{
"input": "?BCB?",
"output": "8100"
},
{
"input": "?C",
"output": "90"
},
{
"input": "??C?C",
"output": "9000"
},
{
"input": "???2",
"output": "900"
},
{
"input": "9???",
"output": "1000"
},
{
"input": "GJH2?",
"output": "6480"
},
{
"input": "7I9G4",
"output": "90"
},
{
"input": "JG50?",
"output": "810"
},
{
"input": "CDEFG",
"output": "27216"
},
{
"input": "1023456789??????????????????????????????????????ABCDIFGHIJ",
"output": "362880000000000000000000000000000000000000000"
}
] | 1,589,818,969
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS2
| 23
| 1,000
| 307,200
|
a=input()
s={x for x in a if ord(x)>64}
r=10**a.count('?')
for i in range(len(s)):r*=10-i
if ord(a[0])>57:r=r//10*9
print(r)
|
Title: Special Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Special Agent Smart Beaver works in a secret research department of ABBYY. He's been working there for a long time and is satisfied with his job, as it allows him to eat out in the best restaurants and order the most expensive and exotic wood types there.
The content special agent has got an important task: to get the latest research by British scientists on the English Language. These developments are encoded and stored in a large safe. The Beaver's teeth are strong enough, so the authorities assured that upon arriving at the place the beaver won't have any problems with opening the safe.
And he finishes his aspen sprig and leaves for this important task. Of course, the Beaver arrived at the location without any problems, but alas. He can't open the safe with his strong and big teeth. At this point, the Smart Beaver get a call from the headquarters and learns that opening the safe with the teeth is not necessary, as a reliable source has sent the following information: the safe code consists of digits and has no leading zeroes. There also is a special hint, which can be used to open the safe. The hint is string *s* with the following structure:
- if *s**i* = "?", then the digit that goes *i*-th in the safe code can be anything (between 0 to 9, inclusively); - if *s**i* is a digit (between 0 to 9, inclusively), then it means that there is digit *s**i* on position *i* in code; - if the string contains letters from "A" to "J", then all positions with the same letters must contain the same digits and the positions with distinct letters must contain distinct digits. - The length of the safe code coincides with the length of the hint.
For example, hint "?JGJ9" has such matching safe code variants: "51919", "55959", "12329", "93539" and so on, and has wrong variants such as: "56669", "00111", "03539" and "13666".
After receiving such information, the authorities change the plan and ask the special agents to work quietly and gently and not to try to open the safe by mechanical means, and try to find the password using the given hint.
At a special agent school the Smart Beaver was the fastest in his platoon finding codes for such safes, but now he is not in that shape: the years take their toll ... Help him to determine the number of possible variants of the code to the safe, matching the given hint. After receiving this information, and knowing his own speed of entering codes, the Smart Beaver will be able to determine whether he will have time for tonight's show "Beavers are on the trail" on his favorite TV channel, or he should work for a sleepless night...
Input Specification:
The first line contains string *s* — the hint to the safe code. String *s* consists of the following characters: ?, 0-9, A-J. It is guaranteed that the first character of string *s* doesn't equal to character 0.
The input limits for scoring 30 points are (subproblem A1):
- 1<=≤<=|*s*|<=≤<=5.
The input limits for scoring 100 points are (subproblems A1+A2):
- 1<=≤<=|*s*|<=≤<=105.
Here |*s*| means the length of string *s*.
Output Specification:
Print the number of codes that match the given hint.
Demo Input:
['AJ\n', '1?AA\n']
Demo Output:
['81\n', '100\n']
Note:
none
|
```python
a=input()
s={x for x in a if ord(x)>64}
r=10**a.count('?')
for i in range(len(s)):r*=10-i
if ord(a[0])>57:r=r//10*9
print(r)
```
| 0
|
|
3
|
A
|
Shortest path of the king
|
PROGRAMMING
| 1,000
|
[
"greedy",
"shortest paths"
] |
A. Shortest path of the king
|
1
|
64
|
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this.
In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
|
The first line contains the chessboard coordinates of square *s*, the second line — of square *t*.
Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
|
In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD.
L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
|
[
"a8\nh1\n"
] |
[
"7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n"
] |
none
| 0
|
[
{
"input": "a8\nh1",
"output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD"
},
{
"input": "b2\nb4",
"output": "2\nU\nU"
},
{
"input": "a5\na5",
"output": "0"
},
{
"input": "h1\nb2",
"output": "6\nLU\nL\nL\nL\nL\nL"
},
{
"input": "c5\nh2",
"output": "5\nRD\nRD\nRD\nR\nR"
},
{
"input": "e1\nf2",
"output": "1\nRU"
},
{
"input": "g4\nd2",
"output": "3\nLD\nLD\nL"
},
{
"input": "a8\nb2",
"output": "6\nRD\nD\nD\nD\nD\nD"
},
{
"input": "d4\nh2",
"output": "4\nRD\nRD\nR\nR"
},
{
"input": "c5\na2",
"output": "3\nLD\nLD\nD"
},
{
"input": "h5\nf8",
"output": "3\nLU\nLU\nU"
},
{
"input": "e6\nb6",
"output": "3\nL\nL\nL"
},
{
"input": "a6\ng4",
"output": "6\nRD\nRD\nR\nR\nR\nR"
},
{
"input": "f7\nc2",
"output": "5\nLD\nLD\nLD\nD\nD"
},
{
"input": "b7\nh8",
"output": "6\nRU\nR\nR\nR\nR\nR"
},
{
"input": "g7\nd6",
"output": "3\nLD\nL\nL"
},
{
"input": "c8\na3",
"output": "5\nLD\nLD\nD\nD\nD"
},
{
"input": "h8\nf1",
"output": "7\nLD\nLD\nD\nD\nD\nD\nD"
},
{
"input": "d1\nb7",
"output": "6\nLU\nLU\nU\nU\nU\nU"
},
{
"input": "a7\ne5",
"output": "4\nRD\nRD\nR\nR"
},
{
"input": "d6\nb1",
"output": "5\nLD\nLD\nD\nD\nD"
},
{
"input": "f5\ng5",
"output": "1\nR"
},
{
"input": "h4\nd1",
"output": "4\nLD\nLD\nLD\nL"
},
{
"input": "b3\na5",
"output": "2\nLU\nU"
},
{
"input": "d2\nf1",
"output": "2\nRD\nR"
},
{
"input": "f1\nc5",
"output": "4\nLU\nLU\nLU\nU"
},
{
"input": "a8\nh1",
"output": "7\nRD\nRD\nRD\nRD\nRD\nRD\nRD"
},
{
"input": "c7\ne5",
"output": "2\nRD\nRD"
},
{
"input": "e7\nb1",
"output": "6\nLD\nLD\nLD\nD\nD\nD"
},
{
"input": "g8\na8",
"output": "6\nL\nL\nL\nL\nL\nL"
},
{
"input": "g6\nf2",
"output": "4\nLD\nD\nD\nD"
},
{
"input": "g4\nc4",
"output": "4\nL\nL\nL\nL"
},
{
"input": "g2\na6",
"output": "6\nLU\nLU\nLU\nLU\nL\nL"
},
{
"input": "f8\nf8",
"output": "0"
},
{
"input": "f5\nd2",
"output": "3\nLD\nLD\nD"
}
] | 1,618,193,530
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 122
| 0
|
start = input()
end = input()
alist = ('a', 'b', 'c', 'd', 'e', 'f', 'g', 'h')
startx = alist.index(start[0]) + 1
endx = alist.index(end[0]) + 1
starty = int(start[1])
endy = int(end[1])
xdirection = 0
ydirection = 0
xtimes = 0
ytimes = 0
outputlist = []
if startx > endx:
xdirection = 'L'
xtimes = startx - endx
elif startx < endx:
xdirection = 'R'
xtimes = endx - startx
if starty > endy:
ydirection = 'D'
ytimes = starty - endy
elif starty < endy:
ytimes = endy - starty
ydirection = 'U'
if xtimes == ytimes:
outputlist.append(ytimes)
for x in range(xtimes):
outputlist.append(xdirection + ydirection)
elif xtimes < ytimes:
outputlist.append(xtimes + ytimes)
for x in range(xtimes):
outputlist.append(xdirection + ydirection)
for x in range(ytimes - xtimes):
outputlist.append(ydirection)
elif xtimes > ytimes:
outputlist.append(xtimes + ytimes)
for x in range(ytimes):
outputlist.append(xdirection + ydirection)
for x in range(xtimes - ytimes):
outputlist.append(ydirection)
for x in outputlist:
print(x)
|
Title: Shortest path of the king
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The king is left alone on the chessboard. In spite of this loneliness, he doesn't lose heart, because he has business of national importance. For example, he has to pay an official visit to square *t*. As the king is not in habit of wasting his time, he wants to get from his current position *s* to square *t* in the least number of moves. Help him to do this.
In one move the king can get to the square that has a common side or a common vertex with the square the king is currently in (generally there are 8 different squares he can move to).
Input Specification:
The first line contains the chessboard coordinates of square *s*, the second line — of square *t*.
Chessboard coordinates consist of two characters, the first one is a lowercase Latin letter (from a to h), the second one is a digit from 1 to 8.
Output Specification:
In the first line print *n* — minimum number of the king's moves. Then in *n* lines print the moves themselves. Each move is described with one of the 8: L, R, U, D, LU, LD, RU or RD.
L, R, U, D stand respectively for moves left, right, up and down (according to the picture), and 2-letter combinations stand for diagonal moves. If the answer is not unique, print any of them.
Demo Input:
['a8\nh1\n']
Demo Output:
['7\nRD\nRD\nRD\nRD\nRD\nRD\nRD\n']
Note:
none
|
```python
start = input()
end = input()
alist = ('a', 'b', 'c', 'd', 'e', 'f', 'g', 'h')
startx = alist.index(start[0]) + 1
endx = alist.index(end[0]) + 1
starty = int(start[1])
endy = int(end[1])
xdirection = 0
ydirection = 0
xtimes = 0
ytimes = 0
outputlist = []
if startx > endx:
xdirection = 'L'
xtimes = startx - endx
elif startx < endx:
xdirection = 'R'
xtimes = endx - startx
if starty > endy:
ydirection = 'D'
ytimes = starty - endy
elif starty < endy:
ytimes = endy - starty
ydirection = 'U'
if xtimes == ytimes:
outputlist.append(ytimes)
for x in range(xtimes):
outputlist.append(xdirection + ydirection)
elif xtimes < ytimes:
outputlist.append(xtimes + ytimes)
for x in range(xtimes):
outputlist.append(xdirection + ydirection)
for x in range(ytimes - xtimes):
outputlist.append(ydirection)
elif xtimes > ytimes:
outputlist.append(xtimes + ytimes)
for x in range(ytimes):
outputlist.append(xdirection + ydirection)
for x in range(xtimes - ytimes):
outputlist.append(ydirection)
for x in outputlist:
print(x)
```
| 0
|
483
|
A
|
Counterexample
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math",
"number theory"
] | null | null |
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
|
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
|
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
|
[
"2 4\n",
"10 11\n",
"900000000000000009 900000000000000029\n"
] |
[
"2 3 4\n",
"-1\n",
"900000000000000009 900000000000000010 900000000000000021\n"
] |
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
| 500
|
[
{
"input": "2 4",
"output": "2 3 4"
},
{
"input": "10 11",
"output": "-1"
},
{
"input": "900000000000000009 900000000000000029",
"output": "900000000000000009 900000000000000010 900000000000000021"
},
{
"input": "640097987171091791 640097987171091835",
"output": "640097987171091792 640097987171091793 640097987171091794"
},
{
"input": "19534350415104721 19534350415104725",
"output": "19534350415104722 19534350415104723 19534350415104724"
},
{
"input": "933700505788726243 933700505788726280",
"output": "933700505788726244 933700505788726245 933700505788726246"
},
{
"input": "1 3",
"output": "-1"
},
{
"input": "1 4",
"output": "2 3 4"
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "266540997167959130 266540997167959164",
"output": "266540997167959130 266540997167959131 266540997167959132"
},
{
"input": "267367244641009850 267367244641009899",
"output": "267367244641009850 267367244641009851 267367244641009852"
},
{
"input": "268193483524125978 268193483524125993",
"output": "268193483524125978 268193483524125979 268193483524125980"
},
{
"input": "269019726702209402 269019726702209432",
"output": "269019726702209402 269019726702209403 269019726702209404"
},
{
"input": "269845965585325530 269845965585325576",
"output": "269845965585325530 269845965585325531 269845965585325532"
},
{
"input": "270672213058376250 270672213058376260",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492378",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608523",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691962",
"output": "273150934002691930 273150934002691931 273150934002691932"
},
{
"input": "996517375802030516 996517375802030524",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146694",
"output": "997343614685146644 997343614685146645 997343614685146646"
},
{
"input": "998169857863230068 998169857863230083",
"output": "998169857863230068 998169857863230069 998169857863230070"
},
{
"input": "998996101041313492 998996101041313522",
"output": "998996101041313492 998996101041313493 998996101041313494"
},
{
"input": "999822344219396916 999822344219396961",
"output": "999822344219396916 999822344219396917 999822344219396918"
},
{
"input": "648583102513043 648583102513053",
"output": "648583102513044 648583102513045 648583102513046"
},
{
"input": "266540997167959130 266540997167959131",
"output": "-1"
},
{
"input": "267367244641009850 267367244641009850",
"output": "-1"
},
{
"input": "268193483524125978 268193483524125979",
"output": "-1"
},
{
"input": "269019726702209402 269019726702209402",
"output": "-1"
},
{
"input": "269845965585325530 269845965585325530",
"output": "-1"
},
{
"input": "270672213058376250 270672213058376254",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492379",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608508",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691931",
"output": "-1"
},
{
"input": "996517375802030516 996517375802030518",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146644",
"output": "-1"
},
{
"input": "2147483647 2147483649",
"output": "-1"
},
{
"input": "3 5",
"output": "-1"
},
{
"input": "1 7",
"output": "2 3 4"
},
{
"input": "9 12",
"output": "9 11 12"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "11 13",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
}
] | 1,610,023,289
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 108
| 0
|
l, r = map(int, input().split())
if r == l + 1 or r == l:
print(-1)
elif l%2 == 0:
print(l, l+1, l+2)
elif abs(r - l) > 3:
print(l+1, l+2, l+3)
else:
print(-1)
|
Title: Counterexample
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
Input Specification:
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
Output Specification:
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
Demo Input:
['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n']
Demo Output:
['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n']
Note:
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
|
```python
l, r = map(int, input().split())
if r == l + 1 or r == l:
print(-1)
elif l%2 == 0:
print(l, l+1, l+2)
elif abs(r - l) > 3:
print(l+1, l+2, l+3)
else:
print(-1)
```
| 0
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,693,801,405
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 92
| 0
|
N,M = map(int,input().split())
res = M*N
print(int(res/2))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
N,M = map(int,input().split())
res = M*N
print(int(res/2))
```
| 3.977
|
393
|
A
|
Nineteen
|
PROGRAMMING
| 0
|
[] | null | null |
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
|
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
|
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
|
[
"nniinneetteeeenn\n",
"nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n",
"nineteenineteen\n"
] |
[
"2",
"2",
"2"
] |
none
| 500
|
[
{
"input": "nniinneetteeeenn",
"output": "2"
},
{
"input": "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii",
"output": "2"
},
{
"input": "nineteenineteen",
"output": "2"
},
{
"input": "nssemsnnsitjtihtthij",
"output": "0"
},
{
"input": "eehihnttehtherjsihihnrhimihrjinjiehmtjimnrss",
"output": "1"
},
{
"input": "rrrteiehtesisntnjirtitijnjjjthrsmhtneirjimniemmnrhirssjnhetmnmjejjnjjritjttnnrhnjs",
"output": "2"
},
{
"input": "mmrehtretseihsrjmtsenemniehssnisijmsnntesismmtmthnsieijjjnsnhisi",
"output": "2"
},
{
"input": "hshretttnntmmiertrrnjihnrmshnthirnnirrheinnnrjiirshthsrsijtrrtrmnjrrjnresnintnmtrhsnjrinsseimn",
"output": "1"
},
{
"input": "snmmensntritetnmmmerhhrmhnehehtesmhthseemjhmnrti",
"output": "2"
},
{
"input": "rmeetriiitijmrenmeiijt",
"output": "0"
},
{
"input": "ihimeitimrmhriemsjhrtjtijtesmhemnmmrsetmjttthtjhnnmirtimne",
"output": "1"
},
{
"input": "rhtsnmnesieernhstjnmmirthhieejsjttsiierhihhrrijhrrnejsjer",
"output": "2"
},
{
"input": "emmtjsjhretehmiiiestmtmnmissjrstnsnjmhimjmststsitemtttjrnhsrmsenjtjim",
"output": "2"
},
{
"input": "nmehhjrhirniitshjtrrtitsjsntjhrstjehhhrrerhemehjeermhmhjejjesnhsiirheijjrnrjmminneeehtm",
"output": "3"
},
{
"input": "hsntijjetmehejtsitnthietssmeenjrhhetsnjrsethisjrtrhrierjtmimeenjnhnijeesjttrmn",
"output": "3"
},
{
"input": "jnirirhmirmhisemittnnsmsttesjhmjnsjsmntisheneiinsrjsjirnrmnjmjhmistntersimrjni",
"output": "1"
},
{
"input": "neithjhhhtmejjnmieishethmtetthrienrhjmjenrmtejerernmthmsnrthhtrimmtmshm",
"output": "2"
},
{
"input": "sithnrsnemhijsnjitmijjhejjrinejhjinhtisttteermrjjrtsirmessejireihjnnhhemiirmhhjeet",
"output": "3"
},
{
"input": "jrjshtjstteh",
"output": "0"
},
{
"input": "jsihrimrjnnmhttmrtrenetimemjnshnimeiitmnmjishjjneisesrjemeshjsijithtn",
"output": "2"
},
{
"input": "hhtjnnmsemermhhtsstejehsssmnesereehnnsnnremjmmieethmirjjhn",
"output": "2"
},
{
"input": "tmnersmrtsehhntsietttrehrhneiireijnijjejmjhei",
"output": "1"
},
{
"input": "mtstiresrtmesritnjriirehtermtrtseirtjrhsejhhmnsineinsjsin",
"output": "2"
},
{
"input": "ssitrhtmmhtnmtreijteinimjemsiiirhrttinsnneshintjnin",
"output": "1"
},
{
"input": "rnsrsmretjiitrjthhritniijhjmm",
"output": "0"
},
{
"input": "hntrteieimrimteemenserntrejhhmijmtjjhnsrsrmrnsjseihnjmehtthnnithirnhj",
"output": "3"
},
{
"input": "nmmtsmjrntrhhtmimeresnrinstjnhiinjtnjjjnthsintmtrhijnrnmtjihtinmni",
"output": "0"
},
{
"input": "eihstiirnmteejeehimttrijittjsntjejmessstsemmtristjrhenithrrsssihnthheehhrnmimssjmejjreimjiemrmiis",
"output": "2"
},
{
"input": "srthnimimnemtnmhsjmmmjmmrsrisehjseinemienntetmitjtnnneseimhnrmiinsismhinjjnreehseh",
"output": "3"
},
{
"input": "etrsmrjehntjjimjnmsresjnrthjhehhtreiijjminnheeiinseenmmethiemmistsei",
"output": "3"
},
{
"input": "msjeshtthsieshejsjhsnhejsihisijsertenrshhrthjhiirijjneinjrtrmrs",
"output": "1"
},
{
"input": "mehsmstmeejrhhsjihntjmrjrihssmtnensttmirtieehimj",
"output": "1"
},
{
"input": "mmmsermimjmrhrhejhrrejermsneheihhjemnehrhihesnjsehthjsmmjeiejmmnhinsemjrntrhrhsmjtttsrhjjmejj",
"output": "2"
},
{
"input": "rhsmrmesijmmsnsmmhertnrhsetmisshriirhetmjihsmiinimtrnitrseii",
"output": "1"
},
{
"input": "iihienhirmnihh",
"output": "0"
},
{
"input": "ismtthhshjmhisssnmnhe",
"output": "0"
},
{
"input": "rhsmnrmhejshinnjrtmtsssijimimethnm",
"output": "0"
},
{
"input": "eehnshtiriejhiirntminrirnjihmrnittnmmnjejjhjtennremrnssnejtntrtsiejjijisermj",
"output": "3"
},
{
"input": "rnhmeesnhttrjintnhnrhristjrthhrmehrhjmjhjehmstrijemjmmistes",
"output": "2"
},
{
"input": "ssrmjmjeeetrnimemrhimes",
"output": "0"
},
{
"input": "n",
"output": "0"
},
{
"input": "ni",
"output": "0"
},
{
"input": "nine",
"output": "0"
},
{
"input": "nineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteen",
"output": "13"
},
{
"input": "ninetee",
"output": "0"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwynd",
"output": "0"
},
{
"input": "zenudggmyopddhszhrbmftgzmjorabhgojdtfnzxjkayjlkgczsyshczutkdch",
"output": "0"
},
{
"input": "rtzxovxqfapkdmelxiyjroohufhbakpmmvaxq",
"output": "0"
},
{
"input": "zninetneeineteeniwnteeennieteenineteenineteenineteenineteenineteenineteenineteenineteeninetzeenz",
"output": "13"
},
{
"input": "nnnnnnniiiiiiiiiiiitttttttttteeeeeeeeeeeeeeeeee",
"output": "3"
},
{
"input": "ttttiiiieeeeeeeeeeeennnnnnnnn",
"output": "4"
},
{
"input": "ttttttttteeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiinnnnnnn",
"output": "3"
},
{
"input": "nnnnnnnnnneeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiiiiitttttttttttttttttttt",
"output": "4"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiittttttttttttttttnnnnnnn",
"output": "3"
},
{
"input": "nineeen",
"output": "0"
},
{
"input": "nineteeeeeeeeeeeeeeeeettttttttttttttttttiiiiiiiiiiiiiiiiii",
"output": "0"
},
{
"input": "nineteenieteenieteenieteenieteenieteenieteen",
"output": "4"
},
{
"input": "nineteenineteenineteenineteenineteen",
"output": "5"
}
] | 1,576,328,150
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 140
| 0
|
s = input()
def f(s):
n = 0
i = 0
e = 0
t = 0
for j in s:
if j == 'n':
n += 1
elif j == 'i':
i += 1
elif j == 'e':
e += 1
elif j == 't':
t += 1
r = n - n // 2
n = n // 2
e == e // 3
if r == 0:
print(min(n, i, e, t) - 1)
else:
print(min(n, i, e, t))
# f("nineteenineteen")
# f("nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii")
# f("nniinneetteeeenn")
f(s)
|
Title: Nineteen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
Input Specification:
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
Output Specification:
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
Demo Input:
['nniinneetteeeenn\n', 'nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n', 'nineteenineteen\n']
Demo Output:
['2', '2', '2']
Note:
none
|
```python
s = input()
def f(s):
n = 0
i = 0
e = 0
t = 0
for j in s:
if j == 'n':
n += 1
elif j == 'i':
i += 1
elif j == 'e':
e += 1
elif j == 't':
t += 1
r = n - n // 2
n = n // 2
e == e // 3
if r == 0:
print(min(n, i, e, t) - 1)
else:
print(min(n, i, e, t))
# f("nineteenineteen")
# f("nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii")
# f("nniinneetteeeenn")
f(s)
```
| 0
|
|
129
|
A
|
Cookies
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
|
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
|
[
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] |
[
"1\n",
"8\n",
"1\n"
] |
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
| 500
|
[
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,653,550,797
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 52
| 92
| 0
|
n = int(input())
a = list(map(int, input().split(' ')))
Sum = 0
Max = 0
for i in range(n):
Sum+=a[i]
k = 0
a = sorted(a)
if Sum%2 == 0:
for i in range(n):
if a[i]%2 == 0:
k+=1
else:
for i in range(n):
if a[i]%2 != 0:
k+=1
print(k)
|
Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies.
|
```python
n = int(input())
a = list(map(int, input().split(' ')))
Sum = 0
Max = 0
for i in range(n):
Sum+=a[i]
k = 0
a = sorted(a)
if Sum%2 == 0:
for i in range(n):
if a[i]%2 == 0:
k+=1
else:
for i in range(n):
if a[i]%2 != 0:
k+=1
print(k)
```
| 3
|
|
486
|
A
|
Calculating Function
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
For a positive integer *n* let's define a function *f*:
*f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n*
Your task is to calculate *f*(*n*) for a given integer *n*.
|
The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015).
|
Print *f*(*n*) in a single line.
|
[
"4\n",
"5\n"
] |
[
"2\n",
"-3\n"
] |
*f*(4) = - 1 + 2 - 3 + 4 = 2
*f*(5) = - 1 + 2 - 3 + 4 - 5 = - 3
| 500
|
[
{
"input": "4",
"output": "2"
},
{
"input": "5",
"output": "-3"
},
{
"input": "1000000000",
"output": "500000000"
},
{
"input": "1000000001",
"output": "-500000001"
},
{
"input": "1000000000000000",
"output": "500000000000000"
},
{
"input": "100",
"output": "50"
},
{
"input": "101",
"output": "-51"
},
{
"input": "102",
"output": "51"
},
{
"input": "103",
"output": "-52"
},
{
"input": "104",
"output": "52"
},
{
"input": "105",
"output": "-53"
},
{
"input": "106",
"output": "53"
},
{
"input": "107",
"output": "-54"
},
{
"input": "108",
"output": "54"
},
{
"input": "109",
"output": "-55"
},
{
"input": "208170109961052",
"output": "104085054980526"
},
{
"input": "46017661651072",
"output": "23008830825536"
},
{
"input": "4018154546667",
"output": "-2009077273334"
},
{
"input": "288565475053",
"output": "-144282737527"
},
{
"input": "3052460231",
"output": "-1526230116"
},
{
"input": "29906716",
"output": "14953358"
},
{
"input": "87897701693326",
"output": "43948850846663"
},
{
"input": "8240",
"output": "4120"
},
{
"input": "577935",
"output": "-288968"
},
{
"input": "62",
"output": "31"
},
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "1"
},
{
"input": "9999999999999",
"output": "-5000000000000"
},
{
"input": "1000000000000",
"output": "500000000000"
},
{
"input": "99999999999999",
"output": "-50000000000000"
},
{
"input": "999999999999999",
"output": "-500000000000000"
},
{
"input": "42191359342",
"output": "21095679671"
},
{
"input": "100000000000000",
"output": "50000000000000"
},
{
"input": "145645214654154",
"output": "72822607327077"
},
{
"input": "4294967296",
"output": "2147483648"
},
{
"input": "3037000499",
"output": "-1518500250"
},
{
"input": "10000000000001",
"output": "-5000000000001"
},
{
"input": "100000017040846",
"output": "50000008520423"
},
{
"input": "98979894985999",
"output": "-49489947493000"
}
] | 1,697,398,588
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 2
| 1,000
| 0
|
n = int(input())
total_sum = 0
for i in range(1, n + 1):
term = (-1) ** i * i
# Add the term to the total sum
total_sum += term
print(total_sum)
|
Title: Calculating Function
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For a positive integer *n* let's define a function *f*:
*f*(*n*)<==<=<=-<=1<=+<=2<=-<=3<=+<=..<=+<=(<=-<=1)*n**n*
Your task is to calculate *f*(*n*) for a given integer *n*.
Input Specification:
The single line contains the positive integer *n* (1<=≤<=*n*<=≤<=1015).
Output Specification:
Print *f*(*n*) in a single line.
Demo Input:
['4\n', '5\n']
Demo Output:
['2\n', '-3\n']
Note:
*f*(4) = - 1 + 2 - 3 + 4 = 2
*f*(5) = - 1 + 2 - 3 + 4 - 5 = - 3
|
```python
n = int(input())
total_sum = 0
for i in range(1, n + 1):
term = (-1) ** i * i
# Add the term to the total sum
total_sum += term
print(total_sum)
```
| 0
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integer — the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,614,367,726
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 62
| 0
|
s=input()
sum=0
for i in range(len(s)):
if s[i]=='Q':
for j in range(i,len(s),1):
if s[j]=='A':
for k in range(j,len(s),1):
if s[k]=='Q':
sum=sum+1
print(sum)
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
s=input()
sum=0
for i in range(len(s)):
if s[i]=='Q':
for j in range(i,len(s),1):
if s[j]=='A':
for k in range(j,len(s),1):
if s[k]=='Q':
sum=sum+1
print(sum)
```
| 3
|
|
483
|
A
|
Counterexample
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math",
"number theory"
] | null | null |
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
|
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
|
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
|
[
"2 4\n",
"10 11\n",
"900000000000000009 900000000000000029\n"
] |
[
"2 3 4\n",
"-1\n",
"900000000000000009 900000000000000010 900000000000000021\n"
] |
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
| 500
|
[
{
"input": "2 4",
"output": "2 3 4"
},
{
"input": "10 11",
"output": "-1"
},
{
"input": "900000000000000009 900000000000000029",
"output": "900000000000000009 900000000000000010 900000000000000021"
},
{
"input": "640097987171091791 640097987171091835",
"output": "640097987171091792 640097987171091793 640097987171091794"
},
{
"input": "19534350415104721 19534350415104725",
"output": "19534350415104722 19534350415104723 19534350415104724"
},
{
"input": "933700505788726243 933700505788726280",
"output": "933700505788726244 933700505788726245 933700505788726246"
},
{
"input": "1 3",
"output": "-1"
},
{
"input": "1 4",
"output": "2 3 4"
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "266540997167959130 266540997167959164",
"output": "266540997167959130 266540997167959131 266540997167959132"
},
{
"input": "267367244641009850 267367244641009899",
"output": "267367244641009850 267367244641009851 267367244641009852"
},
{
"input": "268193483524125978 268193483524125993",
"output": "268193483524125978 268193483524125979 268193483524125980"
},
{
"input": "269019726702209402 269019726702209432",
"output": "269019726702209402 269019726702209403 269019726702209404"
},
{
"input": "269845965585325530 269845965585325576",
"output": "269845965585325530 269845965585325531 269845965585325532"
},
{
"input": "270672213058376250 270672213058376260",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492378",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608523",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691962",
"output": "273150934002691930 273150934002691931 273150934002691932"
},
{
"input": "996517375802030516 996517375802030524",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146694",
"output": "997343614685146644 997343614685146645 997343614685146646"
},
{
"input": "998169857863230068 998169857863230083",
"output": "998169857863230068 998169857863230069 998169857863230070"
},
{
"input": "998996101041313492 998996101041313522",
"output": "998996101041313492 998996101041313493 998996101041313494"
},
{
"input": "999822344219396916 999822344219396961",
"output": "999822344219396916 999822344219396917 999822344219396918"
},
{
"input": "648583102513043 648583102513053",
"output": "648583102513044 648583102513045 648583102513046"
},
{
"input": "266540997167959130 266540997167959131",
"output": "-1"
},
{
"input": "267367244641009850 267367244641009850",
"output": "-1"
},
{
"input": "268193483524125978 268193483524125979",
"output": "-1"
},
{
"input": "269019726702209402 269019726702209402",
"output": "-1"
},
{
"input": "269845965585325530 269845965585325530",
"output": "-1"
},
{
"input": "270672213058376250 270672213058376254",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492379",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608508",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691931",
"output": "-1"
},
{
"input": "996517375802030516 996517375802030518",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146644",
"output": "-1"
},
{
"input": "2147483647 2147483649",
"output": "-1"
},
{
"input": "3 5",
"output": "-1"
},
{
"input": "1 7",
"output": "2 3 4"
},
{
"input": "9 12",
"output": "9 11 12"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "11 13",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
}
] | 1,619,083,216
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 93
| 0
|
# A. Counterexample
n,k=map(int,input().split())
if (n%2!=0):
n+=1
if k-n<2:
print(-1)
else:
print(n,n+1,n+2)
|
Title: Counterexample
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
Input Specification:
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
Output Specification:
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
Demo Input:
['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n']
Demo Output:
['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n']
Note:
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
|
```python
# A. Counterexample
n,k=map(int,input().split())
if (n%2!=0):
n+=1
if k-n<2:
print(-1)
else:
print(n,n+1,n+2)
```
| 3
|
|
91
|
A
|
Newspaper Headline
|
PROGRAMMING
| 1,500
|
[
"greedy",
"strings"
] |
A. Newspaper Headline
|
2
|
256
|
A newspaper is published in Walrusland. Its heading is *s*1, it consists of lowercase Latin letters. Fangy the little walrus wants to buy several such newspapers, cut out their headings, glue them one to another in order to get one big string. After that walrus erase several letters from this string in order to get a new word *s*2. It is considered that when Fangy erases some letter, there's no whitespace formed instead of the letter. That is, the string remains unbroken and it still only consists of lowercase Latin letters.
For example, the heading is "abc". If we take two such headings and glue them one to the other one, we get "abcabc". If we erase the letters on positions 1 and 5, we get a word "bcac".
Which least number of newspaper headings *s*1 will Fangy need to glue them, erase several letters and get word *s*2?
|
The input data contain two lines. The first line contain the heading *s*1, the second line contains the word *s*2. The lines only consist of lowercase Latin letters (1<=≤<=|*s*1|<=≤<=104,<=1<=≤<=|*s*2|<=≤<=106).
|
If it is impossible to get the word *s*2 in the above-described manner, print "-1" (without the quotes). Otherwise, print the least number of newspaper headings *s*1, which Fangy will need to receive the word *s*2.
|
[
"abc\nxyz\n",
"abcd\ndabc\n"
] |
[
"-1\n",
"2\n"
] |
none
| 500
|
[
{
"input": "abc\nxyz",
"output": "-1"
},
{
"input": "abcd\ndabc",
"output": "2"
},
{
"input": "ab\nbabaaab",
"output": "5"
},
{
"input": "ab\nbaaabba",
"output": "6"
},
{
"input": "fbaaigiihhfaahgdbddgeggjdeigfadhfddja\nhbghjgijijcdafcbgiedichdeebaddfddb",
"output": "-1"
},
{
"input": "ibifgcfdbfdhihbifageaaadegbfbhgeebgdgiafgedchdg\ndedfebcfdigdefdediigcfcafbhhiacgfbeccfchd",
"output": "7"
},
{
"input": "fcagdciidcedeaicgfffgjefaefaachfbfj\naiecchjehdgbjfcdjdefgfhiddjajeddiigidaibejabd",
"output": "11"
},
{
"input": "ehfjaabjfedhddejjfcfijagefhjeahjcddhchahjbagi\nfbfdjbjhibjgjgaaajgdbcfdbhjcajcbbieijhcjgajhgaa",
"output": "10"
},
{
"input": "ifjcedhjhdjhbiaededfefagigggcebfaebf\ngeibbffgeefbaghdbfidbbhabdbdgej",
"output": "9"
},
{
"input": "eidfdfbbgjigghaddbjhcbdechecgghjgfjjcajjhaghdhd\nfcgecaefhgjjegbhjeaffcabifihhcadaibhi",
"output": "11"
}
] | 1,584,004,425
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 12
| 2,000
| 92,467,200
|
s1, s2= input(), input()
if any([i not in s1 for i in s2]): print(-1)
else:
S1, S2 = map(enumerate,(s1, s2))
inv_map = {}
for k, v in S1:
inv_map[v] = inv_map.get(v, [])
inv_map[v].append(k)
pointer = inv_map[s2[0]][0]
count = 1
for i,j in list(S2)[1:]:
if pointer>=inv_map[j][-1]:
count+=1
pointer = inv_map[j][0]
else:
for k in inv_map[j]:
if k>pointer:
pointer = k
break
print(count)
|
Title: Newspaper Headline
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A newspaper is published in Walrusland. Its heading is *s*1, it consists of lowercase Latin letters. Fangy the little walrus wants to buy several such newspapers, cut out their headings, glue them one to another in order to get one big string. After that walrus erase several letters from this string in order to get a new word *s*2. It is considered that when Fangy erases some letter, there's no whitespace formed instead of the letter. That is, the string remains unbroken and it still only consists of lowercase Latin letters.
For example, the heading is "abc". If we take two such headings and glue them one to the other one, we get "abcabc". If we erase the letters on positions 1 and 5, we get a word "bcac".
Which least number of newspaper headings *s*1 will Fangy need to glue them, erase several letters and get word *s*2?
Input Specification:
The input data contain two lines. The first line contain the heading *s*1, the second line contains the word *s*2. The lines only consist of lowercase Latin letters (1<=≤<=|*s*1|<=≤<=104,<=1<=≤<=|*s*2|<=≤<=106).
Output Specification:
If it is impossible to get the word *s*2 in the above-described manner, print "-1" (without the quotes). Otherwise, print the least number of newspaper headings *s*1, which Fangy will need to receive the word *s*2.
Demo Input:
['abc\nxyz\n', 'abcd\ndabc\n']
Demo Output:
['-1\n', '2\n']
Note:
none
|
```python
s1, s2= input(), input()
if any([i not in s1 for i in s2]): print(-1)
else:
S1, S2 = map(enumerate,(s1, s2))
inv_map = {}
for k, v in S1:
inv_map[v] = inv_map.get(v, [])
inv_map[v].append(k)
pointer = inv_map[s2[0]][0]
count = 1
for i,j in list(S2)[1:]:
if pointer>=inv_map[j][-1]:
count+=1
pointer = inv_map[j][0]
else:
for k in inv_map[j]:
if k>pointer:
pointer = k
break
print(count)
```
| 0
|
583
|
B
|
Robot's Task
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
|
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
|
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
|
[
"3\n0 2 0\n",
"5\n4 2 3 0 1\n",
"7\n0 3 1 0 5 2 6\n"
] |
[
"1\n",
"3\n",
"2\n"
] |
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7.
| 1,000
|
[
{
"input": "3\n0 2 0",
"output": "1"
},
{
"input": "5\n4 2 3 0 1",
"output": "3"
},
{
"input": "7\n0 3 1 0 5 2 6",
"output": "2"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "0"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "3\n0 2 1",
"output": "1"
},
{
"input": "10\n7 1 9 3 5 8 6 0 2 4",
"output": "9"
},
{
"input": "10\n1 3 5 7 9 8 6 4 2 0",
"output": "9"
},
{
"input": "10\n5 0 0 1 3 2 2 2 5 7",
"output": "1"
},
{
"input": "10\n8 6 5 3 9 7 1 4 2 0",
"output": "8"
},
{
"input": "10\n1 2 4 5 0 1 3 7 1 4",
"output": "2"
},
{
"input": "10\n3 4 8 9 5 1 2 0 6 7",
"output": "6"
},
{
"input": "10\n2 2 0 0 6 2 9 0 2 0",
"output": "2"
},
{
"input": "10\n1 7 5 3 2 6 0 8 4 9",
"output": "8"
},
{
"input": "9\n1 3 8 6 2 4 5 0 7",
"output": "7"
},
{
"input": "9\n1 3 5 7 8 6 4 2 0",
"output": "8"
},
{
"input": "9\n2 4 3 1 3 0 5 4 3",
"output": "3"
},
{
"input": "9\n3 5 6 8 7 0 4 2 1",
"output": "5"
},
{
"input": "9\n2 0 8 1 0 3 0 5 3",
"output": "2"
},
{
"input": "9\n6 2 3 7 4 8 5 1 0",
"output": "4"
},
{
"input": "9\n3 1 5 6 0 3 2 0 0",
"output": "2"
},
{
"input": "9\n2 6 4 1 0 8 5 3 7",
"output": "7"
},
{
"input": "100\n27 20 18 78 93 38 56 2 48 75 36 88 96 57 69 10 25 74 68 86 65 85 66 14 22 12 43 80 99 34 42 63 61 71 77 15 37 54 21 59 23 94 28 30 50 84 62 76 47 16 26 64 82 92 72 53 17 11 41 91 35 83 79 95 67 13 1 7 3 4 73 90 8 19 33 58 98 32 39 45 87 52 60 46 6 44 49 70 51 9 5 29 31 24 40 97 81 0 89 55",
"output": "69"
},
{
"input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "99"
},
{
"input": "100\n13 89 81 0 62 1 59 92 29 13 1 37 2 8 53 15 20 34 12 70 0 85 97 55 84 60 37 54 14 65 22 69 30 22 95 44 59 85 50 80 9 71 91 93 74 21 11 78 28 21 40 81 76 24 26 60 48 85 61 68 89 76 46 73 34 52 98 29 4 38 94 51 5 55 6 27 74 27 38 37 82 70 44 89 51 59 30 37 15 55 63 78 42 39 71 43 4 10 2 13",
"output": "21"
},
{
"input": "100\n1 3 5 7 58 11 13 15 17 19 45 23 25 27 29 31 33 35 37 39 41 43 21 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 81 79 83 85 87 89 91 93 95 97 48 98 96 94 92 90 88 44 84 82 80 78 76 74 72 70 68 66 64 62 60 9 56 54 52 50 99 46 86 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "96"
},
{
"input": "100\n32 47 74 8 14 4 12 68 18 0 44 80 14 38 6 57 4 72 69 3 21 78 74 22 39 32 58 63 34 33 23 6 39 11 6 12 18 4 0 11 20 28 16 1 22 12 57 55 13 48 43 1 50 18 87 6 11 45 38 67 37 14 7 56 6 41 1 55 5 73 78 64 38 18 38 8 37 0 18 61 37 58 58 62 86 5 0 2 15 43 34 61 2 21 15 9 69 1 11 24",
"output": "4"
},
{
"input": "100\n40 3 55 7 6 77 13 46 17 64 21 54 25 27 91 41 1 15 37 82 23 43 42 47 26 95 53 5 11 59 61 9 78 67 69 58 73 0 36 79 60 83 2 87 63 33 71 89 97 99 98 93 56 92 19 88 86 84 39 28 65 20 34 76 51 94 66 12 62 49 96 72 24 52 48 50 44 35 74 31 38 57 81 32 22 80 70 29 30 18 68 16 14 90 10 8 85 4 45 75",
"output": "75"
},
{
"input": "100\n34 16 42 21 84 27 11 7 82 16 95 39 36 64 26 0 38 37 2 2 16 56 16 61 55 42 26 5 61 8 30 20 19 15 9 78 5 34 15 0 3 17 36 36 1 5 4 26 18 0 14 25 7 5 91 7 43 26 79 37 17 27 40 55 66 7 0 2 16 23 68 35 2 5 9 21 1 7 2 9 4 3 22 15 27 6 0 47 5 0 12 9 20 55 36 10 6 8 5 1",
"output": "3"
},
{
"input": "100\n35 53 87 49 13 24 93 20 5 11 31 32 40 52 96 46 1 25 66 69 28 88 84 82 70 9 75 39 26 21 18 29 23 57 90 16 48 22 95 0 58 43 7 73 8 62 63 30 64 92 79 3 6 94 34 12 76 99 67 55 56 97 14 91 68 36 44 78 41 71 86 89 47 74 4 45 98 37 80 33 83 27 42 59 72 54 17 60 51 81 15 77 65 50 10 85 61 19 38 2",
"output": "67"
},
{
"input": "99\n89 96 56 31 32 14 9 66 87 34 69 5 92 54 41 52 46 30 22 26 16 18 20 68 62 73 90 43 79 33 58 98 37 45 10 78 94 51 19 0 91 39 28 47 17 86 3 61 77 7 15 64 55 83 65 71 97 88 6 48 24 11 8 42 81 4 63 93 50 74 35 12 95 27 53 82 29 85 84 60 72 40 36 57 23 13 38 59 49 1 75 44 76 2 21 25 70 80 67",
"output": "75"
},
{
"input": "99\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "98"
},
{
"input": "99\n82 7 6 77 17 28 90 3 68 12 63 60 24 20 4 81 71 85 57 45 11 84 3 91 49 34 89 82 0 50 48 88 36 76 36 5 62 48 20 2 20 45 69 27 37 62 42 31 57 51 92 84 89 25 7 62 12 23 23 56 30 90 27 10 77 58 48 38 56 68 57 15 33 1 34 67 16 47 75 70 69 28 38 16 5 61 85 76 44 90 37 22 77 94 55 1 97 8 69",
"output": "22"
},
{
"input": "99\n1 51 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 42 43 45 47 49 3 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 8 76 74 72 70 68 66 22 62 60 58 56 54 52 0 48 46 44 41 40 38 36 34 32 30 28 26 24 64 20 18 16 14 12 10 78 6 4 2 50",
"output": "96"
},
{
"input": "99\n22 3 19 13 65 87 28 17 41 40 31 21 8 37 29 65 65 53 16 33 13 5 76 4 72 9 2 76 57 72 50 15 75 0 30 13 83 36 12 31 49 51 65 22 48 31 60 15 2 17 6 1 8 0 1 63 3 16 7 7 2 1 47 28 26 21 2 36 1 5 20 25 44 0 2 39 46 30 33 11 15 34 34 4 84 52 0 39 7 3 17 15 6 38 52 64 26 1 0",
"output": "3"
},
{
"input": "99\n24 87 25 82 97 11 37 15 23 19 34 17 76 13 45 89 33 1 27 78 63 43 54 47 49 2 42 41 75 83 61 90 65 67 21 71 60 57 77 62 81 58 85 69 3 91 68 55 72 93 29 94 66 16 88 86 84 53 14 39 35 44 9 70 80 92 56 79 74 5 64 31 52 50 48 46 51 59 40 38 36 96 32 30 28 95 7 22 20 18 26 73 12 10 8 6 4 98 0",
"output": "74"
},
{
"input": "99\n22 14 0 44 6 17 6 6 37 45 0 48 19 8 57 8 10 0 3 12 25 2 5 53 9 49 15 6 38 14 9 40 38 22 27 12 64 10 11 35 89 19 46 39 12 24 48 0 52 1 27 27 24 4 64 24 5 0 67 3 5 39 0 1 13 37 2 8 46 1 28 70 6 79 14 15 33 6 7 34 6 18 4 71 1 55 33 71 18 11 47 23 72 53 65 32 2 7 28",
"output": "3"
},
{
"input": "99\n28 59 73 89 52 27 0 20 36 12 83 95 31 24 54 94 49 14 51 34 50 93 13 1 2 68 63 48 41 81 23 43 18 9 16 38 33 60 62 3 40 85 72 69 90 98 11 37 22 44 35 6 21 39 82 10 64 66 96 42 74 30 8 67 97 46 84 32 17 57 75 71 5 26 4 55 58 29 7 15 45 19 92 91 78 65 88 25 86 80 77 87 79 53 47 70 56 76 61",
"output": "63"
}
] | 1,446,330,977
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 187
| 409,600
|
n = int(input())
a = list(map(int, input().split()))
cnt = 0
res = 0
while len(a):
b = []
for i in range(len(a)):
if a[i] <= cnt:
cnt += 1
else:
b.append(a[i])
a = b[::-1]
res += 1
print(res - 1)
|
Title: Robot's Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
Input Specification:
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
Output Specification:
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
Demo Input:
['3\n0 2 0\n', '5\n4 2 3 0 1\n', '7\n0 3 1 0 5 2 6\n']
Demo Output:
['1\n', '3\n', '2\n']
Note:
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7.
|
```python
n = int(input())
a = list(map(int, input().split()))
cnt = 0
res = 0
while len(a):
b = []
for i in range(len(a)):
if a[i] <= cnt:
cnt += 1
else:
b.append(a[i])
a = b[::-1]
res += 1
print(res - 1)
```
| 3
|
|
284
|
A
|
Cows and Primitive Roots
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math",
"number theory"
] | null | null |
The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is.
Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots .
|
The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime.
|
Output on a single line the number of primitive roots .
|
[
"3\n",
"5\n"
] |
[
"1\n",
"2\n"
] |
The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3.
| 500
|
[
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "2"
},
{
"input": "7",
"output": "2"
},
{
"input": "11",
"output": "4"
},
{
"input": "17",
"output": "8"
},
{
"input": "19",
"output": "6"
},
{
"input": "1583",
"output": "672"
},
{
"input": "997",
"output": "328"
},
{
"input": "2",
"output": "1"
},
{
"input": "1987",
"output": "660"
},
{
"input": "1993",
"output": "656"
},
{
"input": "1997",
"output": "996"
},
{
"input": "1999",
"output": "648"
},
{
"input": "1297",
"output": "432"
},
{
"input": "163",
"output": "54"
},
{
"input": "1259",
"output": "576"
},
{
"input": "821",
"output": "320"
},
{
"input": "29",
"output": "12"
},
{
"input": "43",
"output": "12"
},
{
"input": "1949",
"output": "972"
},
{
"input": "1879",
"output": "624"
},
{
"input": "1759",
"output": "584"
},
{
"input": "1597",
"output": "432"
},
{
"input": "1619",
"output": "808"
},
{
"input": "1277",
"output": "560"
},
{
"input": "1097",
"output": "544"
},
{
"input": "953",
"output": "384"
},
{
"input": "751",
"output": "200"
},
{
"input": "607",
"output": "200"
},
{
"input": "509",
"output": "252"
},
{
"input": "431",
"output": "168"
},
{
"input": "317",
"output": "156"
},
{
"input": "211",
"output": "48"
},
{
"input": "127",
"output": "36"
},
{
"input": "101",
"output": "40"
},
{
"input": "31",
"output": "8"
}
] | 1,584,638,326
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 154
| 0
|
import math
n=int(input())
print(1)
print(2)
print(2)
|
Title: Cows and Primitive Roots
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The cows have just learned what a primitive root is! Given a prime *p*, a primitive root is an integer *x* (1<=≤<=*x*<=<<=*p*) such that none of integers *x*<=-<=1,<=*x*2<=-<=1,<=...,<=*x**p*<=-<=2<=-<=1 are divisible by *p*, but *x**p*<=-<=1<=-<=1 is.
Unfortunately, computing primitive roots can be time consuming, so the cows need your help. Given a prime *p*, help the cows find the number of primitive roots .
Input Specification:
The input contains a single line containing an integer *p* (2<=≤<=*p*<=<<=2000). It is guaranteed that *p* is a prime.
Output Specification:
Output on a single line the number of primitive roots .
Demo Input:
['3\n', '5\n']
Demo Output:
['1\n', '2\n']
Note:
The only primitive root <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/3722298ba062e95b18705d1253eb4e5d31e3b2d1.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
The primitive roots <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1d85c6a17ef1c42b53cf94d00bc49a7ac458fd58.png" style="max-width: 100.0%;max-height: 100.0%;"/> are 2 and 3.
|
```python
import math
n=int(input())
print(1)
print(2)
print(2)
```
| 0
|
|
676
|
A
|
Nicholas and Permutation
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
|
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
|
[
"5\n4 5 1 3 2\n",
"7\n1 6 5 3 4 7 2\n",
"6\n6 5 4 3 2 1\n"
] |
[
"3\n",
"6\n",
"5\n"
] |
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
| 500
|
[
{
"input": "5\n4 5 1 3 2",
"output": "3"
},
{
"input": "7\n1 6 5 3 4 7 2",
"output": "6"
},
{
"input": "6\n6 5 4 3 2 1",
"output": "5"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "5\n1 4 5 2 3",
"output": "4"
},
{
"input": "6\n4 6 3 5 2 1",
"output": "5"
},
{
"input": "7\n1 5 3 6 2 4 7",
"output": "6"
},
{
"input": "100\n76 70 67 54 40 1 48 63 64 36 42 90 99 27 47 17 93 7 13 84 16 57 74 5 83 61 19 56 52 92 38 91 82 79 34 66 71 28 37 98 35 94 77 53 73 10 26 80 15 32 8 81 3 95 44 46 72 6 33 11 21 85 4 30 24 51 49 96 87 55 14 31 12 60 45 9 29 22 58 18 88 2 50 59 20 86 23 41 100 39 62 68 69 97 78 43 25 89 65 75",
"output": "94"
},
{
"input": "8\n4 5 3 8 6 7 1 2",
"output": "6"
},
{
"input": "9\n6 8 5 3 4 7 9 2 1",
"output": "8"
},
{
"input": "10\n8 7 10 1 2 3 4 6 5 9",
"output": "7"
},
{
"input": "11\n5 4 6 9 10 11 7 3 1 2 8",
"output": "8"
},
{
"input": "12\n3 6 7 8 9 10 12 5 4 2 11 1",
"output": "11"
},
{
"input": "13\n8 4 3 7 5 11 9 1 10 2 13 12 6",
"output": "10"
},
{
"input": "14\n6 10 13 9 7 1 12 14 3 2 5 4 11 8",
"output": "8"
},
{
"input": "15\n3 14 13 12 7 2 4 11 15 1 8 6 5 10 9",
"output": "9"
},
{
"input": "16\n11 6 9 8 7 14 12 13 10 15 2 5 3 1 4 16",
"output": "15"
},
{
"input": "17\n13 12 5 3 9 16 8 14 2 4 10 1 6 11 7 15 17",
"output": "16"
},
{
"input": "18\n8 6 14 17 9 11 15 13 5 3 18 1 2 7 12 16 4 10",
"output": "11"
},
{
"input": "19\n12 19 3 11 15 6 18 14 5 10 2 13 9 7 4 8 17 16 1",
"output": "18"
},
{
"input": "20\n15 17 10 20 7 2 16 9 13 6 18 5 19 8 11 14 4 12 3 1",
"output": "19"
},
{
"input": "21\n1 9 14 18 13 12 11 20 16 2 4 19 15 7 6 17 8 5 3 10 21",
"output": "20"
},
{
"input": "22\n8 3 17 4 16 21 14 11 10 15 6 18 13 12 22 20 5 2 9 7 19 1",
"output": "21"
},
{
"input": "23\n1 23 11 20 9 3 12 4 7 17 5 15 2 10 18 16 8 22 14 13 19 21 6",
"output": "22"
},
{
"input": "24\n2 10 23 22 20 19 18 16 11 12 15 17 21 8 24 13 1 5 6 7 14 3 9 4",
"output": "16"
},
{
"input": "25\n12 13 22 17 1 18 14 5 21 2 10 4 3 23 11 6 20 8 24 16 15 19 9 7 25",
"output": "24"
},
{
"input": "26\n6 21 20 16 26 17 11 2 24 4 1 12 14 8 25 7 15 10 22 5 13 18 9 23 19 3",
"output": "21"
},
{
"input": "27\n20 14 18 10 5 3 9 4 24 22 21 27 17 15 26 2 23 7 12 11 6 8 19 25 16 13 1",
"output": "26"
},
{
"input": "28\n28 13 16 6 1 12 4 27 22 7 18 3 21 26 25 11 5 10 20 24 19 15 14 8 23 17 9 2",
"output": "27"
},
{
"input": "29\n21 11 10 25 2 5 9 16 29 8 17 4 15 13 6 22 7 24 19 12 18 20 1 3 23 28 27 14 26",
"output": "22"
},
{
"input": "30\n6 19 14 22 26 17 27 8 25 3 24 30 4 18 23 16 9 13 29 20 15 2 5 11 28 12 1 10 21 7",
"output": "26"
},
{
"input": "31\n29 13 26 27 9 28 2 16 30 21 12 11 3 31 23 6 22 20 1 5 14 24 19 18 8 4 10 17 15 25 7",
"output": "18"
},
{
"input": "32\n15 32 11 3 18 23 19 14 5 8 6 21 13 24 25 4 16 9 27 20 17 31 2 22 7 12 30 1 26 10 29 28",
"output": "30"
},
{
"input": "33\n22 13 10 33 8 25 15 14 21 28 27 19 26 24 1 12 5 11 32 20 30 31 18 4 6 23 7 29 16 2 17 9 3",
"output": "29"
},
{
"input": "34\n34 30 7 16 6 1 10 23 29 13 15 25 32 26 18 11 28 3 14 21 19 5 31 33 4 17 8 9 24 20 27 22 2 12",
"output": "33"
},
{
"input": "35\n24 33 20 8 34 11 31 25 2 4 18 13 9 35 16 30 23 32 17 1 14 22 19 21 28 26 3 15 5 12 27 29 10 6 7",
"output": "21"
},
{
"input": "36\n1 32 27 35 22 7 34 15 18 36 31 28 13 2 10 21 20 17 16 4 3 24 19 29 11 12 25 5 33 26 14 6 9 23 30 8",
"output": "35"
},
{
"input": "37\n24 1 12 23 11 6 30 15 4 21 13 20 25 17 5 8 36 19 32 26 14 9 7 18 10 29 37 35 16 2 22 34 3 27 31 33 28",
"output": "35"
},
{
"input": "38\n9 35 37 28 36 21 10 25 19 4 26 5 22 7 27 18 6 14 15 24 1 17 11 34 20 8 2 16 3 23 32 31 13 12 38 33 30 29",
"output": "34"
},
{
"input": "39\n16 28 4 33 26 36 25 23 22 30 27 7 12 34 17 6 3 38 10 24 13 31 29 39 14 32 9 20 35 11 18 21 8 2 15 37 5 19 1",
"output": "38"
},
{
"input": "40\n35 39 28 11 9 31 36 8 5 32 26 19 38 33 2 22 23 25 6 37 12 7 3 10 17 24 20 16 27 4 34 15 40 14 18 13 29 21 30 1",
"output": "39"
},
{
"input": "41\n24 18 7 23 3 15 1 17 25 5 30 10 34 36 2 14 9 21 41 40 20 28 33 35 12 22 11 8 19 16 31 27 26 32 29 4 13 38 37 39 6",
"output": "34"
},
{
"input": "42\n42 15 24 26 4 34 19 29 38 32 31 33 14 41 21 3 11 39 25 6 5 20 23 10 16 36 18 28 27 1 7 40 22 30 9 2 37 17 8 12 13 35",
"output": "41"
},
{
"input": "43\n43 24 20 13 22 29 28 4 30 3 32 40 31 8 7 9 35 27 18 5 42 6 17 19 23 12 41 21 16 37 33 34 2 14 36 38 25 10 15 39 26 11 1",
"output": "42"
},
{
"input": "44\n4 38 6 40 29 3 44 2 30 35 25 36 34 10 11 31 21 7 14 23 37 19 27 18 5 22 1 16 17 9 39 13 15 32 43 8 41 26 42 12 24 33 20 28",
"output": "37"
},
{
"input": "45\n45 29 24 2 31 5 34 41 26 44 33 43 15 3 4 11 21 37 27 12 14 39 23 42 16 6 13 19 8 38 20 9 25 22 40 17 32 35 18 10 28 7 30 36 1",
"output": "44"
},
{
"input": "46\n29 3 12 33 45 40 19 17 25 27 28 1 16 23 24 46 31 8 44 15 5 32 22 11 4 36 34 10 35 26 21 7 14 2 18 9 20 41 6 43 42 37 38 13 39 30",
"output": "34"
},
{
"input": "47\n7 3 8 12 24 16 29 10 28 38 1 20 37 40 21 5 15 6 45 23 36 44 25 43 41 4 11 42 18 35 32 31 39 33 27 30 22 34 14 13 17 47 19 9 46 26 2",
"output": "41"
},
{
"input": "48\n29 26 14 18 34 33 13 39 32 1 37 20 35 19 28 48 30 23 46 27 5 22 24 38 12 15 8 36 43 45 16 47 6 9 31 40 44 17 2 41 11 42 25 4 21 3 10 7",
"output": "38"
},
{
"input": "49\n16 7 42 32 11 35 15 8 23 41 6 20 47 24 9 45 49 2 37 48 25 28 5 18 3 19 12 4 22 33 13 14 10 36 44 17 40 38 30 26 1 43 29 46 21 34 27 39 31",
"output": "40"
},
{
"input": "50\n31 45 3 34 13 43 32 4 42 9 7 8 24 14 35 6 19 46 44 17 18 1 25 20 27 41 2 16 12 10 11 47 38 21 28 49 30 15 50 36 29 26 22 39 48 5 23 37 33 40",
"output": "38"
},
{
"input": "51\n47 29 2 11 43 44 27 1 39 14 25 30 33 21 38 45 34 51 16 50 42 31 41 46 15 48 13 19 6 37 35 7 22 28 20 4 17 10 5 8 24 40 9 36 18 49 12 26 23 3 32",
"output": "43"
},
{
"input": "52\n16 45 23 7 15 19 43 20 4 32 35 36 9 50 5 26 38 46 13 33 12 2 48 37 41 31 10 28 8 42 3 21 11 1 17 27 34 30 44 40 6 51 49 47 25 22 18 24 52 29 14 39",
"output": "48"
},
{
"input": "53\n53 30 50 22 51 31 32 38 12 7 39 43 1 23 6 8 24 52 2 21 34 13 3 35 5 15 19 11 47 18 9 20 29 4 36 45 27 41 25 48 16 46 44 17 10 14 42 26 40 28 33 37 49",
"output": "52"
},
{
"input": "54\n6 39 17 3 45 52 16 21 23 48 42 36 13 37 46 10 43 27 49 7 38 32 31 30 15 25 2 29 8 51 54 19 41 44 24 34 22 5 20 14 12 1 33 40 4 26 9 35 18 28 47 50 11 53",
"output": "41"
},
{
"input": "55\n26 15 31 21 32 43 34 51 7 12 5 44 17 54 18 25 48 47 20 3 41 24 45 2 11 22 29 39 37 53 35 28 36 9 50 10 30 38 19 13 4 8 27 1 42 6 49 23 55 40 33 16 46 14 52",
"output": "48"
},
{
"input": "56\n6 20 38 46 10 11 40 19 5 1 47 33 4 18 32 36 37 45 56 49 48 52 12 26 31 14 2 9 24 3 16 51 41 43 23 17 34 7 29 50 55 25 39 44 22 27 54 8 28 35 30 42 13 53 21 15",
"output": "46"
},
{
"input": "57\n39 28 53 36 3 6 12 56 55 20 50 19 43 42 18 40 24 52 38 17 33 23 22 41 14 7 26 44 45 16 35 1 8 47 31 5 30 51 32 4 37 25 13 34 54 21 46 10 15 11 2 27 29 48 49 9 57",
"output": "56"
},
{
"input": "58\n1 26 28 14 22 33 57 40 9 42 44 37 24 19 58 12 48 3 34 31 49 4 16 47 55 52 27 23 46 18 20 32 56 6 39 36 41 38 13 43 45 21 53 54 29 17 5 10 25 30 2 35 11 7 15 51 8 50",
"output": "57"
},
{
"input": "59\n1 27 10 37 53 9 14 49 46 26 50 42 59 11 47 15 24 56 43 45 44 38 5 8 58 30 52 12 23 32 22 3 31 41 2 25 29 6 54 16 35 33 18 55 4 51 57 28 40 19 13 21 7 39 36 48 34 17 20",
"output": "58"
},
{
"input": "60\n60 27 34 32 54 55 33 12 40 3 47 44 50 39 38 59 11 25 17 15 16 30 21 31 10 52 5 23 4 48 6 26 36 57 14 22 8 56 58 9 24 7 37 53 42 43 20 49 51 19 2 46 28 18 35 13 29 45 41 1",
"output": "59"
},
{
"input": "61\n61 11 26 29 31 40 32 30 35 3 18 52 9 53 42 4 50 54 20 58 28 49 22 12 2 19 16 15 57 34 51 43 7 17 25 41 56 47 55 60 46 14 44 45 24 27 33 1 48 13 59 23 38 39 6 5 36 10 8 37 21",
"output": "60"
},
{
"input": "62\n21 23 34 38 11 61 55 30 37 48 54 51 46 47 6 56 36 49 1 35 12 28 29 20 43 42 5 8 22 57 44 4 53 10 58 33 27 25 16 45 50 40 18 15 3 41 39 2 7 60 59 13 32 24 52 31 14 9 19 26 17 62",
"output": "61"
},
{
"input": "63\n2 5 29 48 31 26 21 16 47 24 43 22 61 28 6 39 60 27 14 52 37 7 53 8 62 56 63 10 50 18 44 13 4 9 25 11 23 42 45 41 59 12 32 36 40 51 1 35 49 54 57 20 19 34 38 46 33 3 55 15 30 58 17",
"output": "46"
},
{
"input": "64\n23 5 51 40 12 46 44 8 64 31 58 55 45 24 54 39 21 19 52 61 30 42 16 18 15 32 53 22 28 26 11 25 48 56 27 9 29 41 35 49 59 38 62 7 34 1 20 33 60 17 2 3 43 37 57 14 6 36 13 10 50 4 63 47",
"output": "55"
},
{
"input": "65\n10 11 55 43 53 25 35 26 16 37 41 38 59 21 48 2 65 49 17 23 18 30 62 36 3 4 47 15 28 63 57 54 31 46 44 12 51 7 29 13 56 52 14 22 39 19 8 27 45 5 6 34 32 61 20 50 9 24 33 58 60 40 1 42 64",
"output": "62"
},
{
"input": "66\n66 39 3 2 55 53 60 54 12 49 10 30 59 26 32 46 50 56 7 13 43 36 24 28 11 8 6 21 35 25 42 57 23 45 64 5 34 61 27 51 52 9 15 1 38 17 63 48 37 20 58 14 47 19 22 41 31 44 33 65 4 62 40 18 16 29",
"output": "65"
},
{
"input": "67\n66 16 2 53 35 38 49 28 18 6 36 58 21 47 27 5 50 62 44 12 52 37 11 56 15 31 25 65 17 29 59 41 7 42 4 43 39 10 1 40 24 13 20 54 19 67 46 60 51 45 64 30 8 33 26 9 3 22 34 23 57 48 55 14 63 61 32",
"output": "45"
},
{
"input": "68\n13 6 27 21 65 23 59 14 62 43 33 31 38 41 67 20 16 25 42 4 28 40 29 9 64 17 2 26 32 58 60 53 46 48 47 54 44 50 39 19 30 57 61 1 11 18 37 24 55 15 63 34 8 52 56 7 10 12 35 66 5 36 45 49 68 22 51 3",
"output": "64"
},
{
"input": "69\n29 49 25 51 21 35 11 61 39 54 40 37 60 42 27 33 59 53 34 10 46 2 23 69 8 47 58 36 1 38 19 12 7 48 13 3 6 22 18 5 65 24 50 41 66 44 67 57 4 56 62 43 9 30 14 15 28 31 64 26 16 55 68 17 32 20 45 52 63",
"output": "45"
},
{
"input": "70\n19 12 15 18 36 16 61 69 24 7 11 13 3 48 55 21 37 17 43 31 41 22 28 32 27 63 38 49 59 56 30 25 67 51 52 45 50 44 66 57 26 60 5 46 33 6 23 34 8 40 2 68 14 39 65 64 62 42 47 54 10 53 9 1 70 58 20 4 29 35",
"output": "64"
},
{
"input": "71\n40 6 62 3 41 52 31 66 27 16 35 5 17 60 2 15 51 22 67 61 71 53 1 64 8 45 28 18 50 30 12 69 20 26 10 37 36 49 70 32 33 11 57 14 9 55 4 58 29 25 44 65 39 48 24 47 19 46 56 38 34 42 59 63 54 23 7 68 43 13 21",
"output": "50"
},
{
"input": "72\n52 64 71 40 32 10 62 21 11 37 38 13 22 70 1 66 41 50 27 20 42 47 25 68 49 12 15 72 44 60 53 5 23 14 43 29 65 36 51 54 35 67 7 19 55 48 58 46 39 24 33 30 61 45 57 2 31 3 18 59 6 9 4 63 8 16 26 34 28 69 17 56",
"output": "57"
},
{
"input": "73\n58 38 47 34 39 64 69 66 72 57 9 4 67 22 35 13 61 14 28 52 56 20 31 70 27 24 36 1 62 17 10 5 12 33 16 73 18 49 63 71 44 65 23 30 40 8 50 46 60 25 11 26 37 55 29 68 42 2 3 32 59 7 15 43 41 48 51 53 6 45 54 19 21",
"output": "45"
},
{
"input": "74\n19 51 59 34 8 40 42 55 65 16 74 26 49 63 64 70 35 72 7 12 43 18 61 27 47 31 13 32 71 22 25 67 9 1 48 50 33 10 21 46 11 45 17 37 28 60 69 66 38 2 30 3 39 15 53 68 57 41 6 36 24 73 4 23 5 62 44 14 20 29 52 54 56 58",
"output": "63"
},
{
"input": "75\n75 28 60 19 59 17 65 26 32 23 18 64 8 62 4 11 42 16 47 5 72 46 9 1 25 21 2 50 33 6 36 68 30 12 20 40 53 45 34 7 37 39 38 44 63 61 67 3 66 51 29 73 24 57 70 27 10 56 22 55 13 49 35 15 54 41 14 74 69 48 52 31 71 43 58",
"output": "74"
},
{
"input": "76\n1 47 54 17 38 37 12 32 14 48 43 71 60 56 4 13 64 41 52 57 62 24 23 49 20 10 63 3 25 66 59 40 58 33 53 46 70 7 35 61 72 74 73 19 30 5 29 6 15 28 21 27 51 55 50 9 65 8 67 39 76 42 31 34 16 2 36 11 26 44 22 45 75 18 69 68",
"output": "75"
},
{
"input": "77\n10 20 57 65 53 69 59 45 58 32 28 72 4 14 1 33 40 47 7 5 51 76 37 16 41 61 42 2 21 26 38 74 35 64 43 77 71 50 39 48 27 63 73 44 52 66 9 18 23 54 25 6 8 56 13 67 36 22 15 46 62 75 55 11 31 17 24 29 60 68 12 30 3 70 49 19 34",
"output": "62"
},
{
"input": "78\n7 61 69 47 68 42 65 78 70 3 32 59 49 51 23 71 11 63 22 18 43 34 24 13 27 16 19 40 21 46 48 77 28 66 54 67 60 15 75 62 9 26 52 58 4 25 8 37 41 76 1 6 30 50 44 36 5 14 29 53 17 12 2 57 73 35 64 39 56 10 33 20 45 74 31 55 38 72",
"output": "70"
},
{
"input": "79\n75 79 43 66 72 52 29 65 74 38 24 1 5 51 13 7 71 33 4 61 2 36 63 47 64 44 34 27 3 21 17 37 54 53 49 20 28 60 39 10 16 76 6 77 73 22 50 48 78 30 67 56 31 26 40 59 41 11 18 45 69 62 15 23 32 70 19 55 68 57 35 25 12 46 14 42 9 8 58",
"output": "77"
},
{
"input": "80\n51 20 37 12 68 11 28 52 76 21 7 5 3 16 64 34 25 2 6 40 60 62 75 13 45 17 56 29 32 47 79 73 49 72 15 46 30 54 80 27 43 24 74 18 42 71 14 4 44 63 65 33 1 77 55 57 41 59 58 70 69 35 19 67 10 36 26 23 48 50 39 61 9 66 38 8 31 22 53 78",
"output": "52"
},
{
"input": "81\n63 22 4 41 43 74 64 39 10 35 20 81 11 28 70 67 53 79 16 61 68 52 27 37 58 9 50 49 18 30 72 47 7 60 78 51 23 48 73 66 44 13 15 57 56 38 1 76 25 45 36 34 42 8 75 26 59 14 71 21 6 77 5 17 2 32 40 54 46 24 29 3 31 19 65 62 33 69 12 80 55",
"output": "69"
},
{
"input": "82\n50 24 17 41 49 18 80 11 79 72 57 31 21 35 2 51 36 66 20 65 38 3 45 32 59 81 28 30 70 55 29 76 73 6 33 39 8 7 19 48 63 1 77 43 4 13 78 54 69 9 40 46 74 82 60 71 16 64 12 14 47 26 44 5 10 75 53 25 27 15 56 42 58 34 23 61 67 62 68 22 37 52",
"output": "53"
},
{
"input": "83\n64 8 58 17 67 46 3 82 23 70 72 16 53 45 13 20 12 48 40 4 6 47 76 60 19 44 30 78 28 22 75 15 25 29 63 74 55 32 14 51 35 31 62 77 27 42 65 71 56 61 66 41 68 49 7 34 2 83 36 5 33 26 37 80 59 50 1 9 54 21 18 24 38 73 81 52 10 39 43 79 57 11 69",
"output": "66"
},
{
"input": "84\n75 8 66 21 61 63 72 51 52 13 59 25 28 58 64 53 79 41 34 7 67 11 39 56 44 24 50 9 49 55 1 80 26 6 73 74 27 69 65 37 18 43 36 17 30 3 47 29 76 78 32 22 12 68 46 5 42 81 57 31 33 83 54 48 14 62 10 16 4 20 71 70 35 15 45 19 60 77 2 23 84 40 82 38",
"output": "80"
},
{
"input": "85\n1 18 58 8 22 76 3 61 12 33 54 41 6 24 82 15 10 17 38 64 26 4 62 28 47 14 66 9 84 75 2 71 67 43 37 32 85 21 69 52 55 63 81 51 74 59 65 34 29 36 30 45 27 53 13 79 39 57 5 70 19 40 7 42 68 48 16 80 83 23 46 35 72 31 11 44 73 77 50 56 49 25 60 20 78",
"output": "84"
},
{
"input": "86\n64 56 41 10 31 69 47 39 37 36 27 19 9 42 15 6 78 59 52 17 71 45 72 14 2 54 38 79 4 18 16 8 46 75 50 82 44 24 20 55 58 86 61 43 35 32 33 40 63 30 28 60 13 53 12 57 77 81 76 66 73 84 85 62 68 22 51 5 49 7 1 70 80 65 34 48 23 21 83 11 74 26 29 67 25 3",
"output": "70"
},
{
"input": "87\n14 20 82 47 39 75 71 45 3 37 63 19 32 68 7 41 48 76 27 46 84 49 4 44 26 69 17 64 1 18 58 33 11 23 21 86 67 52 70 16 77 78 6 74 15 87 10 59 13 34 22 2 65 38 66 61 51 57 35 60 81 40 36 80 31 43 83 56 79 55 29 5 12 8 50 30 53 72 54 9 24 25 42 62 73 28 85",
"output": "58"
},
{
"input": "88\n1 83 73 46 61 31 39 86 57 43 16 29 26 80 82 7 36 42 13 20 6 64 19 40 24 12 47 87 8 34 75 9 69 3 11 52 14 25 84 59 27 10 54 51 81 74 65 77 70 17 60 35 23 44 49 2 4 88 5 21 41 32 68 66 15 55 48 58 78 53 22 38 45 33 30 50 85 76 37 79 63 18 28 62 72 56 71 67",
"output": "87"
},
{
"input": "89\n68 40 14 58 56 25 8 44 49 55 9 76 66 54 33 81 42 15 59 17 21 30 75 60 4 48 64 6 52 63 61 27 12 57 72 67 23 86 77 80 22 13 43 73 26 78 50 51 18 62 1 29 82 16 74 2 87 24 3 41 11 46 47 69 10 84 65 39 35 79 70 32 34 31 20 19 53 71 36 28 83 88 38 85 7 5 37 45 89",
"output": "88"
},
{
"input": "90\n2 67 26 58 9 49 76 22 60 30 77 20 13 7 37 81 47 16 19 12 14 45 41 68 85 54 28 24 46 1 27 43 32 89 53 35 59 75 18 51 17 64 66 80 31 88 87 90 38 72 55 71 42 11 73 69 62 78 23 74 65 79 84 4 86 52 10 6 3 82 56 5 48 33 21 57 40 29 61 63 34 36 83 8 15 44 50 70 39 25",
"output": "60"
},
{
"input": "91\n91 69 56 16 73 55 14 82 80 46 57 81 22 71 63 76 43 37 77 75 70 3 26 2 28 17 51 38 30 67 41 47 54 62 34 25 84 11 87 39 32 52 31 36 50 19 21 53 29 24 79 8 74 64 44 7 6 18 10 42 13 9 83 58 4 88 65 60 20 90 66 49 86 89 78 48 5 27 23 59 61 15 72 45 40 33 68 85 35 12 1",
"output": "90"
},
{
"input": "92\n67 57 76 78 25 89 6 82 11 16 26 17 59 48 73 10 21 31 27 80 4 5 22 13 92 55 45 85 63 28 75 60 54 88 91 47 29 35 7 87 1 39 43 51 71 84 83 81 46 9 38 56 90 24 37 41 19 86 50 61 79 20 18 14 69 23 62 65 49 52 58 53 36 2 68 64 15 42 30 34 66 32 44 40 8 33 3 77 74 12 70 72",
"output": "67"
},
{
"input": "93\n76 35 5 87 7 21 59 71 24 37 2 73 31 74 4 52 28 20 56 27 65 86 16 45 85 67 68 70 47 72 91 88 14 32 62 69 78 41 15 22 57 18 50 13 39 58 17 83 64 51 25 11 38 77 82 90 8 26 29 61 10 43 79 53 48 6 23 55 63 49 81 92 80 44 89 60 66 30 1 9 36 33 19 46 75 93 3 12 42 84 40 54 34",
"output": "85"
},
{
"input": "94\n29 85 82 78 61 83 80 63 11 38 50 43 9 24 4 87 79 45 3 17 90 7 34 27 1 76 26 39 84 47 22 41 81 19 44 23 56 92 35 31 72 62 70 53 40 88 13 14 73 2 59 86 46 94 15 12 77 57 89 42 75 48 18 51 32 55 71 30 49 91 20 60 5 93 33 64 21 36 10 28 8 65 66 69 74 58 6 52 25 67 16 37 54 68",
"output": "69"
},
{
"input": "95\n36 73 18 77 15 71 50 57 79 65 94 88 9 69 52 70 26 66 78 89 55 20 72 83 75 68 32 28 45 74 19 22 54 23 84 90 86 12 42 58 11 81 39 31 85 47 60 44 59 43 21 7 30 41 64 76 93 46 87 48 10 40 3 14 38 49 29 35 2 67 5 34 13 37 27 56 91 17 62 80 8 61 53 95 24 92 6 82 63 33 51 25 4 16 1",
"output": "94"
},
{
"input": "96\n64 3 47 83 19 10 72 61 73 95 16 40 54 84 8 86 28 4 37 42 92 48 63 76 67 1 59 66 20 35 93 2 43 7 45 70 34 33 26 91 85 89 13 29 58 68 44 25 87 75 49 71 41 17 55 36 32 31 74 22 52 79 30 88 50 78 38 39 65 27 69 77 81 94 82 53 21 80 57 60 24 46 51 9 18 15 96 62 6 23 11 12 90 5 14 56",
"output": "86"
},
{
"input": "97\n40 63 44 64 84 92 38 41 28 91 3 70 76 67 94 96 35 79 29 22 78 88 85 8 21 1 93 54 71 80 37 17 13 26 62 59 75 87 69 33 89 49 77 61 12 39 6 36 58 18 73 50 82 45 74 52 11 34 95 7 23 30 15 32 31 16 55 19 20 83 60 72 10 53 51 14 27 9 68 47 5 2 81 46 57 86 56 43 48 66 24 25 4 42 65 97 90",
"output": "95"
},
{
"input": "98\n85 94 69 86 22 52 27 79 53 91 35 55 33 88 8 75 76 95 64 54 67 30 70 49 6 16 2 48 80 32 25 90 98 46 9 96 36 81 10 92 28 11 37 97 15 41 38 40 83 44 29 47 23 3 31 61 87 39 78 20 68 12 17 73 59 18 77 72 43 51 84 24 89 65 26 7 74 93 21 19 5 14 50 42 82 71 60 56 34 62 58 57 45 66 13 63 4 1",
"output": "97"
},
{
"input": "99\n33 48 19 41 59 64 16 12 17 13 7 1 9 6 4 92 61 49 60 25 74 65 22 97 30 32 10 62 14 55 80 66 82 78 31 23 87 93 27 98 20 29 88 84 77 34 83 96 79 90 56 89 58 72 52 47 21 76 24 70 44 94 5 39 8 18 57 36 40 68 43 75 3 2 35 99 63 26 67 73 15 11 53 28 42 46 69 50 51 95 38 37 54 85 81 91 45 86 71",
"output": "87"
},
{
"input": "100\n28 30 77 4 81 67 31 25 66 56 88 73 83 51 57 34 21 90 38 76 22 99 53 70 91 3 64 54 6 94 8 5 97 80 50 45 61 40 16 95 36 98 9 2 17 44 72 55 18 58 47 12 87 24 7 32 14 23 65 41 63 48 62 39 92 27 43 19 46 13 42 52 96 84 26 69 100 79 93 49 35 60 71 59 68 15 10 29 20 1 78 33 75 86 11 85 74 82 89 37",
"output": "89"
},
{
"input": "100\n100 97 35 55 45 3 46 98 77 64 94 85 73 43 49 79 72 9 70 62 80 88 29 58 61 20 89 83 66 86 82 15 6 87 42 96 90 75 63 38 81 40 5 23 4 18 41 19 99 60 8 12 76 51 39 93 53 26 21 50 47 28 13 30 68 59 34 54 24 56 31 27 65 16 32 10 36 52 44 91 22 14 33 25 7 78 67 17 57 37 92 11 2 69 84 95 74 71 48 1",
"output": "99"
},
{
"input": "100\n83 96 73 70 30 25 7 77 58 89 76 85 49 82 45 51 14 62 50 9 31 32 16 15 97 64 4 37 20 93 24 10 80 71 100 39 75 72 78 74 8 29 53 86 79 48 3 68 90 99 56 87 63 94 36 1 40 65 6 44 43 84 17 52 34 95 38 47 60 57 98 59 33 41 46 81 23 27 19 2 54 91 55 35 26 12 92 18 28 66 69 21 5 67 13 11 22 88 61 42",
"output": "65"
},
{
"input": "100\n96 80 47 60 56 9 78 20 37 72 68 15 100 94 51 26 65 38 50 19 4 70 25 63 22 30 13 58 43 69 18 33 5 66 39 73 12 55 95 92 97 1 14 83 10 28 64 31 46 91 32 86 74 54 29 52 89 53 90 44 62 40 16 24 67 81 36 34 7 23 79 87 75 98 84 3 41 77 76 42 71 35 49 61 2 27 59 82 99 85 21 11 45 6 88 48 17 57 8 93",
"output": "87"
},
{
"input": "100\n5 6 88 37 97 51 25 81 54 17 57 98 99 44 67 24 30 93 100 36 8 38 84 42 21 4 75 31 85 48 70 77 43 50 65 94 29 32 68 86 56 39 69 47 20 60 52 53 10 34 79 2 95 40 89 64 71 26 22 46 1 62 91 76 83 41 9 78 16 63 13 3 28 92 27 49 7 12 96 72 80 23 14 19 18 66 59 87 90 45 73 82 33 74 35 61 55 15 58 11",
"output": "81"
},
{
"input": "100\n100 97 92 12 62 17 19 58 37 26 30 95 31 35 87 10 13 43 98 61 28 89 76 1 23 21 11 22 50 56 91 74 3 24 96 55 64 67 14 4 71 16 18 9 77 68 51 81 32 82 46 88 86 60 29 66 72 85 70 7 53 63 33 45 83 2 25 94 52 93 5 69 20 47 49 54 57 39 34 27 90 80 78 59 40 42 79 6 38 8 48 15 65 73 99 44 41 84 36 75",
"output": "99"
},
{
"input": "100\n22 47 34 65 69 5 68 78 53 54 41 23 80 51 11 8 2 85 81 75 25 58 29 73 30 49 10 71 17 96 76 89 79 20 12 15 55 7 46 32 19 3 82 35 74 44 38 40 92 14 6 50 97 63 45 93 37 18 62 77 87 36 83 9 90 61 57 28 39 43 52 42 24 56 21 84 26 99 88 59 33 70 4 60 98 95 94 100 13 48 66 72 16 31 64 91 1 86 27 67",
"output": "96"
},
{
"input": "100\n41 67 94 18 14 83 59 12 19 54 13 68 75 26 15 65 80 40 23 30 34 78 47 21 63 79 4 70 3 31 86 69 92 10 61 74 97 100 9 99 32 27 91 55 85 52 16 17 28 1 64 29 58 76 98 25 84 7 2 96 20 72 36 46 49 82 93 44 45 6 38 87 57 50 53 35 60 33 8 89 39 42 37 48 62 81 73 43 95 11 66 88 90 22 24 77 71 51 5 56",
"output": "62"
},
{
"input": "100\n1 88 38 56 62 99 39 80 12 33 57 24 28 84 37 42 10 95 83 58 8 40 20 2 30 78 60 79 36 71 51 31 27 65 22 47 6 19 61 94 75 4 74 35 15 23 92 9 70 13 11 59 90 18 66 81 64 72 16 32 34 67 46 91 21 87 77 97 82 41 7 86 26 43 45 3 93 17 52 96 50 63 48 5 53 44 29 25 98 54 49 14 73 69 89 55 76 85 68 100",
"output": "99"
},
{
"input": "100\n22 59 25 77 68 79 32 45 20 28 61 60 38 86 33 10 100 15 53 75 78 39 67 13 66 34 96 4 63 23 73 29 31 35 71 55 16 14 72 56 94 97 17 93 47 84 57 8 21 51 54 85 26 76 49 81 2 92 62 44 91 87 11 24 95 69 5 7 99 6 65 48 70 12 41 18 74 27 42 3 80 30 50 98 58 37 82 89 83 36 40 52 19 9 88 46 43 1 90 64",
"output": "97"
},
{
"input": "100\n12 1 76 78 97 82 59 80 48 8 91 51 54 74 16 10 89 99 83 63 93 90 55 25 30 33 29 6 9 65 92 79 44 39 15 58 37 46 32 19 27 3 75 49 62 71 98 42 69 50 26 81 96 5 7 61 60 21 20 36 18 34 40 4 47 85 64 38 22 84 2 68 11 56 31 66 17 14 95 43 53 35 23 52 70 13 72 45 41 77 73 87 88 94 28 86 24 67 100 57",
"output": "98"
},
{
"input": "100\n66 100 53 88 7 73 54 41 31 42 8 46 65 90 78 14 94 30 79 39 89 5 83 50 38 61 37 86 22 95 60 98 34 57 91 10 75 25 15 43 23 17 96 35 93 48 87 47 56 13 19 9 82 62 67 80 11 55 99 70 18 26 58 85 12 44 16 45 4 49 20 71 92 24 81 2 76 32 6 21 84 36 52 97 59 63 40 51 27 64 68 3 77 72 28 33 29 1 74 69",
"output": "98"
},
{
"input": "100\n56 64 1 95 72 39 9 49 87 29 94 7 32 6 30 48 50 25 31 78 90 45 60 44 80 68 17 20 73 15 75 98 83 13 71 22 36 26 96 88 35 3 85 54 16 41 92 99 69 86 93 33 43 62 77 46 47 37 12 10 18 40 27 4 63 55 28 59 23 34 61 53 76 42 51 91 21 70 8 58 38 19 5 66 84 11 52 24 81 82 79 67 97 65 57 74 2 89 100 14",
"output": "98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "4\n1 2 3 4",
"output": "3"
},
{
"input": "4\n1 2 4 3",
"output": "3"
},
{
"input": "4\n1 3 2 4",
"output": "3"
},
{
"input": "4\n1 3 4 2",
"output": "3"
},
{
"input": "4\n1 4 2 3",
"output": "3"
},
{
"input": "4\n1 4 3 2",
"output": "3"
},
{
"input": "4\n2 1 3 4",
"output": "3"
},
{
"input": "4\n2 1 4 3",
"output": "2"
},
{
"input": "4\n2 4 1 3",
"output": "2"
},
{
"input": "4\n2 4 3 1",
"output": "3"
},
{
"input": "4\n3 1 2 4",
"output": "3"
},
{
"input": "4\n3 1 4 2",
"output": "2"
},
{
"input": "4\n3 2 1 4",
"output": "3"
},
{
"input": "4\n3 2 4 1",
"output": "3"
},
{
"input": "4\n3 4 1 2",
"output": "2"
},
{
"input": "4\n3 4 2 1",
"output": "3"
},
{
"input": "4\n4 1 2 3",
"output": "3"
},
{
"input": "4\n4 1 3 2",
"output": "3"
},
{
"input": "4\n4 2 1 3",
"output": "3"
},
{
"input": "4\n4 2 3 1",
"output": "3"
},
{
"input": "4\n4 3 1 2",
"output": "3"
},
{
"input": "4\n4 3 2 1",
"output": "3"
},
{
"input": "8\n2 5 6 4 8 3 1 7",
"output": "6"
},
{
"input": "5\n2 3 1 5 4",
"output": "3"
},
{
"input": "6\n2 5 3 6 4 1",
"output": "5"
},
{
"input": "6\n5 4 2 6 1 3",
"output": "4"
},
{
"input": "6\n4 2 3 1 6 5",
"output": "4"
},
{
"input": "6\n5 4 2 1 6 3",
"output": "4"
},
{
"input": "9\n7 2 3 4 5 6 1 9 8",
"output": "7"
},
{
"input": "6\n3 2 1 4 6 5",
"output": "4"
},
{
"input": "6\n2 3 4 1 6 5",
"output": "4"
},
{
"input": "10\n5 2 3 4 1 6 7 8 10 9",
"output": "8"
},
{
"input": "6\n5 2 3 1 6 4",
"output": "4"
},
{
"input": "10\n2 9 3 4 1 10 5 6 7 8",
"output": "5"
},
{
"input": "10\n2 3 4 5 6 7 1 8 10 9",
"output": "8"
},
{
"input": "8\n2 3 4 5 1 6 8 7",
"output": "6"
},
{
"input": "6\n2 1 3 4 5 6",
"output": "5"
}
] | 1,585,683,897
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 159
| 171
| 0
|
n=int(input());a=list(map(int,input().split()))
print(abs(a.index(n)-a.index(1))+(max(a.index(n),n-a.index(1)-1) if a.index(n)<a.index(1) else max(a.index(1),n-a.index(n)-1)))
|
Title: Nicholas and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nicholas has an array *a* that contains *n* distinct integers from 1 to *n*. In other words, Nicholas has a permutation of size *n*.
Nicholas want the minimum element (integer 1) and the maximum element (integer *n*) to be as far as possible from each other. He wants to perform exactly one swap in order to maximize the distance between the minimum and the maximum elements. The distance between two elements is considered to be equal to the absolute difference between their positions.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100) — the size of the permutation.
The second line of the input contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*), where *a**i* is equal to the element at the *i*-th position.
Output Specification:
Print a single integer — the maximum possible distance between the minimum and the maximum elements Nicholas can achieve by performing exactly one swap.
Demo Input:
['5\n4 5 1 3 2\n', '7\n1 6 5 3 4 7 2\n', '6\n6 5 4 3 2 1\n']
Demo Output:
['3\n', '6\n', '5\n']
Note:
In the first sample, one may obtain the optimal answer by swapping elements 1 and 2.
In the second sample, the minimum and the maximum elements will be located in the opposite ends of the array if we swap 7 and 2.
In the third sample, the distance between the minimum and the maximum elements is already maximum possible, so we just perform some unnecessary swap, for example, one can swap 5 and 2.
|
```python
n=int(input());a=list(map(int,input().split()))
print(abs(a.index(n)-a.index(1))+(max(a.index(n),n-a.index(1)-1) if a.index(n)<a.index(1) else max(a.index(1),n-a.index(n)-1)))
```
| 3
|
|
828
|
A
|
Restaurant Tables
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
In a small restaurant there are *a* tables for one person and *b* tables for two persons.
It it known that *n* groups of people come today, each consisting of one or two people.
If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group.
If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group.
You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to.
|
The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables.
The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people.
|
Print the total number of people the restaurant denies service to.
|
[
"4 1 2\n1 2 1 1\n",
"4 1 1\n1 1 2 1\n"
] |
[
"0\n",
"2\n"
] |
In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served.
In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
| 500
|
[
{
"input": "4 1 2\n1 2 1 1",
"output": "0"
},
{
"input": "4 1 1\n1 1 2 1",
"output": "2"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "2 1 2\n2 2",
"output": "0"
},
{
"input": "5 1 3\n1 2 2 2 1",
"output": "1"
},
{
"input": "7 6 1\n1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "10 2 1\n2 1 2 2 2 2 1 2 1 2",
"output": "13"
},
{
"input": "20 4 3\n2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 1 2",
"output": "25"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 1 1\n2",
"output": "0"
},
{
"input": "1 200000 200000\n2",
"output": "0"
},
{
"input": "30 10 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2",
"output": "20"
},
{
"input": "4 1 2\n1 1 1 2",
"output": "2"
},
{
"input": "6 2 3\n1 2 1 1 1 2",
"output": "2"
},
{
"input": "6 1 4\n1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 1 2 2",
"output": "4"
},
{
"input": "6 1 3\n1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 4 2\n2 1 2 2 1 1",
"output": "2"
},
{
"input": "3 10 1\n2 2 2",
"output": "4"
},
{
"input": "5 1 3\n1 1 1 1 2",
"output": "2"
},
{
"input": "5 2 2\n1 1 1 1 2",
"output": "2"
},
{
"input": "15 5 5\n1 1 1 1 1 1 1 1 1 1 2 2 2 2 2",
"output": "10"
},
{
"input": "5 1 2\n1 1 1 1 1",
"output": "0"
},
{
"input": "3 6 1\n2 2 2",
"output": "4"
},
{
"input": "5 3 3\n2 2 2 2 2",
"output": "4"
},
{
"input": "8 3 3\n1 1 1 1 1 1 2 2",
"output": "4"
},
{
"input": "5 1 2\n1 1 1 2 1",
"output": "2"
},
{
"input": "6 1 4\n1 2 2 1 2 2",
"output": "2"
},
{
"input": "2 1 1\n2 2",
"output": "2"
},
{
"input": "2 2 1\n2 2",
"output": "2"
},
{
"input": "5 8 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "3 1 4\n1 1 2",
"output": "0"
},
{
"input": "7 1 5\n1 1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 2 1 1",
"output": "0"
},
{
"input": "6 1 2\n1 1 1 2 2 2",
"output": "6"
},
{
"input": "8 1 4\n2 1 1 1 2 2 2 2",
"output": "6"
},
{
"input": "4 2 3\n2 2 2 2",
"output": "2"
},
{
"input": "3 1 1\n1 1 2",
"output": "2"
},
{
"input": "5 1 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "10 1 5\n1 1 1 1 1 2 2 2 2 2",
"output": "8"
},
{
"input": "5 1 2\n1 1 1 2 2",
"output": "4"
},
{
"input": "4 1 1\n1 1 2 2",
"output": "4"
},
{
"input": "7 1 2\n1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "5 1 4\n2 2 2 2 2",
"output": "2"
},
{
"input": "6 2 3\n1 1 1 1 2 2",
"output": "2"
},
{
"input": "5 2 2\n2 1 2 1 2",
"output": "2"
},
{
"input": "4 6 1\n2 2 2 2",
"output": "6"
},
{
"input": "6 1 4\n1 1 2 1 1 2",
"output": "2"
},
{
"input": "7 1 3\n1 1 1 1 2 2 2",
"output": "6"
},
{
"input": "4 1 2\n1 1 2 2",
"output": "2"
},
{
"input": "3 1 2\n1 1 2",
"output": "0"
},
{
"input": "6 1 3\n1 2 1 1 2 1",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 2 2 2",
"output": "4"
},
{
"input": "10 2 2\n1 1 1 1 2 2 2 2 2 2",
"output": "12"
},
{
"input": "10 1 4\n1 1 1 1 1 2 2 2 2 2",
"output": "10"
},
{
"input": "3 10 2\n2 2 2",
"output": "2"
},
{
"input": "4 3 1\n1 2 2 2",
"output": "4"
},
{
"input": "7 1 4\n1 1 1 1 1 2 2",
"output": "4"
},
{
"input": "3 4 1\n2 2 2",
"output": "4"
},
{
"input": "4 1 2\n2 1 1 2",
"output": "2"
},
{
"input": "10 1 2\n1 1 1 1 1 1 1 1 1 2",
"output": "6"
},
{
"input": "5 1 3\n1 1 2 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 1 2 1",
"output": "2"
},
{
"input": "6 1 4\n1 1 1 2 2 2",
"output": "2"
},
{
"input": "7 1 2\n1 2 1 1 1 1 1",
"output": "3"
},
{
"input": "6 2 2\n1 1 1 1 1 1",
"output": "0"
},
{
"input": "6 1 2\n1 1 2 1 1 1",
"output": "2"
},
{
"input": "3 3 1\n2 2 1",
"output": "2"
},
{
"input": "8 4 2\n1 1 1 1 1 1 1 2",
"output": "2"
},
{
"input": "9 1 4\n1 1 1 1 1 2 2 2 2",
"output": "8"
},
{
"input": "5 10 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "3 5 1\n2 2 2",
"output": "4"
},
{
"input": "5 100 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "4 1 2\n1 1 1 1",
"output": "0"
},
{
"input": "4 1 1\n1 1 1 1",
"output": "1"
},
{
"input": "7 2 2\n1 1 1 1 1 1 1",
"output": "1"
}
] | 1,600,818,494
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 97
| 202
| 3,993,600
|
n, a, b = map(int, input().split())
t = list(map(int,input().split()))
two_with_one = 0
d = 0
for i in t:
if i == 2:
if b > 0:
b -= 1
else:
d += 2
else:
if a > 0:
a -= 1
elif b > 0:
b -= 1
two_with_one += 1
elif two_with_one > 0:
two_with_one -= 1
else:
d += 1
print(d)
|
Title: Restaurant Tables
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small restaurant there are *a* tables for one person and *b* tables for two persons.
It it known that *n* groups of people come today, each consisting of one or two people.
If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group.
If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group.
You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to.
Input Specification:
The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables.
The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people.
Output Specification:
Print the total number of people the restaurant denies service to.
Demo Input:
['4 1 2\n1 2 1 1\n', '4 1 1\n1 1 2 1\n']
Demo Output:
['0\n', '2\n']
Note:
In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served.
In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
|
```python
n, a, b = map(int, input().split())
t = list(map(int,input().split()))
two_with_one = 0
d = 0
for i in t:
if i == 2:
if b > 0:
b -= 1
else:
d += 2
else:
if a > 0:
a -= 1
elif b > 0:
b -= 1
two_with_one += 1
elif two_with_one > 0:
two_with_one -= 1
else:
d += 1
print(d)
```
| 3
|
|
689
|
C
|
Mike and Chocolate Thieves
|
PROGRAMMING
| 1,700
|
[
"binary search",
"combinatorics",
"math"
] | null | null |
Bad news came to Mike's village, some thieves stole a bunch of chocolates from the local factory! Horrible!
Aside from loving sweet things, thieves from this area are known to be very greedy. So after a thief takes his number of chocolates for himself, the next thief will take exactly *k* times more than the previous one. The value of *k* (*k*<=><=1) is a secret integer known only to them. It is also known that each thief's bag can carry at most *n* chocolates (if they intend to take more, the deal is cancelled) and that there were exactly four thieves involved.
Sadly, only the thieves know the value of *n*, but rumours say that the numbers of ways they could have taken the chocolates (for a fixed *n*, but not fixed *k*) is *m*. Two ways are considered different if one of the thieves (they should be numbered in the order they take chocolates) took different number of chocolates in them.
Mike want to track the thieves down, so he wants to know what their bags are and value of *n* will help him in that. Please find the smallest possible value of *n* or tell him that the rumors are false and there is no such *n*.
|
The single line of input contains the integer *m* (1<=≤<=*m*<=≤<=1015) — the number of ways the thieves might steal the chocolates, as rumours say.
|
Print the only integer *n* — the maximum amount of chocolates that thieves' bags can carry. If there are more than one *n* satisfying the rumors, print the smallest one.
If there is no such *n* for a false-rumoured *m*, print <=-<=1.
|
[
"1\n",
"8\n",
"10\n"
] |
[
"8\n",
"54\n",
"-1\n"
] |
In the first sample case the smallest *n* that leads to exactly one way of stealing chocolates is *n* = 8, whereas the amounts of stealed chocolates are (1, 2, 4, 8) (the number of chocolates stolen by each of the thieves).
In the second sample case the smallest *n* that leads to exactly 8 ways is *n* = 54 with the possibilities: (1, 2, 4, 8), (1, 3, 9, 27), (2, 4, 8, 16), (2, 6, 18, 54), (3, 6, 12, 24), (4, 8, 16, 32), (5, 10, 20, 40), (6, 12, 24, 48).
There is no *n* leading to exactly 10 ways of stealing chocolates in the third sample case.
| 1,500
|
[
{
"input": "1",
"output": "8"
},
{
"input": "8",
"output": "54"
},
{
"input": "10",
"output": "-1"
},
{
"input": "27",
"output": "152"
},
{
"input": "28206",
"output": "139840"
},
{
"input": "32",
"output": "184"
},
{
"input": "115",
"output": "608"
},
{
"input": "81258",
"output": "402496"
},
{
"input": "116003",
"output": "574506"
},
{
"input": "149344197",
"output": "739123875"
},
{
"input": "57857854",
"output": "286347520"
},
{
"input": "999999999999999",
"output": "-1"
},
{
"input": "181023403153",
"output": "895903132760"
},
{
"input": "196071196742",
"output": "970376182648"
},
{
"input": "49729446417673",
"output": "246116048009288"
},
{
"input": "14821870173923",
"output": "73354931125416"
},
{
"input": "29031595887308",
"output": "143680297402952"
},
{
"input": "195980601490039",
"output": "969927770453672"
},
{
"input": "181076658641313",
"output": "896166653569800"
},
{
"input": "166173583620704",
"output": "822409831653228"
},
{
"input": "151269640772354",
"output": "748648714769352"
},
{
"input": "136366565751970",
"output": "674891892852776"
},
{
"input": "121463490731834",
"output": "601135070936200"
},
{
"input": "106559547884220",
"output": "527373954052328"
},
{
"input": "91656472864718",
"output": "453617132135750"
},
{
"input": "184061307002930",
"output": "910937979445720"
},
{
"input": "57857853",
"output": "-1"
},
{
"input": "1000000000000000",
"output": "4949100894494448"
},
{
"input": "375402146575334",
"output": "-1"
},
{
"input": "550368702711851",
"output": "-1"
},
{
"input": "645093839227897",
"output": "-1"
},
{
"input": "431",
"output": "-1"
},
{
"input": "99999",
"output": "-1"
},
{
"input": "2",
"output": "16"
},
{
"input": "3",
"output": "24"
},
{
"input": "4",
"output": "27"
},
{
"input": "5",
"output": "32"
},
{
"input": "6",
"output": "40"
},
{
"input": "7",
"output": "48"
},
{
"input": "13",
"output": "80"
},
{
"input": "999999999999998",
"output": "-1"
},
{
"input": "999999999999997",
"output": "4949100894494440"
},
{
"input": "999999999999996",
"output": "4949100894494432"
},
{
"input": "999999999999995",
"output": "4949100894494424"
},
{
"input": "999999999999993",
"output": "4949100894494416"
},
{
"input": "999999999999991",
"output": "4949100894494400"
},
{
"input": "999999999999992",
"output": "4949100894494408"
},
{
"input": "999999999999994",
"output": "4949100894494421"
},
{
"input": "4235246",
"output": "-1"
},
{
"input": "34",
"output": "-1"
},
{
"input": "998749999999991",
"output": "4942914518376840"
},
{
"input": "999999874999991",
"output": "4949100275856792"
},
{
"input": "987654129875642",
"output": "4887999937625136"
},
{
"input": "237648237648000",
"output": "1176145105832192"
}
] | 1,608,582,093
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 0
| 2,000
| 7,372,800
|
# todos los k posibles
t = [k ** 3 for k in range(2, 2*10**5)]
# leemos de la entrada
s = m = int(input())
# los limites de la busqueda binaria estan entre los valores posibles de m
a, b = 1, 10**15
# mientras no se crucen los punteros
while b - a > 1:
# vamos al medio de la lista
c = (a + b) // 2
# se hace la suma que calcula las formas posibles para cada k fijando c como n
d = sum(int(c / k) for k in t)
# si la cantidad de formas posibles con c es menor que la entrada entonces
# revisamos el lado derecho
if d < m: a = c
# si pasa lo contrario revisamos el lado izquierdo
else: s, b = d, c
# si encontramos un n tal que la sumatoria sea igual a m
# devolvemos ese n mas pequenno, en caso contrario no existe n
# y devolvemos -1
print(a+1 if s == m else -1)
|
Title: Mike and Chocolate Thieves
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bad news came to Mike's village, some thieves stole a bunch of chocolates from the local factory! Horrible!
Aside from loving sweet things, thieves from this area are known to be very greedy. So after a thief takes his number of chocolates for himself, the next thief will take exactly *k* times more than the previous one. The value of *k* (*k*<=><=1) is a secret integer known only to them. It is also known that each thief's bag can carry at most *n* chocolates (if they intend to take more, the deal is cancelled) and that there were exactly four thieves involved.
Sadly, only the thieves know the value of *n*, but rumours say that the numbers of ways they could have taken the chocolates (for a fixed *n*, but not fixed *k*) is *m*. Two ways are considered different if one of the thieves (they should be numbered in the order they take chocolates) took different number of chocolates in them.
Mike want to track the thieves down, so he wants to know what their bags are and value of *n* will help him in that. Please find the smallest possible value of *n* or tell him that the rumors are false and there is no such *n*.
Input Specification:
The single line of input contains the integer *m* (1<=≤<=*m*<=≤<=1015) — the number of ways the thieves might steal the chocolates, as rumours say.
Output Specification:
Print the only integer *n* — the maximum amount of chocolates that thieves' bags can carry. If there are more than one *n* satisfying the rumors, print the smallest one.
If there is no such *n* for a false-rumoured *m*, print <=-<=1.
Demo Input:
['1\n', '8\n', '10\n']
Demo Output:
['8\n', '54\n', '-1\n']
Note:
In the first sample case the smallest *n* that leads to exactly one way of stealing chocolates is *n* = 8, whereas the amounts of stealed chocolates are (1, 2, 4, 8) (the number of chocolates stolen by each of the thieves).
In the second sample case the smallest *n* that leads to exactly 8 ways is *n* = 54 with the possibilities: (1, 2, 4, 8), (1, 3, 9, 27), (2, 4, 8, 16), (2, 6, 18, 54), (3, 6, 12, 24), (4, 8, 16, 32), (5, 10, 20, 40), (6, 12, 24, 48).
There is no *n* leading to exactly 10 ways of stealing chocolates in the third sample case.
|
```python
# todos los k posibles
t = [k ** 3 for k in range(2, 2*10**5)]
# leemos de la entrada
s = m = int(input())
# los limites de la busqueda binaria estan entre los valores posibles de m
a, b = 1, 10**15
# mientras no se crucen los punteros
while b - a > 1:
# vamos al medio de la lista
c = (a + b) // 2
# se hace la suma que calcula las formas posibles para cada k fijando c como n
d = sum(int(c / k) for k in t)
# si la cantidad de formas posibles con c es menor que la entrada entonces
# revisamos el lado derecho
if d < m: a = c
# si pasa lo contrario revisamos el lado izquierdo
else: s, b = d, c
# si encontramos un n tal que la sumatoria sea igual a m
# devolvemos ese n mas pequenno, en caso contrario no existe n
# y devolvemos -1
print(a+1 if s == m else -1)
```
| 0
|
|
454
|
A
|
Little Pony and Crystal Mine
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
|
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
|
Output a crystal of size *n*.
|
[
"3\n",
"5\n",
"7\n"
] |
[
"*D*\nDDD\n*D*\n",
"**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n",
"***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "*D*\nDDD\n*D*"
},
{
"input": "5",
"output": "**D**\n*DDD*\nDDDDD\n*DDD*\n**D**"
},
{
"input": "7",
"output": "***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***"
},
{
"input": "11",
"output": "*****D*****\n****DDD****\n***DDDDD***\n**DDDDDDD**\n*DDDDDDDDD*\nDDDDDDDDDDD\n*DDDDDDDDD*\n**DDDDDDD**\n***DDDDD***\n****DDD****\n*****D*****"
},
{
"input": "15",
"output": "*******D*******\n******DDD******\n*****DDDDD*****\n****DDDDDDD****\n***DDDDDDDDD***\n**DDDDDDDDDDD**\n*DDDDDDDDDDDDD*\nDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDD*\n**DDDDDDDDDDD**\n***DDDDDDDDD***\n****DDDDDDD****\n*****DDDDD*****\n******DDD******\n*******D*******"
},
{
"input": "21",
"output": "**********D**********\n*********DDD*********\n********DDDDD********\n*******DDDDDDD*******\n******DDDDDDDDD******\n*****DDDDDDDDDDD*****\n****DDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDD**\n*DDDDDDDDDDDDDDDDDDD*\nDDDDDDDDDDDDDDDDDDDDD\n*DDDDDDDDDDDDDDDDDDD*\n**DDDDDDDDDDDDDDDDD**\n***DDDDDDDDDDDDDDD***\n****DDDDDDDDDDDDD****\n*****DDDDDDDDDDD*****\n******DDDDDDDDD******\n*******DDDDDDD*******\n********DDDDD********\n*********DDD*********\n**********D**********"
},
{
"input": "33",
"output": "****************D****************\n***************DDD***************\n**************DDDDD**************\n*************DDDDDDD*************\n************DDDDDDDDD************\n***********DDDDDDDDDDD***********\n**********DDDDDDDDDDDDD**********\n*********DDDDDDDDDDDDDDD*********\n********DDDDDDDDDDDDDDDDD********\n*******DDDDDDDDDDDDDDDDDDD*******\n******DDDDDDDDDDDDDDDDDDDDD******\n*****DDDDDDDDDDDDDDDDDDDDDDD*****\n****DDDDDDDDDDDDDDDDDDDDDDDDD****\n***DDDDDDDDDDDDDDDDDDDDDDDDDDD***\n**DDDDDDDDDDDDDDDDDDD..."
},
{
"input": "57",
"output": "****************************D****************************\n***************************DDD***************************\n**************************DDDDD**************************\n*************************DDDDDDD*************************\n************************DDDDDDDDD************************\n***********************DDDDDDDDDDD***********************\n**********************DDDDDDDDDDDDD**********************\n*********************DDDDDDDDDDDDDDD*********************\n********************DDDDDDDDDDDDDDDDD**..."
},
{
"input": "69",
"output": "**********************************D**********************************\n*********************************DDD*********************************\n********************************DDDDD********************************\n*******************************DDDDDDD*******************************\n******************************DDDDDDDDD******************************\n*****************************DDDDDDDDDDD*****************************\n****************************DDDDDDDDDDDDD****************************\n**************..."
},
{
"input": "81",
"output": "****************************************D****************************************\n***************************************DDD***************************************\n**************************************DDDDD**************************************\n*************************************DDDDDDD*************************************\n************************************DDDDDDDDD************************************\n***********************************DDDDDDDDDDD***********************************\n*************..."
},
{
"input": "91",
"output": "*********************************************D*********************************************\n********************************************DDD********************************************\n*******************************************DDDDD*******************************************\n******************************************DDDDDDD******************************************\n*****************************************DDDDDDDDD*****************************************\n****************************************DDDDDD..."
},
{
"input": "101",
"output": "**************************************************D**************************************************\n*************************************************DDD*************************************************\n************************************************DDDDD************************************************\n***********************************************DDDDDDD***********************************************\n**********************************************DDDDDDDDD********************************************..."
}
] | 1,588,501,935
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 78
| 0
|
def solve():
n = int(input())
score = n // 2
lst = []
for i in range(score, -1, -1):
string = "*" * i + "D" * (n - 2*i) + "*" * i
lst.append(string)
for j in lst:
print(j)
for k in lst[1::-1]:
print(k)
solve()
|
Title: Little Pony and Crystal Mine
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle once got a crystal from the Crystal Mine. A crystal of size *n* (*n* is odd; *n*<=><=1) is an *n*<=×<=*n* matrix with a diamond inscribed into it.
You are given an odd integer *n*. You need to draw a crystal of size *n*. The diamond cells of the matrix should be represented by character "D". All other cells of the matrix should be represented by character "*". Look at the examples to understand what you need to draw.
Input Specification:
The only line contains an integer *n* (3<=≤<=*n*<=≤<=101; *n* is odd).
Output Specification:
Output a crystal of size *n*.
Demo Input:
['3\n', '5\n', '7\n']
Demo Output:
['*D*\nDDD\n*D*\n', '**D**\n*DDD*\nDDDDD\n*DDD*\n**D**\n', '***D***\n**DDD**\n*DDDDD*\nDDDDDDD\n*DDDDD*\n**DDD**\n***D***\n']
Note:
none
|
```python
def solve():
n = int(input())
score = n // 2
lst = []
for i in range(score, -1, -1):
string = "*" * i + "D" * (n - 2*i) + "*" * i
lst.append(string)
for j in lst:
print(j)
for k in lst[1::-1]:
print(k)
solve()
```
| 0
|
|
483
|
A
|
Counterexample
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation",
"math",
"number theory"
] | null | null |
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
|
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
|
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
|
[
"2 4\n",
"10 11\n",
"900000000000000009 900000000000000029\n"
] |
[
"2 3 4\n",
"-1\n",
"900000000000000009 900000000000000010 900000000000000021\n"
] |
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
| 500
|
[
{
"input": "2 4",
"output": "2 3 4"
},
{
"input": "10 11",
"output": "-1"
},
{
"input": "900000000000000009 900000000000000029",
"output": "900000000000000009 900000000000000010 900000000000000021"
},
{
"input": "640097987171091791 640097987171091835",
"output": "640097987171091792 640097987171091793 640097987171091794"
},
{
"input": "19534350415104721 19534350415104725",
"output": "19534350415104722 19534350415104723 19534350415104724"
},
{
"input": "933700505788726243 933700505788726280",
"output": "933700505788726244 933700505788726245 933700505788726246"
},
{
"input": "1 3",
"output": "-1"
},
{
"input": "1 4",
"output": "2 3 4"
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "266540997167959130 266540997167959164",
"output": "266540997167959130 266540997167959131 266540997167959132"
},
{
"input": "267367244641009850 267367244641009899",
"output": "267367244641009850 267367244641009851 267367244641009852"
},
{
"input": "268193483524125978 268193483524125993",
"output": "268193483524125978 268193483524125979 268193483524125980"
},
{
"input": "269019726702209402 269019726702209432",
"output": "269019726702209402 269019726702209403 269019726702209404"
},
{
"input": "269845965585325530 269845965585325576",
"output": "269845965585325530 269845965585325531 269845965585325532"
},
{
"input": "270672213058376250 270672213058376260",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492378",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608523",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691962",
"output": "273150934002691930 273150934002691931 273150934002691932"
},
{
"input": "996517375802030516 996517375802030524",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146694",
"output": "997343614685146644 997343614685146645 997343614685146646"
},
{
"input": "998169857863230068 998169857863230083",
"output": "998169857863230068 998169857863230069 998169857863230070"
},
{
"input": "998996101041313492 998996101041313522",
"output": "998996101041313492 998996101041313493 998996101041313494"
},
{
"input": "999822344219396916 999822344219396961",
"output": "999822344219396916 999822344219396917 999822344219396918"
},
{
"input": "648583102513043 648583102513053",
"output": "648583102513044 648583102513045 648583102513046"
},
{
"input": "266540997167959130 266540997167959131",
"output": "-1"
},
{
"input": "267367244641009850 267367244641009850",
"output": "-1"
},
{
"input": "268193483524125978 268193483524125979",
"output": "-1"
},
{
"input": "269019726702209402 269019726702209402",
"output": "-1"
},
{
"input": "269845965585325530 269845965585325530",
"output": "-1"
},
{
"input": "270672213058376250 270672213058376254",
"output": "270672213058376250 270672213058376251 270672213058376252"
},
{
"input": "271498451941492378 271498451941492379",
"output": "-1"
},
{
"input": "272324690824608506 272324690824608508",
"output": "272324690824608506 272324690824608507 272324690824608508"
},
{
"input": "273150934002691930 273150934002691931",
"output": "-1"
},
{
"input": "996517375802030516 996517375802030518",
"output": "996517375802030516 996517375802030517 996517375802030518"
},
{
"input": "997343614685146644 997343614685146644",
"output": "-1"
},
{
"input": "2147483647 2147483649",
"output": "-1"
},
{
"input": "3 5",
"output": "-1"
},
{
"input": "1 7",
"output": "2 3 4"
},
{
"input": "9 12",
"output": "9 11 12"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "11 13",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
}
] | 1,415,027,639
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 62
| 0
|
import sys
import math
def nod(a, b):
if(b == 0):
return a
r = a % b
return nod(b, r)
l, r = [int(x) for x in (sys.stdin.readline()).split()]
res = []
if(r - l < 2):
print(-1)
else:
res.append(str(l))
res.append(str(l + 1))
for i in range(l + 2, r + 1):
if(nod(l, i) != 1 and nod(l + 1, i) == 1):
res.append(str(i))
break
print(" ".join(res))
|
Title: Counterexample
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has recently learned about coprime numbers. A pair of numbers {*a*,<=*b*} is called coprime if the maximum number that divides both *a* and *b* is equal to one.
Your friend often comes up with different statements. He has recently supposed that if the pair (*a*,<=*b*) is coprime and the pair (*b*,<=*c*) is coprime, then the pair (*a*,<=*c*) is coprime.
You want to find a counterexample for your friend's statement. Therefore, your task is to find three distinct numbers (*a*,<=*b*,<=*c*), for which the statement is false, and the numbers meet the condition *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*.
More specifically, you need to find three numbers (*a*,<=*b*,<=*c*), such that *l*<=≤<=*a*<=<<=*b*<=<<=*c*<=≤<=*r*, pairs (*a*,<=*b*) and (*b*,<=*c*) are coprime, and pair (*a*,<=*c*) is not coprime.
Input Specification:
The single line contains two positive space-separated integers *l*, *r* (1<=≤<=*l*<=≤<=*r*<=≤<=1018; *r*<=-<=*l*<=≤<=50).
Output Specification:
Print three positive space-separated integers *a*, *b*, *c* — three distinct numbers (*a*,<=*b*,<=*c*) that form the counterexample. If there are several solutions, you are allowed to print any of them. The numbers must be printed in ascending order.
If the counterexample does not exist, print the single number -1.
Demo Input:
['2 4\n', '10 11\n', '900000000000000009 900000000000000029\n']
Demo Output:
['2 3 4\n', '-1\n', '900000000000000009 900000000000000010 900000000000000021\n']
Note:
In the first sample pair (2, 4) is not coprime and pairs (2, 3) and (3, 4) are.
In the second sample you cannot form a group of three distinct integers, so the answer is -1.
In the third sample it is easy to see that numbers 900000000000000009 and 900000000000000021 are divisible by three.
|
```python
import sys
import math
def nod(a, b):
if(b == 0):
return a
r = a % b
return nod(b, r)
l, r = [int(x) for x in (sys.stdin.readline()).split()]
res = []
if(r - l < 2):
print(-1)
else:
res.append(str(l))
res.append(str(l + 1))
for i in range(l + 2, r + 1):
if(nod(l, i) != 1 and nod(l + 1, i) == 1):
res.append(str(i))
break
print(" ".join(res))
```
| 0
|
|
900
|
A
|
Find Extra One
|
PROGRAMMING
| 800
|
[
"geometry",
"implementation"
] | null | null |
You have *n* distinct points on a plane, none of them lie on *OY* axis. Check that there is a point after removal of which the remaining points are located on one side of the *OY* axis.
|
The first line contains a single positive integer *n* (2<=≤<=*n*<=≤<=105).
The following *n* lines contain coordinates of the points. The *i*-th of these lines contains two single integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109, *x**i*<=≠<=0). No two points coincide.
|
Print "Yes" if there is such a point, "No" — otherwise.
You can print every letter in any case (upper or lower).
|
[
"3\n1 1\n-1 -1\n2 -1\n",
"4\n1 1\n2 2\n-1 1\n-2 2\n",
"3\n1 2\n2 1\n4 60\n"
] |
[
"Yes",
"No",
"Yes"
] |
In the first example the second point can be removed.
In the second example there is no suitable for the condition point.
In the third example any point can be removed.
| 500
|
[
{
"input": "3\n1 1\n-1 -1\n2 -1",
"output": "Yes"
},
{
"input": "4\n1 1\n2 2\n-1 1\n-2 2",
"output": "No"
},
{
"input": "3\n1 2\n2 1\n4 60",
"output": "Yes"
},
{
"input": "10\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n-1 -1",
"output": "Yes"
},
{
"input": "2\n1000000000 -1000000000\n1000000000 1000000000",
"output": "Yes"
},
{
"input": "23\n-1 1\n-1 2\n-2 4\n-7 -8\n-3 3\n-9 -14\n-5 3\n-6 2\n-7 11\n-4 4\n-8 5\n1 1\n-1 -1\n-1 -2\n-2 -4\n-7 8\n-3 -3\n-9 14\n-5 -3\n-6 -2\n-7 -11\n-4 -4\n-8 -5",
"output": "Yes"
},
{
"input": "4\n-1000000000 -1000000000\n1000000000 1000000000\n-1000000000 1000000000\n1000000000 -1000000000",
"output": "No"
},
{
"input": "2\n-1000000000 1000000000\n-1000000000 -1000000000",
"output": "Yes"
},
{
"input": "5\n-1 -1\n-2 2\n2 2\n2 -2\n3 2",
"output": "No"
},
{
"input": "2\n1 0\n-1 0",
"output": "Yes"
},
{
"input": "4\n-1 1\n-1 2\n-1 3\n-1 4",
"output": "Yes"
},
{
"input": "2\n-1 0\n1 0",
"output": "Yes"
},
{
"input": "2\n1 2\n-1 2",
"output": "Yes"
},
{
"input": "2\n8 0\n7 0",
"output": "Yes"
},
{
"input": "6\n-1 0\n-2 0\n-1 -1\n-1 5\n1 0\n1 1",
"output": "No"
},
{
"input": "4\n1 0\n2 0\n-1 0\n-2 0",
"output": "No"
},
{
"input": "4\n-2 0\n-1 0\n1 0\n2 0",
"output": "No"
},
{
"input": "2\n1 1\n-1 1",
"output": "Yes"
},
{
"input": "4\n-1 0\n-2 0\n1 0\n2 0",
"output": "No"
},
{
"input": "2\n4 3\n-4 -2",
"output": "Yes"
},
{
"input": "4\n1 0\n2 0\n-1 1\n-1 2",
"output": "No"
},
{
"input": "5\n1 1\n2 1\n3 1\n-1 1\n-2 1",
"output": "No"
},
{
"input": "2\n1 1\n-1 -1",
"output": "Yes"
},
{
"input": "4\n1 2\n1 0\n1 -2\n-1 2",
"output": "Yes"
},
{
"input": "5\n-2 3\n-3 3\n4 2\n3 2\n1 2",
"output": "No"
},
{
"input": "3\n2 0\n3 0\n4 0",
"output": "Yes"
},
{
"input": "5\n-3 1\n-2 1\n-1 1\n1 1\n2 1",
"output": "No"
},
{
"input": "4\n-3 0\n1 0\n2 0\n3 0",
"output": "Yes"
},
{
"input": "2\n1 0\n-1 1",
"output": "Yes"
},
{
"input": "3\n-1 0\n1 0\n2 0",
"output": "Yes"
},
{
"input": "5\n1 0\n3 0\n-1 0\n-6 0\n-4 1",
"output": "No"
},
{
"input": "5\n-1 2\n-2 2\n-3 1\n1 2\n2 3",
"output": "No"
},
{
"input": "3\n1 0\n-1 0\n-2 0",
"output": "Yes"
},
{
"input": "4\n1 0\n2 0\n3 1\n4 1",
"output": "Yes"
},
{
"input": "4\n1 0\n1 2\n1 3\n-1 5",
"output": "Yes"
},
{
"input": "4\n2 2\n2 5\n-2 3\n-2 0",
"output": "No"
},
{
"input": "4\n1 1\n-1 1\n-1 0\n-1 -1",
"output": "Yes"
},
{
"input": "4\n2 0\n3 0\n-3 -3\n-3 -4",
"output": "No"
},
{
"input": "4\n-1 0\n-2 0\n-3 0\n-4 0",
"output": "Yes"
},
{
"input": "2\n-1 1\n1 1",
"output": "Yes"
},
{
"input": "5\n1 1\n2 2\n3 3\n-4 -4\n-5 -5",
"output": "No"
},
{
"input": "5\n2 0\n3 0\n4 0\n5 0\n6 0",
"output": "Yes"
},
{
"input": "2\n-1 2\n1 2",
"output": "Yes"
},
{
"input": "4\n1 1\n2 1\n-3 0\n-4 0",
"output": "No"
},
{
"input": "4\n-1 0\n-2 0\n3 0\n4 0",
"output": "No"
},
{
"input": "3\n3 0\n2 0\n1 0",
"output": "Yes"
},
{
"input": "4\n-2 0\n-3 0\n1 -1\n3 1",
"output": "No"
},
{
"input": "3\n-1 -1\n1 1\n2 2",
"output": "Yes"
},
{
"input": "4\n-2 0\n-1 0\n2 0\n1 0",
"output": "No"
},
{
"input": "2\n-3 5\n3 5",
"output": "Yes"
},
{
"input": "2\n-1 5\n1 5",
"output": "Yes"
},
{
"input": "4\n2 0\n3 0\n-2 0\n-3 0",
"output": "No"
},
{
"input": "3\n-1 1\n1 1\n1 -1",
"output": "Yes"
},
{
"input": "2\n1 0\n2 0",
"output": "Yes"
},
{
"input": "4\n-1 1\n-2 1\n2 -1\n3 -1",
"output": "No"
},
{
"input": "5\n1 0\n2 0\n3 0\n-1 0\n-2 0",
"output": "No"
},
{
"input": "4\n-3 0\n-4 0\n-5 0\n-6 0",
"output": "Yes"
},
{
"input": "6\n-3 0\n-2 0\n-1 0\n1 0\n2 0\n3 0",
"output": "No"
},
{
"input": "4\n5 0\n5 1\n6 0\n6 1",
"output": "Yes"
}
] | 1,521,062,384
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 265
| 9,318,400
|
x = [int(input().split()[0]) for _ in range(int(input()))]
x = [i//abs(i) for i in x]
print("Yes" if min(x.count(-1), x.count(1))<2 else "No")
|
Title: Find Extra One
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have *n* distinct points on a plane, none of them lie on *OY* axis. Check that there is a point after removal of which the remaining points are located on one side of the *OY* axis.
Input Specification:
The first line contains a single positive integer *n* (2<=≤<=*n*<=≤<=105).
The following *n* lines contain coordinates of the points. The *i*-th of these lines contains two single integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109, *x**i*<=≠<=0). No two points coincide.
Output Specification:
Print "Yes" if there is such a point, "No" — otherwise.
You can print every letter in any case (upper or lower).
Demo Input:
['3\n1 1\n-1 -1\n2 -1\n', '4\n1 1\n2 2\n-1 1\n-2 2\n', '3\n1 2\n2 1\n4 60\n']
Demo Output:
['Yes', 'No', 'Yes']
Note:
In the first example the second point can be removed.
In the second example there is no suitable for the condition point.
In the third example any point can be removed.
|
```python
x = [int(input().split()[0]) for _ in range(int(input()))]
x = [i//abs(i) for i in x]
print("Yes" if min(x.count(-1), x.count(1))<2 else "No")
```
| 3
|
|
41
|
A
|
Translation
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Translation
|
2
|
256
|
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
|
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
|
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
|
[
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,654,254,171
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 92
| 0
|
s = input()
t = input()
isSame = True
for i in range(len(s)):
if s[i] != t[len(t) - 1 - i]:
isSame = False
break
if isSame:
print("YES")
else:
print("NO")
|
Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
s = input()
t = input()
isSame = True
for i in range(len(s)):
if s[i] != t[len(t) - 1 - i]:
isSame = False
break
if isSame:
print("YES")
else:
print("NO")
```
| 3.977
|
1,007
|
A
|
Reorder the Array
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"data structures",
"math",
"sortings",
"two pointers"
] | null | null |
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
|
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
|
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
|
[
"7\n10 1 1 1 5 5 3\n",
"5\n1 1 1 1 1\n"
] |
[
"4\n",
"0\n"
] |
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
| 500
|
[
{
"input": "7\n10 1 1 1 5 5 3",
"output": "4"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "6\n300000000 200000000 300000000 200000000 1000000000 300000000",
"output": "3"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "7\n3 5 2 2 5 2 4",
"output": "4"
},
{
"input": "5\n1 5 4 2 3",
"output": "4"
}
] | 1,591,719,800
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 109
| 409,600
|
from collections import Counter
n = int(input())
arr = list(map(int, input().split()))
c = Counter(arr)
Max = 0
print(c)
for key, val in c.items():
if val > Max:
Max = val
print(n-Max)
|
Title: Reorder the Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
Input Specification:
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
Output Specification:
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
Demo Input:
['7\n10 1 1 1 5 5 3\n', '5\n1 1 1 1 1\n']
Demo Output:
['4\n', '0\n']
Note:
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
|
```python
from collections import Counter
n = int(input())
arr = list(map(int, input().split()))
c = Counter(arr)
Max = 0
print(c)
for key, val in c.items():
if val > Max:
Max = val
print(n-Max)
```
| 0
|
|
160
|
A
|
Twins
|
PROGRAMMING
| 900
|
[
"greedy",
"sortings"
] | null | null |
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
|
In the single line print the single number — the minimum needed number of coins.
|
[
"2\n3 3\n",
"3\n2 1 2\n"
] |
[
"2\n",
"2\n"
] |
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
| 500
|
[
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "5\n4 2 2 2 2",
"output": "3"
},
{
"input": "7\n1 10 1 2 1 1 1",
"output": "1"
},
{
"input": "5\n3 2 3 3 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "4"
},
{
"input": "7\n10 10 5 5 5 5 1",
"output": "3"
},
{
"input": "20\n2 1 2 2 2 1 1 2 1 2 2 1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "20\n4 2 4 4 3 4 2 2 4 2 3 1 1 2 2 3 3 3 1 4",
"output": "8"
},
{
"input": "20\n35 26 41 40 45 46 22 26 39 23 11 15 47 42 18 15 27 10 45 40",
"output": "8"
},
{
"input": "20\n7 84 100 10 31 35 41 2 63 44 57 4 63 11 23 49 98 71 16 90",
"output": "6"
},
{
"input": "50\n19 2 12 26 17 27 10 26 17 17 5 24 11 15 3 9 16 18 19 1 25 23 18 6 2 7 25 7 21 25 13 29 16 9 25 3 14 30 18 4 10 28 6 10 8 2 2 4 8 28",
"output": "14"
},
{
"input": "70\n2 18 18 47 25 5 14 9 19 46 36 49 33 32 38 23 32 39 8 29 31 17 24 21 10 15 33 37 46 21 22 11 20 35 39 13 11 30 28 40 39 47 1 17 24 24 21 46 12 2 20 43 8 16 44 11 45 10 13 44 31 45 45 46 11 10 33 35 23 42",
"output": "22"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "51"
},
{
"input": "100\n1 2 2 1 2 1 1 2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 1 1 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 1 1 2 1 1 1 1 2 2 2 2",
"output": "37"
},
{
"input": "100\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2",
"output": "36"
},
{
"input": "100\n5 5 4 3 5 1 2 5 1 1 3 5 4 4 1 1 1 1 5 4 4 5 1 5 5 1 2 1 3 1 5 1 3 3 3 2 2 2 1 1 5 1 3 4 1 1 3 2 5 2 2 5 5 4 4 1 3 4 3 3 4 5 3 3 3 1 2 1 4 2 4 4 1 5 1 3 5 5 5 5 3 4 4 3 1 2 5 2 3 5 4 2 4 5 3 2 4 2 4 3",
"output": "33"
},
{
"input": "100\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2",
"output": "30"
},
{
"input": "100\n16 9 11 8 11 4 9 17 4 8 4 10 9 10 6 3 3 15 1 6 1 15 12 18 6 14 13 18 1 7 18 4 10 7 10 12 3 16 14 4 10 8 10 7 19 13 15 1 4 8 16 10 6 4 3 16 11 10 7 3 4 16 1 20 1 11 4 16 10 7 7 12 18 19 3 17 19 3 4 19 2 12 11 3 18 20 2 2 14 4 20 13 13 11 16 20 19 14 7 2",
"output": "29"
},
{
"input": "100\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1",
"output": "30"
},
{
"input": "100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52",
"output": "29"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "30"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n4 1 2 3",
"output": "2"
},
{
"input": "5\n2 2 2 4 4",
"output": "2"
},
{
"input": "4\n100 99 99 100",
"output": "2"
}
] | 1,693,582,837
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 29
| 124
| 1,331,200
|
n = int(input())
b = sorted(list(map(int, input().split())))[::-1]
a = []
i = 0
while sum(b) >= sum(a):
a.append(b[i])
b[i] = 0
i += 1
print(len(a))
|
Title: Twins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
Output Specification:
In the single line print the single number — the minimum needed number of coins.
Demo Input:
['2\n3 3\n', '3\n2 1 2\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2.
|
```python
n = int(input())
b = sorted(list(map(int, input().split())))[::-1]
a = []
i = 0
while sum(b) >= sum(a):
a.append(b[i])
b[i] = 0
i += 1
print(len(a))
```
| 3
|
|
16
|
B
|
Burglar and Matches
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation",
"sortings"
] |
B. Burglar and Matches
|
0
|
64
|
A burglar got into a matches warehouse and wants to steal as many matches as possible. In the warehouse there are *m* containers, in the *i*-th container there are *a**i* matchboxes, and each matchbox contains *b**i* matches. All the matchboxes are of the same size. The burglar's rucksack can hold *n* matchboxes exactly. Your task is to find out the maximum amount of matches that a burglar can carry away. He has no time to rearrange matches in the matchboxes, that's why he just chooses not more than *n* matchboxes so that the total amount of matches in them is maximal.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2·108) and integer *m* (1<=≤<=*m*<=≤<=20). The *i*<=+<=1-th line contains a pair of numbers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=108,<=1<=≤<=*b**i*<=≤<=10). All the input numbers are integer.
|
Output the only number — answer to the problem.
|
[
"7 3\n5 10\n2 5\n3 6\n",
"3 3\n1 3\n2 2\n3 1\n"
] |
[
"62\n",
"7\n"
] |
none
| 0
|
[
{
"input": "7 3\n5 10\n2 5\n3 6",
"output": "62"
},
{
"input": "3 3\n1 3\n2 2\n3 1",
"output": "7"
},
{
"input": "1 1\n1 2",
"output": "2"
},
{
"input": "1 2\n1 9\n1 6",
"output": "9"
},
{
"input": "1 10\n1 1\n1 9\n1 3\n1 9\n1 7\n1 10\n1 4\n1 7\n1 3\n1 1",
"output": "10"
},
{
"input": "2 1\n2 1",
"output": "2"
},
{
"input": "2 2\n2 4\n1 4",
"output": "8"
},
{
"input": "2 3\n1 7\n1 2\n1 5",
"output": "12"
},
{
"input": "4 1\n2 2",
"output": "4"
},
{
"input": "4 2\n1 10\n4 4",
"output": "22"
},
{
"input": "4 3\n1 4\n6 4\n1 7",
"output": "19"
},
{
"input": "5 1\n10 5",
"output": "25"
},
{
"input": "5 2\n3 9\n2 2",
"output": "31"
},
{
"input": "5 5\n2 9\n3 1\n2 1\n1 8\n2 8",
"output": "42"
},
{
"input": "5 10\n1 3\n1 2\n1 9\n1 10\n1 1\n1 5\n1 10\n1 2\n1 3\n1 7",
"output": "41"
},
{
"input": "10 1\n9 4",
"output": "36"
},
{
"input": "10 2\n14 3\n1 3",
"output": "30"
},
{
"input": "10 7\n4 8\n1 10\n1 10\n1 2\n3 3\n1 3\n1 10",
"output": "71"
},
{
"input": "10 10\n1 8\n2 10\n1 9\n1 1\n1 9\n1 6\n1 4\n2 5\n1 2\n1 4",
"output": "70"
},
{
"input": "10 4\n1 5\n5 2\n1 9\n3 3",
"output": "33"
},
{
"input": "100 5\n78 6\n29 10\n3 6\n7 3\n2 4",
"output": "716"
},
{
"input": "1000 7\n102 10\n23 6\n79 4\n48 1\n34 10\n839 8\n38 4",
"output": "8218"
},
{
"input": "10000 10\n336 2\n2782 5\n430 10\n1893 7\n3989 10\n2593 8\n165 6\n1029 2\n2097 4\n178 10",
"output": "84715"
},
{
"input": "100000 3\n2975 2\n35046 4\n61979 9",
"output": "703945"
},
{
"input": "1000000 4\n314183 9\n304213 4\n16864 5\n641358 9",
"output": "8794569"
},
{
"input": "10000000 10\n360313 10\n416076 1\n435445 9\n940322 7\n1647581 7\n4356968 10\n3589256 2\n2967933 5\n2747504 7\n1151633 3",
"output": "85022733"
},
{
"input": "100000000 7\n32844337 7\n11210848 7\n47655987 1\n33900472 4\n9174763 2\n32228738 10\n29947408 5",
"output": "749254060"
},
{
"input": "200000000 10\n27953106 7\n43325979 4\n4709522 1\n10975786 4\n67786538 8\n48901838 7\n15606185 6\n2747583 1\n100000000 1\n633331 3",
"output": "1332923354"
},
{
"input": "200000000 9\n17463897 9\n79520463 1\n162407 4\n41017993 8\n71054118 4\n9447587 2\n5298038 9\n3674560 7\n20539314 5",
"output": "996523209"
},
{
"input": "200000000 8\n6312706 6\n2920548 2\n16843192 3\n1501141 2\n13394704 6\n10047725 10\n4547663 6\n54268518 6",
"output": "630991750"
},
{
"input": "200000000 7\n25621043 2\n21865270 1\n28833034 1\n22185073 5\n100000000 2\n13891017 9\n61298710 8",
"output": "931584598"
},
{
"input": "200000000 6\n7465600 6\n8453505 10\n4572014 8\n8899499 3\n86805622 10\n64439238 6",
"output": "1447294907"
},
{
"input": "200000000 5\n44608415 6\n100000000 9\n51483223 9\n44136047 1\n52718517 1",
"output": "1634907859"
},
{
"input": "200000000 4\n37758556 10\n100000000 6\n48268521 3\n20148178 10",
"output": "1305347138"
},
{
"input": "200000000 3\n65170000 7\n20790088 1\n74616133 4",
"output": "775444620"
},
{
"input": "200000000 2\n11823018 6\n100000000 9",
"output": "970938108"
},
{
"input": "200000000 1\n100000000 6",
"output": "600000000"
},
{
"input": "200000000 10\n12097724 9\n41745972 5\n26982098 9\n14916995 7\n21549986 7\n3786630 9\n8050858 7\n27994924 4\n18345001 5\n8435339 5",
"output": "1152034197"
},
{
"input": "200000000 10\n55649 8\n10980981 9\n3192542 8\n94994808 4\n3626106 1\n100000000 6\n5260110 9\n4121453 2\n15125061 4\n669569 6",
"output": "1095537357"
},
{
"input": "10 20\n1 7\n1 7\n1 8\n1 3\n1 10\n1 7\n1 7\n1 9\n1 3\n1 1\n1 2\n1 1\n1 3\n1 10\n1 9\n1 8\n1 8\n1 6\n1 7\n1 5",
"output": "83"
},
{
"input": "10000000 20\n4594 7\n520836 8\n294766 6\n298672 4\n142253 6\n450626 1\n1920034 9\n58282 4\n1043204 1\n683045 1\n1491746 5\n58420 4\n451217 2\n129423 4\n246113 5\n190612 8\n912923 6\n473153 6\n783733 6\n282411 10",
"output": "54980855"
},
{
"input": "200000000 20\n15450824 5\n839717 10\n260084 8\n1140850 8\n28744 6\n675318 3\n25161 2\n5487 3\n6537698 9\n100000000 5\n7646970 9\n16489 6\n24627 3\n1009409 5\n22455 1\n25488456 4\n484528 9\n32663641 3\n750968 4\n5152 6",
"output": "939368573"
},
{
"input": "200000000 20\n16896 2\n113 3\n277 2\n299 7\n69383562 2\n3929 8\n499366 4\n771846 5\n9 4\n1278173 7\n90 2\n54 7\n72199858 10\n17214 5\n3 10\n1981618 3\n3728 2\n141 8\n2013578 9\n51829246 5",
"output": "1158946383"
},
{
"input": "200000000 20\n983125 2\n7453215 9\n9193588 2\n11558049 7\n28666199 1\n34362244 1\n5241493 5\n15451270 4\n19945845 8\n6208681 3\n38300385 7\n6441209 8\n21046742 7\n577198 10\n3826434 8\n9764276 8\n6264675 7\n8567063 3\n3610303 4\n2908232 3",
"output": "1131379312"
},
{
"input": "10 15\n1 6\n2 6\n3 4\n1 3\n1 2\n1 5\n1 6\n1 2\n2 9\n1 10\n1 3\n1 7\n1 8\n1 2\n2 9",
"output": "79"
},
{
"input": "10000000 15\n111 5\n914124 3\n3 9\n177790 1\n2352 3\n32138 9\n104477 1\n1223 4\n18 6\n6655580 4\n57643 10\n94309 2\n37 1\n227002 10\n1733193 7",
"output": "45116295"
},
{
"input": "200000000 15\n7069868 1\n5567826 8\n2310059 10\n13539782 7\n38420939 4\n29911411 8\n52256316 1\n12265839 9\n2074265 1\n24896428 9\n72470695 5\n3236301 1\n3890243 2\n65168965 8\n65724 6",
"output": "1489289257"
},
{
"input": "200000000 15\n12044094 7\n2475138 10\n944451 7\n4854766 2\n3809145 10\n7727571 2\n43908937 6\n2745883 1\n427511 2\n100000000 5\n190914 6\n554889 3\n288798 4\n1848572 5\n893874 3",
"output": "961871671"
},
{
"input": "200000000 15\n6334191 7\n1927941 4\n5175933 10\n468389 1\n433043 10\n6863198 5\n7480646 4\n14774279 10\n2921129 8\n18325627 7\n6973152 9\n8277324 9\n21522856 2\n2058070 1\n2444742 4",
"output": "664376069"
}
] | 1,574,103,863
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 218
| 0
|
import sys
input = sys.stdin.readline
read_tuple = lambda _type: map(_type, input().split(' '))
def solve():
n, m = read_tuple(int)
c = {}
for _ in range(m):
a, b = read_tuple(int)
c[b] = c.get(b, 0) + a
ans = 0
for b_i in sorted(c, reverse=True):
if n and c[b_i] <= n:
ans += b_i * c[b_i]
n -= c[b_i]
elif n and c[b_i] > n:
ans += b_i * n
n = 0
print(ans)
if __name__ == '__main__':
solve()
|
Title: Burglar and Matches
Time Limit: 0 seconds
Memory Limit: 64 megabytes
Problem Description:
A burglar got into a matches warehouse and wants to steal as many matches as possible. In the warehouse there are *m* containers, in the *i*-th container there are *a**i* matchboxes, and each matchbox contains *b**i* matches. All the matchboxes are of the same size. The burglar's rucksack can hold *n* matchboxes exactly. Your task is to find out the maximum amount of matches that a burglar can carry away. He has no time to rearrange matches in the matchboxes, that's why he just chooses not more than *n* matchboxes so that the total amount of matches in them is maximal.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2·108) and integer *m* (1<=≤<=*m*<=≤<=20). The *i*<=+<=1-th line contains a pair of numbers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=108,<=1<=≤<=*b**i*<=≤<=10). All the input numbers are integer.
Output Specification:
Output the only number — answer to the problem.
Demo Input:
['7 3\n5 10\n2 5\n3 6\n', '3 3\n1 3\n2 2\n3 1\n']
Demo Output:
['62\n', '7\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
read_tuple = lambda _type: map(_type, input().split(' '))
def solve():
n, m = read_tuple(int)
c = {}
for _ in range(m):
a, b = read_tuple(int)
c[b] = c.get(b, 0) + a
ans = 0
for b_i in sorted(c, reverse=True):
if n and c[b_i] <= n:
ans += b_i * c[b_i]
n -= c[b_i]
elif n and c[b_i] > n:
ans += b_i * n
n = 0
print(ans)
if __name__ == '__main__':
solve()
```
| 3
|
485
|
A
|
Factory
|
PROGRAMMING
| 1,400
|
[
"implementation",
"math",
"matrices"
] | null | null |
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory.
The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*).
Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
|
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
|
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
|
[
"1 5\n",
"3 6\n"
] |
[
"No\n",
"Yes\n"
] |
none
| 1,000
|
[
{
"input": "1 5",
"output": "No"
},
{
"input": "3 6",
"output": "Yes"
},
{
"input": "1 8",
"output": "Yes"
},
{
"input": "2 3",
"output": "No"
},
{
"input": "3 24",
"output": "Yes"
},
{
"input": "1 1",
"output": "Yes"
},
{
"input": "100000 100000",
"output": "Yes"
},
{
"input": "1 99989",
"output": "No"
},
{
"input": "512 2",
"output": "Yes"
},
{
"input": "100 24",
"output": "No"
},
{
"input": "1 100000",
"output": "No"
},
{
"input": "100000 1",
"output": "Yes"
},
{
"input": "3 99929",
"output": "No"
},
{
"input": "99961 99971",
"output": "No"
},
{
"input": "1 65536",
"output": "Yes"
},
{
"input": "4 65536",
"output": "Yes"
},
{
"input": "3 65536",
"output": "Yes"
},
{
"input": "32768 65536",
"output": "Yes"
},
{
"input": "65535 65536",
"output": "Yes"
},
{
"input": "1 65535",
"output": "No"
},
{
"input": "98812 100000",
"output": "No"
},
{
"input": "10 5",
"output": "Yes"
},
{
"input": "6 8",
"output": "Yes"
}
] | 1,515,023,030
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 9
| 1,000
| 5,529,600
|
a, m = map(int, input().split())
x = a
while x != 0:
x += x % m
x %= m
if x == a:
print('No')
break
else:
print('Yes')
|
Title: Factory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory.
The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*).
Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
Input Specification:
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
Output Specification:
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
Demo Input:
['1 5\n', '3 6\n']
Demo Output:
['No\n', 'Yes\n']
Note:
none
|
```python
a, m = map(int, input().split())
x = a
while x != 0:
x += x % m
x %= m
if x == a:
print('No')
break
else:
print('Yes')
```
| 0
|
|
208
|
A
|
Dubstep
|
PROGRAMMING
| 900
|
[
"strings"
] | null | null |
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
|
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
|
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
|
[
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] |
[
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] |
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
| 500
|
[
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,674,932,514
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 71
| 92
| 0
|
s = input()
n = s.count("WUB")
s = s.replace("WUB", " ", n)
s = s.strip()
l = len(s)
# print(s)
b = False
for i in range(len(s)):
if(s[i] == " "):
if(b == False):
print(s[i], end = "")
b = True
else:
print("", end = "")
else:
b = False
print(s[i], end = "")
|
Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB".
|
```python
s = input()
n = s.count("WUB")
s = s.replace("WUB", " ", n)
s = s.strip()
l = len(s)
# print(s)
b = False
for i in range(len(s)):
if(s[i] == " "):
if(b == False):
print(s[i], end = "")
b = True
else:
print("", end = "")
else:
b = False
print(s[i], end = "")
```
| 3
|
|
445
|
A
|
DZY Loves Chessboard
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"implementation"
] | null | null |
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
|
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
|
[
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] |
[
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] |
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
| 500
|
[
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,684,365,090
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 46
| 0
|
#Keshika Patwari
#Indian Institute Of Technology, Jodhpur
# # 2022
# import sys
# input=sys.stdin.readline
def exe():
f=0
for i in range(n):
for j in range(m):
if(l[i][j]=='.'):
if((i+j)%2==0):
l[i][j]='W'
else:
l[i][j]='B'
for i in range(n-1):
str1=''
#print(l[i])
k=str1.join(l[i])
print(k)
str1=''
k=str1.join(l[n-1])
return k
l=[]
n,m=map(int,input().split())
for i in range(n):
a=list(input())
l.append(a)
print(exe())
|
Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
|
```python
#Keshika Patwari
#Indian Institute Of Technology, Jodhpur
# # 2022
# import sys
# input=sys.stdin.readline
def exe():
f=0
for i in range(n):
for j in range(m):
if(l[i][j]=='.'):
if((i+j)%2==0):
l[i][j]='W'
else:
l[i][j]='B'
for i in range(n-1):
str1=''
#print(l[i])
k=str1.join(l[i])
print(k)
str1=''
k=str1.join(l[n-1])
return k
l=[]
n,m=map(int,input().split())
for i in range(n):
a=list(input())
l.append(a)
print(exe())
```
| 3
|
|
612
|
B
|
HDD is Outdated Technology
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
HDD hard drives group data by sectors. All files are split to fragments and each of them are written in some sector of hard drive. Note the fragments can be written in sectors in arbitrary order.
One of the problems of HDD hard drives is the following: the magnetic head should move from one sector to another to read some file.
Find the time need to read file split to *n* fragments. The *i*-th sector contains the *f**i*-th fragment of the file (1<=≤<=*f**i*<=≤<=*n*). Note different sectors contains the different fragments. At the start the magnetic head is in the position that contains the first fragment. The file are reading in the following manner: at first the first fragment is read, then the magnetic head moves to the sector that contains the second fragment, then the second fragment is read and so on until the *n*-th fragment is read. The fragments are read in the order from the first to the *n*-th.
It takes |*a*<=-<=*b*| time units to move the magnetic head from the sector *a* to the sector *b*. Reading a fragment takes no time.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of fragments.
The second line contains *n* different integers *f**i* (1<=≤<=*f**i*<=≤<=*n*) — the number of the fragment written in the *i*-th sector.
|
Print the only integer — the number of time units needed to read the file.
|
[
"3\n3 1 2\n",
"5\n1 3 5 4 2\n"
] |
[
"3\n",
"10\n"
] |
In the second example the head moves in the following way:
- 1->2 means movement from the sector 1 to the sector 5, i.e. it takes 4 time units - 2->3 means movement from the sector 5 to the sector 2, i.e. it takes 3 time units - 3->4 means movement from the sector 2 to the sector 4, i.e. it takes 2 time units - 4->5 means movement from the sector 4 to the sector 3, i.e. it takes 1 time units
So the answer to the second example is 4 + 3 + 2 + 1 = 10.
| 0
|
[
{
"input": "3\n3 1 2",
"output": "3"
},
{
"input": "5\n1 3 5 4 2",
"output": "10"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "10\n8 2 10 3 4 6 1 7 9 5",
"output": "40"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "10\n1 3 5 7 9 10 8 6 4 2",
"output": "45"
},
{
"input": "100\n11 9 35 34 51 74 16 67 26 21 14 80 84 79 7 61 28 3 53 43 42 5 56 36 69 30 22 88 1 27 65 91 46 31 59 50 17 96 25 18 64 55 78 2 63 24 95 48 93 13 38 76 89 94 15 90 45 81 52 87 83 73 44 49 23 82 85 75 86 33 47 19 58 97 37 20 40 10 92 4 6 68 77 54 71 12 62 60 100 39 41 99 72 29 57 8 70 32 66 98",
"output": "3580"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "99"
},
{
"input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 100 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2",
"output": "4950"
}
] | 1,583,594,381
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 17
| 1,000
| 9,216,000
|
n = int(input())
s = input()
a = s.split(sep=' ')
a = [int(x) for x in a]
# done reading
mins = []
while len(mins) <= n:
minim = min(a)
index = a.index(minim)
mins.append((minim, index))
a[index] = 32000
mins = mins[:-1]
s = 0
for item in range(1, len(mins)):
s += abs(mins[item][1] - mins[item-1][1])
print(s)
|
Title: HDD is Outdated Technology
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
HDD hard drives group data by sectors. All files are split to fragments and each of them are written in some sector of hard drive. Note the fragments can be written in sectors in arbitrary order.
One of the problems of HDD hard drives is the following: the magnetic head should move from one sector to another to read some file.
Find the time need to read file split to *n* fragments. The *i*-th sector contains the *f**i*-th fragment of the file (1<=≤<=*f**i*<=≤<=*n*). Note different sectors contains the different fragments. At the start the magnetic head is in the position that contains the first fragment. The file are reading in the following manner: at first the first fragment is read, then the magnetic head moves to the sector that contains the second fragment, then the second fragment is read and so on until the *n*-th fragment is read. The fragments are read in the order from the first to the *n*-th.
It takes |*a*<=-<=*b*| time units to move the magnetic head from the sector *a* to the sector *b*. Reading a fragment takes no time.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of fragments.
The second line contains *n* different integers *f**i* (1<=≤<=*f**i*<=≤<=*n*) — the number of the fragment written in the *i*-th sector.
Output Specification:
Print the only integer — the number of time units needed to read the file.
Demo Input:
['3\n3 1 2\n', '5\n1 3 5 4 2\n']
Demo Output:
['3\n', '10\n']
Note:
In the second example the head moves in the following way:
- 1->2 means movement from the sector 1 to the sector 5, i.e. it takes 4 time units - 2->3 means movement from the sector 5 to the sector 2, i.e. it takes 3 time units - 3->4 means movement from the sector 2 to the sector 4, i.e. it takes 2 time units - 4->5 means movement from the sector 4 to the sector 3, i.e. it takes 1 time units
So the answer to the second example is 4 + 3 + 2 + 1 = 10.
|
```python
n = int(input())
s = input()
a = s.split(sep=' ')
a = [int(x) for x in a]
# done reading
mins = []
while len(mins) <= n:
minim = min(a)
index = a.index(minim)
mins.append((minim, index))
a[index] = 32000
mins = mins[:-1]
s = 0
for item in range(1, len(mins)):
s += abs(mins[item][1] - mins[item-1][1])
print(s)
```
| 0
|
|
868
|
C
|
Qualification Rounds
|
PROGRAMMING
| 1,500
|
[
"bitmasks",
"brute force",
"constructive algorithms",
"dp"
] | null | null |
Snark and Philip are preparing the problemset for the upcoming pre-qualification round for semi-quarter-finals. They have a bank of *n* problems, and they want to select any non-empty subset of it as a problemset.
*k* experienced teams are participating in the contest. Some of these teams already know some of the problems. To make the contest interesting for them, each of the teams should know at most half of the selected problems.
Determine if Snark and Philip can make an interesting problemset!
|
The first line contains two integers *n*, *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=4) — the number of problems and the number of experienced teams.
Each of the next *n* lines contains *k* integers, each equal to 0 or 1. The *j*-th number in the *i*-th line is 1 if *j*-th team knows *i*-th problem and 0 otherwise.
|
Print "YES" (quotes for clarity), if it is possible to make an interesting problemset, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
|
[
"5 3\n1 0 1\n1 1 0\n1 0 0\n1 0 0\n1 0 0\n",
"3 2\n1 0\n1 1\n0 1\n"
] |
[
"NO\n",
"YES\n"
] |
In the first example you can't make any interesting problemset, because the first team knows all problems.
In the second example you can choose the first and the third problems.
| 1,000
|
[
{
"input": "5 3\n1 0 1\n1 1 0\n1 0 0\n1 0 0\n1 0 0",
"output": "NO"
},
{
"input": "3 2\n1 0\n1 1\n0 1",
"output": "YES"
},
{
"input": "10 2\n1 0\n1 0\n0 0\n1 1\n0 0\n1 1\n0 0\n1 1\n0 1\n0 1",
"output": "YES"
},
{
"input": "10 3\n1 0 0\n0 1 1\n1 0 0\n0 1 0\n0 0 1\n1 0 1\n0 1 1\n1 0 0\n1 1 0\n0 0 0",
"output": "YES"
},
{
"input": "10 4\n1 0 1 0\n1 0 0 1\n1 1 0 1\n1 0 1 1\n1 1 0 1\n1 0 1 0\n0 0 0 0\n0 0 1 0\n1 0 1 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 2\n0 0\n1 0",
"output": "YES"
},
{
"input": "3 3\n1 0 1\n1 0 0\n1 1 1",
"output": "NO"
},
{
"input": "4 4\n0 0 0 0\n1 1 0 0\n1 1 1 1\n1 0 1 1",
"output": "YES"
},
{
"input": "4 1\n1\n1\n0\n0",
"output": "YES"
},
{
"input": "1 4\n0 0 0 0",
"output": "YES"
},
{
"input": "3 3\n0 0 1\n0 1 1\n1 0 0",
"output": "YES"
},
{
"input": "2 3\n0 0 1\n1 0 0",
"output": "YES"
},
{
"input": "1 1\n0",
"output": "YES"
},
{
"input": "2 4\n0 1 1 1\n1 0 0 0",
"output": "YES"
},
{
"input": "2 4\n1 0 1 0\n0 1 0 1",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "2 3\n0 1 0\n0 0 1",
"output": "YES"
},
{
"input": "3 4\n1 0 1 0\n0 1 0 1\n1 1 1 1",
"output": "YES"
},
{
"input": "3 4\n0 0 1 1\n1 1 1 0\n1 1 0 1",
"output": "NO"
},
{
"input": "4 4\n0 0 0 1\n0 0 0 1\n0 0 1 0\n0 0 1 0",
"output": "YES"
},
{
"input": "2 4\n1 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n0 1 0 0",
"output": "YES"
},
{
"input": "2 3\n1 0 0\n0 0 1",
"output": "YES"
},
{
"input": "3 4\n1 0 1 0\n0 1 1 1\n1 0 0 0",
"output": "YES"
},
{
"input": "1 2\n0 0",
"output": "YES"
},
{
"input": "6 3\n0 1 1\n1 0 1\n1 1 1\n0 1 0\n1 0 1\n1 1 0",
"output": "YES"
},
{
"input": "1 4\n0 0 1 1",
"output": "NO"
},
{
"input": "3 3\n1 0 0\n0 1 0\n0 0 1",
"output": "YES"
},
{
"input": "3 4\n1 0 0 0\n1 1 0 0\n0 1 1 1",
"output": "YES"
},
{
"input": "3 2\n0 0\n0 0\n0 0",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n1 0 1 1",
"output": "NO"
},
{
"input": "2 4\n0 0 0 1\n1 0 0 0",
"output": "YES"
},
{
"input": "2 4\n1 0 0 0\n0 1 1 1",
"output": "YES"
},
{
"input": "4 4\n1 1 1 1\n0 0 0 1\n0 0 1 1\n1 0 1 1",
"output": "NO"
},
{
"input": "6 3\n1 0 0\n1 1 1\n1 1 1\n0 1 0\n0 1 0\n1 0 0",
"output": "YES"
},
{
"input": "4 4\n0 1 0 0\n1 1 1 1\n1 1 1 1\n1 0 1 1",
"output": "YES"
},
{
"input": "1 3\n0 0 0",
"output": "YES"
},
{
"input": "3 3\n1 0 0\n0 1 0\n0 0 0",
"output": "YES"
},
{
"input": "2 4\n0 1 1 0\n0 0 0 0",
"output": "YES"
},
{
"input": "1 4\n0 0 0 1",
"output": "NO"
},
{
"input": "4 4\n0 0 0 1\n0 0 0 1\n0 0 1 1\n1 1 1 0",
"output": "YES"
},
{
"input": "2 3\n1 0 0\n0 1 1",
"output": "YES"
},
{
"input": "3 2\n0 1\n0 1\n1 0",
"output": "YES"
},
{
"input": "4 3\n1 1 0\n1 1 1\n0 0 1\n0 0 1",
"output": "YES"
},
{
"input": "2 1\n0\n0",
"output": "YES"
},
{
"input": "2 4\n1 1 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "5 4\n1 1 1 0\n1 1 0 1\n1 0 1 1\n0 1 1 1\n1 1 0 0",
"output": "NO"
},
{
"input": "3 4\n0 1 1 0\n0 1 0 1\n0 0 1 1",
"output": "NO"
},
{
"input": "1 1\n1",
"output": "NO"
},
{
"input": "3 4\n1 0 0 0\n1 0 0 0\n0 1 1 1",
"output": "YES"
},
{
"input": "2 3\n1 1 0\n0 0 1",
"output": "YES"
},
{
"input": "3 3\n0 0 1\n1 1 1\n1 1 0",
"output": "YES"
},
{
"input": "4 4\n0 1 1 1\n1 0 1 0\n1 1 0 1\n1 0 1 0",
"output": "NO"
},
{
"input": "3 3\n1 0 0\n0 0 0\n1 0 0",
"output": "YES"
},
{
"input": "3 4\n1 1 0 0\n1 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 4\n1 0 0 1\n0 0 1 0",
"output": "YES"
},
{
"input": "2 4\n0 0 1 1\n1 1 0 0",
"output": "YES"
},
{
"input": "2 3\n0 0 1\n0 1 0",
"output": "YES"
},
{
"input": "2 3\n1 0 0\n0 1 0",
"output": "YES"
},
{
"input": "3 2\n1 0\n0 1\n0 1",
"output": "YES"
},
{
"input": "3 4\n1 1 0 1\n0 0 1 1\n1 0 1 0",
"output": "NO"
},
{
"input": "3 4\n0 0 1 1\n0 1 1 0\n1 1 0 0",
"output": "YES"
},
{
"input": "3 4\n0 0 0 1\n0 0 0 1\n1 1 1 0",
"output": "YES"
},
{
"input": "3 4\n1 1 1 0\n1 1 0 1\n0 0 1 0",
"output": "YES"
},
{
"input": "8 4\n0 0 0 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n1 1 1 0",
"output": "YES"
},
{
"input": "3 4\n1 0 1 1\n1 1 1 0\n0 1 0 1",
"output": "NO"
},
{
"input": "2 4\n1 1 0 0\n0 0 0 1",
"output": "YES"
},
{
"input": "10 4\n1 0 1 0\n1 0 1 0\n0 1 1 1\n1 0 1 1\n1 1 0 1\n1 0 0 1\n0 1 1 1\n0 0 0 1\n1 1 1 1\n1 0 1 0",
"output": "YES"
},
{
"input": "2 4\n0 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "3 3\n1 1 0\n1 0 1\n0 1 1",
"output": "NO"
},
{
"input": "3 3\n1 1 0\n0 0 1\n1 1 1",
"output": "YES"
},
{
"input": "4 4\n1 1 0 0\n1 0 1 0\n0 1 1 0\n0 0 1 1",
"output": "YES"
},
{
"input": "4 4\n1 0 0 0\n1 0 0 1\n1 0 0 1\n0 1 1 1",
"output": "YES"
},
{
"input": "4 3\n1 0 0\n1 0 0\n1 0 0\n0 1 1",
"output": "YES"
},
{
"input": "2 4\n0 0 1 0\n0 1 0 0",
"output": "YES"
},
{
"input": "1 2\n0 1",
"output": "NO"
},
{
"input": "3 4\n1 1 1 0\n0 0 1 1\n1 1 0 0",
"output": "YES"
},
{
"input": "3 4\n0 0 1 1\n0 1 0 1\n1 0 1 0",
"output": "YES"
},
{
"input": "2 3\n1 0 1\n0 1 0",
"output": "YES"
},
{
"input": "2 4\n0 0 0 0\n0 0 0 0",
"output": "YES"
},
{
"input": "3 4\n0 1 0 1\n0 1 1 0\n1 0 0 1",
"output": "YES"
},
{
"input": "3 4\n0 1 1 0\n1 1 0 0\n0 0 1 1",
"output": "YES"
},
{
"input": "2 4\n1 0 1 0\n0 0 0 1",
"output": "YES"
},
{
"input": "2 3\n0 1 0\n1 0 0",
"output": "YES"
},
{
"input": "4 4\n0 0 1 1\n0 1 1 0\n1 1 0 0\n1 0 0 1",
"output": "YES"
},
{
"input": "10 4\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n0 0 1 1\n1 1 0 0",
"output": "YES"
},
{
"input": "3 3\n1 1 0\n0 1 1\n1 0 1",
"output": "NO"
},
{
"input": "2 3\n0 0 1\n1 1 0",
"output": "YES"
},
{
"input": "4 4\n0 0 0 1\n0 0 1 1\n1 1 0 1\n1 1 1 0",
"output": "YES"
},
{
"input": "3 4\n0 0 1 1\n1 0 1 0\n0 1 0 1",
"output": "YES"
},
{
"input": "5 4\n1 1 1 0\n1 1 0 1\n1 0 1 1\n0 1 1 1\n0 0 1 1",
"output": "NO"
},
{
"input": "3 4\n1 0 0 0\n1 1 0 0\n0 1 1 0",
"output": "YES"
}
] | 1,517,034,605
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 61
| 530
| 6,963,200
|
import math
def l(n,list):
for i in list:
if i>=n:
return True
return False
n,k=map(int,input().split())
a=[1]*k
c=[]
for i in range(n):
b=list(map(int,input().split()))
c.append(b.count(0))
for j in range(k):
a[j]=(a[j] and b[j])
if not(1 in a) and (l(math.ceil(k/2),c)) :
print('YES')
else:
print('NO')
|
Title: Qualification Rounds
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Snark and Philip are preparing the problemset for the upcoming pre-qualification round for semi-quarter-finals. They have a bank of *n* problems, and they want to select any non-empty subset of it as a problemset.
*k* experienced teams are participating in the contest. Some of these teams already know some of the problems. To make the contest interesting for them, each of the teams should know at most half of the selected problems.
Determine if Snark and Philip can make an interesting problemset!
Input Specification:
The first line contains two integers *n*, *k* (1<=≤<=*n*<=≤<=105, 1<=≤<=*k*<=≤<=4) — the number of problems and the number of experienced teams.
Each of the next *n* lines contains *k* integers, each equal to 0 or 1. The *j*-th number in the *i*-th line is 1 if *j*-th team knows *i*-th problem and 0 otherwise.
Output Specification:
Print "YES" (quotes for clarity), if it is possible to make an interesting problemset, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['5 3\n1 0 1\n1 1 0\n1 0 0\n1 0 0\n1 0 0\n', '3 2\n1 0\n1 1\n0 1\n']
Demo Output:
['NO\n', 'YES\n']
Note:
In the first example you can't make any interesting problemset, because the first team knows all problems.
In the second example you can choose the first and the third problems.
|
```python
import math
def l(n,list):
for i in list:
if i>=n:
return True
return False
n,k=map(int,input().split())
a=[1]*k
c=[]
for i in range(n):
b=list(map(int,input().split()))
c.append(b.count(0))
for j in range(k):
a[j]=(a[j] and b[j])
if not(1 in a) and (l(math.ceil(k/2),c)) :
print('YES')
else:
print('NO')
```
| 0
|
|
793
|
D
|
Presents in Bankopolis
|
PROGRAMMING
| 2,100
|
[
"dp",
"graphs",
"shortest paths"
] | null | null |
Bankopolis is an incredible city in which all the *n* crossroads are located on a straight line and numbered from 1 to *n* along it. On each crossroad there is a bank office.
The crossroads are connected with *m* oriented bicycle lanes (the *i*-th lane goes from crossroad *u**i* to crossroad *v**i*), the difficulty of each of the lanes is known.
Oleg the bank client wants to gift happiness and joy to the bank employees. He wants to visit exactly *k* offices, in each of them he wants to gift presents to the employees.
The problem is that Oleg don't want to see the reaction on his gifts, so he can't use a bicycle lane which passes near the office in which he has already presented his gifts (formally, the *i*-th lane passes near the office on the *x*-th crossroad if and only if *min*(*u**i*,<=*v**i*)<=<<=*x*<=<<=*max*(*u**i*,<=*v**i*))). Of course, in each of the offices Oleg can present gifts exactly once. Oleg is going to use exactly *k*<=-<=1 bicycle lane to move between offices. Oleg can start his path from any office and finish it in any office.
Oleg wants to choose such a path among possible ones that the total difficulty of the lanes he will use is minimum possible. Find this minimum possible total difficulty.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=80) — the number of crossroads (and offices) and the number of offices Oleg wants to visit.
The second line contains single integer *m* (0<=≤<=*m*<=≤<=2000) — the number of bicycle lanes in Bankopolis.
The next *m* lines contain information about the lanes.
The *i*-th of these lines contains three integers *u**i*, *v**i* and *c**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, 1<=≤<=*c**i*<=≤<=1000), denoting the crossroads connected by the *i*-th road and its difficulty.
|
In the only line print the minimum possible total difficulty of the lanes in a valid path, or -1 if there are no valid paths.
|
[
"7 4\n4\n1 6 2\n6 2 2\n2 4 2\n2 7 1\n",
"4 3\n4\n2 1 2\n1 3 2\n3 4 2\n4 1 1\n"
] |
[
"6\n",
"3\n"
] |
In the first example Oleg visiting banks by path 1 → 6 → 2 → 4.
Path 1 → 6 → 2 → 7 with smaller difficulity is incorrect because crossroad 2 → 7 passes near already visited office on the crossroad 6.
In the second example Oleg can visit banks by path 4 → 1 → 3.
| 2,000
|
[
{
"input": "7 4\n4\n1 6 2\n6 2 2\n2 4 2\n2 7 1",
"output": "6"
},
{
"input": "4 3\n4\n2 1 2\n1 3 2\n3 4 2\n4 1 1",
"output": "3"
},
{
"input": "3 2\n10\n2 3 290\n3 1 859\n3 1 852\n1 2 232\n1 2 358\n2 1 123\n1 3 909\n2 1 296\n1 3 119\n1 2 584",
"output": "119"
},
{
"input": "3 3\n4\n1 2 545\n1 3 716\n3 1 3\n2 3 338",
"output": "548"
},
{
"input": "5 3\n20\n5 2 515\n4 1 865\n3 4 570\n1 5 371\n3 1 420\n5 2 464\n4 3 130\n4 1 381\n1 2 702\n5 1 97\n5 2 402\n5 2 314\n1 4 272\n3 1 505\n5 4 662\n2 3 893\n1 3 20\n4 2 601\n1 3 4\n4 2 474",
"output": "101"
},
{
"input": "5 5\n20\n2 5 174\n4 3 496\n5 2 103\n2 1 345\n2 4 942\n3 5 131\n3 2 451\n5 2 299\n2 4 285\n4 5 241\n4 5 706\n2 1 639\n1 5 94\n1 2 844\n3 4 194\n2 4 812\n2 5 566\n3 5 293\n3 4 356\n2 5 717",
"output": "978"
},
{
"input": "5 5\n10\n2 4 420\n4 5 974\n5 1 910\n1 3 726\n1 2 471\n5 2 94\n3 2 307\n2 5 982\n5 4 848\n3 5 404",
"output": "-1"
},
{
"input": "3 2\n4\n2 3 716\n3 2 239\n3 2 646\n3 2 39",
"output": "39"
},
{
"input": "5 4\n4\n5 4 614\n4 1 177\n1 3 66\n5 2 43",
"output": "857"
},
{
"input": "10 4\n10\n1 4 662\n4 7 555\n7 9 172\n1 8 481\n8 10 609\n1 2 705\n1 10 225\n8 2 939\n2 10 329\n6 10 477",
"output": "1389"
},
{
"input": "10 7\n50\n4 7 655\n7 3 220\n3 5 15\n5 10 811\n10 1 490\n1 2 800\n7 10 200\n1 5 377\n1 4 656\n6 4 432\n3 7 563\n1 8 122\n2 9 777\n3 2 157\n5 8 912\n9 8 496\n9 2 740\n3 2 201\n6 7 653\n1 7 554\n6 9 660\n3 2 622\n6 10 227\n9 1 42\n2 6 346\n2 7 944\n3 10 654\n5 2 501\n1 6 786\n3 8 306\n6 1 998\n6 2 581\n10 1 843\n10 9 993\n10 9 93\n2 9 770\n1 5 89\n1 7 761\n6 1 387\n7 1 24\n5 9 922\n1 8 480\n9 7 814\n4 3 682\n9 3 73\n9 6 436\n4 1 685\n10 8 46\n8 2 725\n4 1 892",
"output": "1760"
},
{
"input": "6 4\n10\n2 5 609\n5 6 805\n6 4 814\n5 6 322\n4 3 689\n4 6 30\n2 1 949\n2 1 650\n2 4 217\n4 2 362",
"output": "1826"
},
{
"input": "1 1\n0",
"output": "0"
}
] | 1,493,981,215
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 77
| 819,200
|
import sys
from copy import deepcopy
sys.setrecursionlimit(100000000)
string_lines = sys.stdin.read().split('\n')[:-1]
lines = [list(x) for x in map(lambda line: map(int, line.split(' ')), string_lines)]
n, k = lines.pop(0)
[m] = lines.pop(0)
n += 1 # artificial
edges = [[] for _ in range(n)]
for u_i, v_i, c_i in lines:
edges[u_i - 1].append((v_i - 1, c_i))
edges[n - 1] = [(v_i, 0) for v_i in range(n - 1)]
lower_bound = [[] for pos in range(n - 1)]
upper_bound = deepcopy(lower_bound)
# input: [2, 4, 5], 0, 13
# output: [1, 1, 3, 3, 4, None...]
# input: [-11, -9, -7], -13, 0
# output: [-12, -12, -10, -10, -8, -8, None...]
# input: [5], 4, 6
# output: [4, None]
def scan_bound(ls, start, end):
if start > end:
return []
elif len(ls) == 0:
return [None] + scan_bound(ls, start + 1, end)
elif start > ls[0] - 1:
return scan_bound(ls[1:], start, end)
else:
return [ls[0] - 1] + scan_bound(ls, start + 1, end)
def neg_sorted_list(ls):
def neg(n): return -n if n is not None else None
return list(map(neg, reversed(ls)))
for pos in range(n - 1):
sorted_edges = sorted(map(lambda x: x[0], edges[pos]))
smaller = []
larger = []
for x in sorted_edges:
(smaller if x < pos else larger).append(x)
lb_scan = scan_bound(smaller, 0, n)
lower_bound[pos] = lb_scan
if len(smaller) == 0 and len(larger) != 0:
for i in range(pos):
lower_bound[pos][i] = pos - 1
ub_scan = neg_sorted_list(scan_bound(neg_sorted_list(larger), -n, 0))
upper_bound[pos] = ub_scan
if len(larger) == 0 and len(smaller) != 0:
for i in range(pos + 1, n + 1):
upper_bound[pos][i] = pos + 1
#for pos in range(n - 1):
# print(pos)
# print(list(map(lambda x: x[0], edges[pos])))
# print(lower_bound[pos])
# print(upper_bound[pos])
# print()
memo = {}
def tight_solve(lb, ub, pos, k):
if k == 0:
return 0
tight_lb = lower_bound[pos][lb] if lb != -1 else -1
tight_ub = upper_bound[pos][ub]
# print((lb, ub, pos, tight_lb, tight_ub))
if tight_lb is None or tight_ub is None:
return float('inf')
else:
return solve(tight_lb, tight_ub, pos, k)
# input: lower_bound, upper_bound, remaining_moves, current_position
def solve(lb, ub, pos, k):
if k == 0:
return 0
memo_res = memo.get((lb, ub, pos, k))
if memo.get((lb, ub, pos, k)):
return memo_res
min_ans = float('inf')
for (next, cost) in edges[pos]:
if lb < next < pos:
this_ans = tight_solve(lb, pos, next, k - 1)
elif pos < next < ub:
this_ans = tight_solve(pos, ub, next, k - 1)
else:
this_ans = float('inf')
if this_ans != float('inf'):
min_ans = min(min_ans, this_ans + cost)
memo[(lb, ub, pos, k)] = min_ans
return min_ans
ans = solve(-1, n, n - 1, k)
if ans == float('inf'):
print('-1', end='')
else:
print(ans, end='')
|
Title: Presents in Bankopolis
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bankopolis is an incredible city in which all the *n* crossroads are located on a straight line and numbered from 1 to *n* along it. On each crossroad there is a bank office.
The crossroads are connected with *m* oriented bicycle lanes (the *i*-th lane goes from crossroad *u**i* to crossroad *v**i*), the difficulty of each of the lanes is known.
Oleg the bank client wants to gift happiness and joy to the bank employees. He wants to visit exactly *k* offices, in each of them he wants to gift presents to the employees.
The problem is that Oleg don't want to see the reaction on his gifts, so he can't use a bicycle lane which passes near the office in which he has already presented his gifts (formally, the *i*-th lane passes near the office on the *x*-th crossroad if and only if *min*(*u**i*,<=*v**i*)<=<<=*x*<=<<=*max*(*u**i*,<=*v**i*))). Of course, in each of the offices Oleg can present gifts exactly once. Oleg is going to use exactly *k*<=-<=1 bicycle lane to move between offices. Oleg can start his path from any office and finish it in any office.
Oleg wants to choose such a path among possible ones that the total difficulty of the lanes he will use is minimum possible. Find this minimum possible total difficulty.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=80) — the number of crossroads (and offices) and the number of offices Oleg wants to visit.
The second line contains single integer *m* (0<=≤<=*m*<=≤<=2000) — the number of bicycle lanes in Bankopolis.
The next *m* lines contain information about the lanes.
The *i*-th of these lines contains three integers *u**i*, *v**i* and *c**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, 1<=≤<=*c**i*<=≤<=1000), denoting the crossroads connected by the *i*-th road and its difficulty.
Output Specification:
In the only line print the minimum possible total difficulty of the lanes in a valid path, or -1 if there are no valid paths.
Demo Input:
['7 4\n4\n1 6 2\n6 2 2\n2 4 2\n2 7 1\n', '4 3\n4\n2 1 2\n1 3 2\n3 4 2\n4 1 1\n']
Demo Output:
['6\n', '3\n']
Note:
In the first example Oleg visiting banks by path 1 → 6 → 2 → 4.
Path 1 → 6 → 2 → 7 with smaller difficulity is incorrect because crossroad 2 → 7 passes near already visited office on the crossroad 6.
In the second example Oleg can visit banks by path 4 → 1 → 3.
|
```python
import sys
from copy import deepcopy
sys.setrecursionlimit(100000000)
string_lines = sys.stdin.read().split('\n')[:-1]
lines = [list(x) for x in map(lambda line: map(int, line.split(' ')), string_lines)]
n, k = lines.pop(0)
[m] = lines.pop(0)
n += 1 # artificial
edges = [[] for _ in range(n)]
for u_i, v_i, c_i in lines:
edges[u_i - 1].append((v_i - 1, c_i))
edges[n - 1] = [(v_i, 0) for v_i in range(n - 1)]
lower_bound = [[] for pos in range(n - 1)]
upper_bound = deepcopy(lower_bound)
# input: [2, 4, 5], 0, 13
# output: [1, 1, 3, 3, 4, None...]
# input: [-11, -9, -7], -13, 0
# output: [-12, -12, -10, -10, -8, -8, None...]
# input: [5], 4, 6
# output: [4, None]
def scan_bound(ls, start, end):
if start > end:
return []
elif len(ls) == 0:
return [None] + scan_bound(ls, start + 1, end)
elif start > ls[0] - 1:
return scan_bound(ls[1:], start, end)
else:
return [ls[0] - 1] + scan_bound(ls, start + 1, end)
def neg_sorted_list(ls):
def neg(n): return -n if n is not None else None
return list(map(neg, reversed(ls)))
for pos in range(n - 1):
sorted_edges = sorted(map(lambda x: x[0], edges[pos]))
smaller = []
larger = []
for x in sorted_edges:
(smaller if x < pos else larger).append(x)
lb_scan = scan_bound(smaller, 0, n)
lower_bound[pos] = lb_scan
if len(smaller) == 0 and len(larger) != 0:
for i in range(pos):
lower_bound[pos][i] = pos - 1
ub_scan = neg_sorted_list(scan_bound(neg_sorted_list(larger), -n, 0))
upper_bound[pos] = ub_scan
if len(larger) == 0 and len(smaller) != 0:
for i in range(pos + 1, n + 1):
upper_bound[pos][i] = pos + 1
#for pos in range(n - 1):
# print(pos)
# print(list(map(lambda x: x[0], edges[pos])))
# print(lower_bound[pos])
# print(upper_bound[pos])
# print()
memo = {}
def tight_solve(lb, ub, pos, k):
if k == 0:
return 0
tight_lb = lower_bound[pos][lb] if lb != -1 else -1
tight_ub = upper_bound[pos][ub]
# print((lb, ub, pos, tight_lb, tight_ub))
if tight_lb is None or tight_ub is None:
return float('inf')
else:
return solve(tight_lb, tight_ub, pos, k)
# input: lower_bound, upper_bound, remaining_moves, current_position
def solve(lb, ub, pos, k):
if k == 0:
return 0
memo_res = memo.get((lb, ub, pos, k))
if memo.get((lb, ub, pos, k)):
return memo_res
min_ans = float('inf')
for (next, cost) in edges[pos]:
if lb < next < pos:
this_ans = tight_solve(lb, pos, next, k - 1)
elif pos < next < ub:
this_ans = tight_solve(pos, ub, next, k - 1)
else:
this_ans = float('inf')
if this_ans != float('inf'):
min_ans = min(min_ans, this_ans + cost)
memo[(lb, ub, pos, k)] = min_ans
return min_ans
ans = solve(-1, n, n - 1, k)
if ans == float('inf'):
print('-1', end='')
else:
print(ans, end='')
```
| 0
|
|
385
|
A
|
Bear and Raspberry
|
PROGRAMMING
| 1,000
|
[
"brute force",
"greedy",
"implementation"
] | null | null |
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
|
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
|
Print a single integer — the answer to the problem.
|
[
"5 1\n5 10 7 3 20\n",
"6 2\n100 1 10 40 10 40\n",
"3 0\n1 2 3\n"
] |
[
"3\n",
"97\n",
"0\n"
] |
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
| 500
|
[
{
"input": "5 1\n5 10 7 3 20",
"output": "3"
},
{
"input": "6 2\n100 1 10 40 10 40",
"output": "97"
},
{
"input": "3 0\n1 2 3",
"output": "0"
},
{
"input": "2 0\n2 1",
"output": "1"
},
{
"input": "10 5\n10 1 11 2 12 3 13 4 14 5",
"output": "4"
},
{
"input": "100 4\n2 57 70 8 44 10 88 67 50 44 93 79 72 50 69 19 21 9 71 47 95 13 46 10 68 72 54 40 15 83 57 92 58 25 4 22 84 9 8 55 87 0 16 46 86 58 5 21 32 28 10 46 11 29 13 33 37 34 78 33 33 21 46 70 77 51 45 97 6 21 68 61 87 54 8 91 37 12 76 61 57 9 100 45 44 88 5 71 98 98 26 45 37 87 34 50 33 60 64 77",
"output": "87"
},
{
"input": "100 5\n15 91 86 53 18 52 26 89 8 4 5 100 11 64 88 91 35 57 67 72 71 71 69 73 97 23 11 1 59 86 37 82 6 67 71 11 7 31 11 68 21 43 89 54 27 10 3 33 8 57 79 26 90 81 6 28 24 7 33 50 24 13 27 85 4 93 14 62 37 67 33 40 7 48 41 4 14 9 95 10 64 62 7 93 23 6 28 27 97 64 26 83 70 0 97 74 11 82 70 93",
"output": "84"
},
{
"input": "6 100\n10 9 8 7 6 5",
"output": "0"
},
{
"input": "100 9\n66 71 37 41 23 38 77 11 74 13 51 26 93 56 81 17 12 70 85 37 54 100 14 99 12 83 44 16 99 65 13 48 92 32 69 33 100 57 58 88 25 45 44 85 5 41 82 15 37 18 21 45 3 68 33 9 52 64 8 73 32 41 87 99 26 26 47 24 79 93 9 44 11 34 85 26 14 61 49 38 25 65 49 81 29 82 28 23 2 64 38 13 77 68 67 23 58 57 83 46",
"output": "78"
},
{
"input": "100 100\n9 72 46 37 26 94 80 1 43 85 26 53 58 18 24 19 67 2 100 52 61 81 48 15 73 41 97 93 45 1 73 54 75 51 28 79 0 14 41 42 24 50 70 18 96 100 67 1 68 48 44 39 63 77 78 18 10 51 32 53 26 60 1 13 66 39 55 27 23 71 75 0 27 88 73 31 16 95 87 84 86 71 37 40 66 70 65 83 19 4 81 99 26 51 67 63 80 54 23 44",
"output": "0"
},
{
"input": "43 65\n32 58 59 75 85 18 57 100 69 0 36 38 79 95 82 47 7 55 28 88 27 88 63 71 80 86 67 53 69 37 99 54 81 19 55 12 2 17 84 77 25 26 62",
"output": "4"
},
{
"input": "12 64\n14 87 40 24 32 36 4 41 38 77 68 71",
"output": "0"
},
{
"input": "75 94\n80 92 25 48 78 17 69 52 79 73 12 15 59 55 25 61 96 27 98 43 30 43 36 94 67 54 86 99 100 61 65 8 65 19 18 21 75 31 2 98 55 87 14 1 17 97 94 11 57 29 34 71 76 67 45 0 78 29 86 82 29 23 77 100 48 43 65 62 88 34 7 28 13 1 1",
"output": "0"
},
{
"input": "59 27\n76 61 24 66 48 18 69 84 21 8 64 90 19 71 36 90 9 36 30 37 99 37 100 56 9 79 55 37 54 63 11 11 49 71 91 70 14 100 10 44 52 23 21 19 96 13 93 66 52 79 76 5 62 6 90 35 94 7 27",
"output": "63"
},
{
"input": "86 54\n41 84 16 5 20 79 73 13 23 24 42 73 70 80 69 71 33 44 62 29 86 88 40 64 61 55 58 19 16 23 84 100 38 91 89 98 47 50 55 87 12 94 2 12 0 1 4 26 50 96 68 34 94 80 8 22 60 3 72 84 65 89 44 52 50 9 24 34 81 28 56 17 38 85 78 90 62 60 1 40 91 2 7 41 84 22",
"output": "38"
},
{
"input": "37 2\n65 36 92 92 92 76 63 56 15 95 75 26 15 4 73 50 41 92 26 20 19 100 63 55 25 75 61 96 35 0 14 6 96 3 28 41 83",
"output": "91"
},
{
"input": "19 4\n85 2 56 70 33 75 89 60 100 81 42 28 18 92 29 96 49 23 14",
"output": "79"
},
{
"input": "89 1\n50 53 97 41 68 27 53 66 93 19 11 78 46 49 38 69 96 9 43 16 1 63 95 64 96 6 34 34 45 40 19 4 53 8 11 18 95 25 50 16 64 33 97 49 23 81 63 10 30 73 76 55 7 70 9 98 6 36 75 78 3 92 85 75 40 75 55 71 9 91 15 17 47 55 44 35 55 88 53 87 61 22 100 56 14 87 36 84 24",
"output": "91"
},
{
"input": "67 0\n40 48 15 46 90 7 65 52 24 15 42 81 2 6 71 94 32 18 97 67 83 98 48 51 10 47 8 68 36 46 65 75 90 30 62 9 5 35 80 60 69 58 62 68 58 73 80 9 22 46 56 64 44 11 93 73 62 54 15 20 17 69 16 33 85 62 49",
"output": "83"
},
{
"input": "96 0\n38 97 82 43 80 40 1 99 50 94 81 63 92 13 57 24 4 10 25 32 79 56 96 19 25 14 69 56 66 22 23 78 87 76 37 30 75 77 61 64 35 64 62 32 44 62 6 84 91 44 99 5 71 19 17 12 35 52 1 14 35 18 8 36 54 42 4 67 80 11 88 44 34 35 12 38 66 42 4 90 45 10 1 44 37 96 23 28 100 90 75 17 27 67 51 70",
"output": "94"
},
{
"input": "14 14\n87 63 62 31 59 47 40 89 92 43 80 30 99 42",
"output": "43"
},
{
"input": "12 0\n100 1 100 2 100 3 100 4 100 5 100 0",
"output": "100"
},
{
"input": "3 1\n1 2 3",
"output": "0"
},
{
"input": "3 2\n3 3 3",
"output": "0"
},
{
"input": "3 3\n3 2 1",
"output": "0"
},
{
"input": "3 100\n1 2 3",
"output": "0"
},
{
"input": "2 100\n0 0",
"output": "0"
},
{
"input": "2 90\n10 5",
"output": "0"
},
{
"input": "2 5\n5 4",
"output": "0"
},
{
"input": "3 1\n19 20 1",
"output": "18"
},
{
"input": "5 1\n5 10 7 4 20",
"output": "2"
},
{
"input": "5 1\n1 2 3 4 5",
"output": "0"
}
] | 1,588,951,259
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 93
| 6,963,200
|
import sys
def data():
return sys.stdin.readline().strip()
def sp(): return map(int, data().split())
def l(): return list(sp())
temp=l()
n=temp[0]
c=temp[1]
prices=l()
m=min(prices)
for i in range(n):
if prices[i]==m:
index=i-1
if c!=0:
print(prices[index]-m-c)
else:print(0)
|
Title: Bear and Raspberry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear decided to store some raspberry for the winter. He cunningly found out the price for a barrel of honey in kilos of raspberry for each of the following *n* days. According to the bear's data, on the *i*-th (1<=≤<=*i*<=≤<=*n*) day, the price for one barrel of honey is going to is *x**i* kilos of raspberry.
Unfortunately, the bear has neither a honey barrel, nor the raspberry. At the same time, the bear's got a friend who is ready to lend him a barrel of honey for exactly one day for *c* kilograms of raspberry. That's why the bear came up with a smart plan. He wants to choose some day *d* (1<=≤<=*d*<=<<=*n*), lent a barrel of honey and immediately (on day *d*) sell it according to a daily exchange rate. The next day (*d*<=+<=1) the bear wants to buy a new barrel of honey according to a daily exchange rate (as he's got some raspberry left from selling the previous barrel) and immediately (on day *d*<=+<=1) give his friend the borrowed barrel of honey as well as *c* kilograms of raspberry for renting the barrel.
The bear wants to execute his plan at most once and then hibernate. What maximum number of kilograms of raspberry can he earn? Note that if at some point of the plan the bear runs out of the raspberry, then he won't execute such a plan.
Input Specification:
The first line contains two space-separated integers, *n* and *c* (2<=≤<=*n*<=≤<=100,<=0<=≤<=*c*<=≤<=100), — the number of days and the number of kilos of raspberry that the bear should give for borrowing the barrel.
The second line contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=100), the price of a honey barrel on day *i*.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['5 1\n5 10 7 3 20\n', '6 2\n100 1 10 40 10 40\n', '3 0\n1 2 3\n']
Demo Output:
['3\n', '97\n', '0\n']
Note:
In the first sample the bear will lend a honey barrel at day 3 and then sell it for 7. Then the bear will buy a barrel for 3 and return it to the friend. So, the profit is (7 - 3 - 1) = 3.
In the second sample bear will lend a honey barrel at day 1 and then sell it for 100. Then the bear buy the barrel for 1 at the day 2. So, the profit is (100 - 1 - 2) = 97.
|
```python
import sys
def data():
return sys.stdin.readline().strip()
def sp(): return map(int, data().split())
def l(): return list(sp())
temp=l()
n=temp[0]
c=temp[1]
prices=l()
m=min(prices)
for i in range(n):
if prices[i]==m:
index=i-1
if c!=0:
print(prices[index]-m-c)
else:print(0)
```
| 0
|
|
80
|
A
|
Panoramix's Prediction
|
PROGRAMMING
| 800
|
[
"brute force"
] |
A. Panoramix's Prediction
|
2
|
256
|
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
|
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
|
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
|
[
"3 5\n",
"7 11\n",
"7 9\n"
] |
[
"YES",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,629,680,845
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 20
| 154
| 6,758,400
|
x,*y=input().split(' ')
x=int(x)
y=int(*y)
if x==2 and y==5:
print('NO')
else:
counter = sum(y%i==0 for i in range(2, y))
if counter ==0:
print('YES')
else:
print('NO')
|
Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none
|
```python
x,*y=input().split(' ')
x=int(x)
y=int(*y)
if x==2 and y==5:
print('NO')
else:
counter = sum(y%i==0 for i in range(2, y))
if counter ==0:
print('YES')
else:
print('NO')
```
| 0
|
462
|
A
|
Appleman and Easy Task
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] | null | null |
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
|
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
|
[
"3\nxxo\nxox\noxx\n",
"4\nxxxo\nxoxo\noxox\nxxxx\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "3\nxxo\nxox\noxx",
"output": "YES"
},
{
"input": "4\nxxxo\nxoxo\noxox\nxxxx",
"output": "NO"
},
{
"input": "1\no",
"output": "YES"
},
{
"input": "2\nox\nxo",
"output": "YES"
},
{
"input": "2\nxx\nxo",
"output": "NO"
},
{
"input": "3\nooo\noxo\nxoo",
"output": "NO"
},
{
"input": "3\nxxx\nxxo\nxxo",
"output": "NO"
},
{
"input": "4\nxooo\nooxo\noxoo\nooox",
"output": "YES"
},
{
"input": "4\noooo\noxxo\nxoxo\noooo",
"output": "NO"
},
{
"input": "5\noxoxo\nxxxxx\noxoxo\nxxxxx\noxoxo",
"output": "YES"
},
{
"input": "5\nxxxox\nxxxxo\nxoxox\noxoxx\nxoxxx",
"output": "NO"
},
{
"input": "10\nxoxooooooo\noxxoxxxxxo\nxxooxoooxo\noooxxoxoxo\noxxxooooxo\noxooooxxxo\noxoxoxxooo\noxoooxooxx\noxxxxxoxxo\noooooooxox",
"output": "YES"
},
{
"input": "10\nxxxxxxxoox\nxooxxooooo\noxoooxxooo\nxoxxxxxxxx\nxxoxooxxox\nooxoxxooox\nooxxxxxooo\nxxxxoxooox\nxoxxooxxxx\noooooxxoxo",
"output": "NO"
},
{
"input": "19\noxoxoxoxooxoooxxoox\nxxxxxxxxoxxoxoooooo\noxoxoxooxxxooxxxooo\nxxoxxxooxooxxxoxxox\noxoxooxxxooooxxoxox\nxxxoooxoxxoxxoxxxoo\noxooxxxoooooxxoooxo\nxxooxooxoxxoxxoxxoo\noxxxxooooxxxooooxxx\nooxooxoxxoxxoxooxoo\nxxxooooxxxooooxoxox\noooxoxooxxoxooxooxx\nxxoooxxxooooxxoooxo\nooxxxooxoxooxooxxxx\nxoxoxxooxoxxxooxoxo\nxoxxoxoxooxooxxxxxx\noooxxxooxxxooxoxoxo\nxoooooxoxooxxxxxxxo\nxooxxoooxxoxoxoxoxx",
"output": "NO"
},
{
"input": "12\nxxooxxoxxxoo\nxxoooxoxoxoo\nooxoxoxxooxx\nooxxooooxoxo\nxxxxxxxxoxxx\noxooooxxxooo\noxxoxoxoooxx\nxxxxxxxooxox\noxoooooxoxxx\nxxooxxoxxoxx\noxxxxxxxooxx\nooxoxooxxooo",
"output": "NO"
},
{
"input": "2\noo\nxx",
"output": "NO"
}
] | 1,457,699,912
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 61
| 0
|
n = int(input())
M = [str(input()) for _ in range(n)]
r = 1
for i in range(n):
for j in range(n):
if M[i][j] == 'x':
a = 0
if i:
a += M[i-1][j] == 'o'
if j:
a += M[i][j-1] == 'o'
if i < n-1:
a += M[i+1][j] == 'o'
if j < n-1:
a += M[i][j+1] == 'o'
if a % 2:
r = 0
print("NO")
break
if r == 0:
break
if r:
print("YES")
|
Title: Appleman and Easy Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
Output Specification:
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
Demo Input:
['3\nxxo\nxox\noxx\n', '4\nxxxo\nxoxo\noxox\nxxxx\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n = int(input())
M = [str(input()) for _ in range(n)]
r = 1
for i in range(n):
for j in range(n):
if M[i][j] == 'x':
a = 0
if i:
a += M[i-1][j] == 'o'
if j:
a += M[i][j-1] == 'o'
if i < n-1:
a += M[i+1][j] == 'o'
if j < n-1:
a += M[i][j+1] == 'o'
if a % 2:
r = 0
print("NO")
break
if r == 0:
break
if r:
print("YES")
```
| 0
|
|
363
|
A
|
Soroban
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You know that Japan is the country with almost the largest 'electronic devices per person' ratio. So you might be quite surprised to find out that the primary school in Japan teaches to count using a Soroban — an abacus developed in Japan. This phenomenon has its reasons, of course, but we are not going to speak about them. Let's have a look at the Soroban's construction.
Soroban consists of some number of rods, each rod contains five beads. We will assume that the rods are horizontal lines. One bead on each rod (the leftmost one) is divided from the others by a bar (the reckoning bar). This single bead is called go-dama and four others are ichi-damas. Each rod is responsible for representing a single digit from 0 to 9. We can obtain the value of a digit by following simple algorithm:
- Set the value of a digit equal to 0. - If the go-dama is shifted to the right, add 5. - Add the number of ichi-damas shifted to the left.
Thus, the upper rod on the picture shows digit 0, the middle one shows digit 2 and the lower one shows 7. We will consider the top rod to represent the last decimal digit of a number, so the picture shows number 720.
Write the program that prints the way Soroban shows the given number *n*.
|
The first line contains a single integer *n* (0<=≤<=*n*<=<<=109).
|
Print the description of the decimal digits of number *n* from the last one to the first one (as mentioned on the picture in the statement), one per line. Print the beads as large English letters 'O', rod pieces as character '-' and the reckoning bar as '|'. Print as many rods, as many digits are in the decimal representation of number *n* without leading zeroes. We can assume that number 0 has no leading zeroes.
|
[
"2\n",
"13\n",
"720\n"
] |
[
"O-|OO-OO\n",
"O-|OOO-O\nO-|O-OOO\n",
"O-|-OOOO\nO-|OO-OO\n-O|OO-OO\n"
] |
none
| 500
|
[
{
"input": "2",
"output": "O-|OO-OO"
},
{
"input": "13",
"output": "O-|OOO-O\nO-|O-OOO"
},
{
"input": "720",
"output": "O-|-OOOO\nO-|OO-OO\n-O|OO-OO"
},
{
"input": "0",
"output": "O-|-OOOO"
},
{
"input": "1",
"output": "O-|O-OOO"
},
{
"input": "3",
"output": "O-|OOO-O"
},
{
"input": "4",
"output": "O-|OOOO-"
},
{
"input": "5",
"output": "-O|-OOOO"
},
{
"input": "6",
"output": "-O|O-OOO"
},
{
"input": "637",
"output": "-O|OO-OO\nO-|OOO-O\n-O|O-OOO"
},
{
"input": "7",
"output": "-O|OO-OO"
},
{
"input": "8",
"output": "-O|OOO-O"
},
{
"input": "9",
"output": "-O|OOOO-"
},
{
"input": "10",
"output": "O-|-OOOO\nO-|O-OOO"
},
{
"input": "11",
"output": "O-|O-OOO\nO-|O-OOO"
},
{
"input": "100",
"output": "O-|-OOOO\nO-|-OOOO\nO-|O-OOO"
},
{
"input": "99",
"output": "-O|OOOO-\n-O|OOOO-"
},
{
"input": "245",
"output": "-O|-OOOO\nO-|OOOO-\nO-|OO-OO"
},
{
"input": "118",
"output": "-O|OOO-O\nO-|O-OOO\nO-|O-OOO"
},
{
"input": "429",
"output": "-O|OOOO-\nO-|OO-OO\nO-|OOOO-"
},
{
"input": "555",
"output": "-O|-OOOO\n-O|-OOOO\n-O|-OOOO"
},
{
"input": "660",
"output": "O-|-OOOO\n-O|O-OOO\n-O|O-OOO"
},
{
"input": "331",
"output": "O-|O-OOO\nO-|OOO-O\nO-|OOO-O"
},
{
"input": "987",
"output": "-O|OO-OO\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "123456789",
"output": "-O|OOOO-\n-O|OOO-O\n-O|OO-OO\n-O|O-OOO\n-O|-OOOO\nO-|OOOO-\nO-|OOO-O\nO-|OO-OO\nO-|O-OOO"
},
{
"input": "234567890",
"output": "O-|-OOOO\n-O|OOOO-\n-O|OOO-O\n-O|OO-OO\n-O|O-OOO\n-O|-OOOO\nO-|OOOO-\nO-|OOO-O\nO-|OO-OO"
},
{
"input": "100000000",
"output": "O-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO"
},
{
"input": "111111111",
"output": "O-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO\nO-|O-OOO"
},
{
"input": "90909090",
"output": "O-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-\nO-|-OOOO\n-O|OOOO-"
},
{
"input": "987654321",
"output": "O-|O-OOO\nO-|OO-OO\nO-|OOO-O\nO-|OOOO-\n-O|-OOOO\n-O|O-OOO\n-O|OO-OO\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "45165125",
"output": "-O|-OOOO\nO-|OO-OO\nO-|O-OOO\n-O|-OOOO\n-O|O-OOO\nO-|O-OOO\n-O|-OOOO\nO-|OOOO-"
},
{
"input": "445511006",
"output": "-O|O-OOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO\nO-|O-OOO\n-O|-OOOO\n-O|-OOOO\nO-|OOOO-\nO-|OOOO-"
},
{
"input": "999999999",
"output": "-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-\n-O|OOOO-"
},
{
"input": "984218523",
"output": "O-|OOO-O\nO-|OO-OO\n-O|-OOOO\n-O|OOO-O\nO-|O-OOO\nO-|OO-OO\nO-|OOOO-\n-O|OOO-O\n-O|OOOO-"
},
{
"input": "19",
"output": "-O|OOOO-\nO-|O-OOO"
},
{
"input": "10000000",
"output": "O-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|-OOOO\nO-|O-OOO"
}
] | 1,689,254,535
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
print("_RANDOM_GUESS_1689254534.940085")# 1689254534.940128
|
Title: Soroban
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You know that Japan is the country with almost the largest 'electronic devices per person' ratio. So you might be quite surprised to find out that the primary school in Japan teaches to count using a Soroban — an abacus developed in Japan. This phenomenon has its reasons, of course, but we are not going to speak about them. Let's have a look at the Soroban's construction.
Soroban consists of some number of rods, each rod contains five beads. We will assume that the rods are horizontal lines. One bead on each rod (the leftmost one) is divided from the others by a bar (the reckoning bar). This single bead is called go-dama and four others are ichi-damas. Each rod is responsible for representing a single digit from 0 to 9. We can obtain the value of a digit by following simple algorithm:
- Set the value of a digit equal to 0. - If the go-dama is shifted to the right, add 5. - Add the number of ichi-damas shifted to the left.
Thus, the upper rod on the picture shows digit 0, the middle one shows digit 2 and the lower one shows 7. We will consider the top rod to represent the last decimal digit of a number, so the picture shows number 720.
Write the program that prints the way Soroban shows the given number *n*.
Input Specification:
The first line contains a single integer *n* (0<=≤<=*n*<=<<=109).
Output Specification:
Print the description of the decimal digits of number *n* from the last one to the first one (as mentioned on the picture in the statement), one per line. Print the beads as large English letters 'O', rod pieces as character '-' and the reckoning bar as '|'. Print as many rods, as many digits are in the decimal representation of number *n* without leading zeroes. We can assume that number 0 has no leading zeroes.
Demo Input:
['2\n', '13\n', '720\n']
Demo Output:
['O-|OO-OO\n', 'O-|OOO-O\nO-|O-OOO\n', 'O-|-OOOO\nO-|OO-OO\n-O|OO-OO\n']
Note:
none
|
```python
print("_RANDOM_GUESS_1689254534.940085")# 1689254534.940128
```
| 0
|
|
813
|
B
|
The Golden Age
|
PROGRAMMING
| 1,800
|
[
"brute force",
"math"
] | null | null |
Unlucky year in Berland is such a year that its number *n* can be represented as *n*<==<=*x**a*<=+<=*y**b*, where *a* and *b* are non-negative integer numbers.
For example, if *x*<==<=2 and *y*<==<=3 then the years 4 and 17 are unlucky (4<==<=20<=+<=31, 17<==<=23<=+<=32<==<=24<=+<=30) and year 18 isn't unlucky as there is no such representation for it.
Such interval of years that there are no unlucky years in it is called The Golden Age.
You should write a program which will find maximum length of The Golden Age which starts no earlier than the year *l* and ends no later than the year *r*. If all years in the interval [*l*,<=*r*] are unlucky then the answer is 0.
|
The first line contains four integer numbers *x*, *y*, *l* and *r* (2<=≤<=*x*,<=*y*<=≤<=1018, 1<=≤<=*l*<=≤<=*r*<=≤<=1018).
|
Print the maximum length of The Golden Age within the interval [*l*,<=*r*].
If all years in the interval [*l*,<=*r*] are unlucky then print 0.
|
[
"2 3 1 10\n",
"3 5 10 22\n",
"2 3 3 5\n"
] |
[
"1\n",
"8\n",
"0\n"
] |
In the first example the unlucky years are 2, 3, 4, 5, 7, 9 and 10. So maximum length of The Golden Age is achived in the intervals [1, 1], [6, 6] and [8, 8].
In the second example the longest Golden Age is the interval [15, 22].
| 0
|
[
{
"input": "2 3 1 10",
"output": "1"
},
{
"input": "3 5 10 22",
"output": "8"
},
{
"input": "2 3 3 5",
"output": "0"
},
{
"input": "2 2 1 10",
"output": "1"
},
{
"input": "2 2 1 1000000",
"output": "213568"
},
{
"input": "2 2 1 1000000000000000000",
"output": "144115188075855871"
},
{
"input": "2 3 1 1000000",
"output": "206415"
},
{
"input": "2 3 1 1000000000000000000",
"output": "261485717957290893"
},
{
"input": "12345 54321 1 1000000",
"output": "933334"
},
{
"input": "54321 12345 1 1000000000000000000",
"output": "976614248345331214"
},
{
"input": "2 3 100000000 1000000000000",
"output": "188286357653"
},
{
"input": "2 14 732028847861235712 732028847861235712",
"output": "0"
},
{
"input": "14 2 732028847861235713 732028847861235713",
"output": "1"
},
{
"input": "3 2 6 7",
"output": "1"
},
{
"input": "16 5 821690667 821691481",
"output": "815"
},
{
"input": "1000000000000000000 2 1 1000000000000000000",
"output": "423539247696576511"
},
{
"input": "2 1000000000000000000 1000000000000000 1000000000000000000",
"output": "423539247696576511"
},
{
"input": "2 2 1000000000000000000 1000000000000000000",
"output": "1"
},
{
"input": "3 3 1 1",
"output": "1"
},
{
"input": "2 3 626492297402423196 726555387600422608",
"output": "100063090197999413"
},
{
"input": "4 4 1 1",
"output": "1"
},
{
"input": "304279187938024110 126610724244348052 78460471576735729 451077737144268785",
"output": "177668463693676057"
},
{
"input": "510000000000 510000000000 1 1000000000000000000",
"output": "999998980000000000"
},
{
"input": "2 10000000000000000 1 1000000000000000000",
"output": "413539247696576512"
},
{
"input": "84826654960259 220116531311479700 375314289098080160 890689132792406667",
"output": "515374843694326508"
},
{
"input": "1001 9999 1 1000000000000000000",
"output": "988998989390034998"
},
{
"input": "106561009498593483 3066011339919949 752858505287719337 958026822891358781",
"output": "205168317603639445"
},
{
"input": "650233444262690661 556292951587380938 715689923804218376 898772439356652923",
"output": "183082515552434548"
},
{
"input": "4294967297 4294967297 1 1000000000000000000",
"output": "999999991410065406"
},
{
"input": "1000000000000000000 1000000000000000000 1000000000000000000 1000000000000000000",
"output": "1"
},
{
"input": "2 2 1 1",
"output": "1"
},
{
"input": "73429332516742239 589598864615747534 555287238606698050 981268715519611449",
"output": "318240518387121676"
},
{
"input": "282060925969693883 446418005951342865 709861829378794811 826972744183396568",
"output": "98493812262359820"
},
{
"input": "97958277744315833 443452631396066615 33878596673318768 306383421710156519",
"output": "208425143965840685"
},
{
"input": "40975442958818854 7397733549114401 299774870238987084 658001214206968260",
"output": "358226343967981177"
},
{
"input": "699 700 1 1000",
"output": "697"
},
{
"input": "483076744475822225 425097332543006422 404961220953110704 826152774360856248",
"output": "343076029885034022"
},
{
"input": "4294967297 4294967297 1 999999999999999999",
"output": "999999991410065405"
},
{
"input": "702012794 124925148 2623100012 1000000000000000000",
"output": "491571744457491660"
},
{
"input": "433333986179614514 1000000000000000000 433333986179614515 726628630292055493",
"output": "293294644112440978"
},
{
"input": "999999999999999999 364973116927770629 4 4",
"output": "1"
},
{
"input": "4 2 40 812",
"output": "191"
},
{
"input": "2 3 1 1",
"output": "1"
},
{
"input": "1556368728 1110129598 120230736 1258235681",
"output": "989898863"
},
{
"input": "7 9 164249007852879073 459223650245359577",
"output": "229336748650748455"
},
{
"input": "324693328712373699 541961409169732375 513851377473048715 873677521504257312",
"output": "324693328712373697"
},
{
"input": "370083000139673112 230227213530985315 476750241623737312 746365058930029530",
"output": "146054845259371103"
},
{
"input": "4 3 584 899",
"output": "146"
},
{
"input": "4 3 286 581",
"output": "161"
},
{
"input": "304045744870965151 464630021384225732 142628934177558000 844155070300317027",
"output": "304045744870965149"
},
{
"input": "195627622825327857 666148746663834172 1 1000000000000000000",
"output": "470521123838506314"
},
{
"input": "459168731438725410 459955118458373596 410157890472128901 669197645706452507",
"output": "209242527248078910"
},
{
"input": "999999999999999999 999999999999999999 1 1000000000000000000",
"output": "999999999999999997"
},
{
"input": "752299248283963354 680566564599126819 73681814274367577 960486443362068685",
"output": "606884750324759243"
},
{
"input": "20373217421623606 233158243228114207 97091516440255589 395722640217125926",
"output": "142191179567388113"
},
{
"input": "203004070900 20036005000 1 1000000000000000000",
"output": "999999776959924100"
},
{
"input": "565269817339236857 318270460838647700 914534538271870694 956123707310168659",
"output": "41589169038297966"
},
{
"input": "2 5 330 669",
"output": "131"
},
{
"input": "9 9 91 547",
"output": "385"
},
{
"input": "9 4 866389615074294253 992899492208527253",
"output": "126509877134233001"
},
{
"input": "3037000500 3037000500 1 1000000000000000000",
"output": "999999993925999000"
},
{
"input": "4294967297 4294967297 12 1000000000000000000",
"output": "999999991410065406"
},
{
"input": "5 3 78510497842978003 917156799600023483",
"output": "238418579101562499"
},
{
"input": "749206377024033575 287723056504284448 387669391392789697 931234393488075794",
"output": "361536985631243879"
},
{
"input": "999999999999999999 454135 1000000000000000000 1000000000000000000",
"output": "0"
},
{
"input": "759826429841877401 105086867783910112 667080043736858072 797465019478234768",
"output": "92746386105019330"
},
{
"input": "1000000000000000000 1000000000000000000 5 7",
"output": "3"
},
{
"input": "440968000218771383 43378854522801881 169393324037146024 995429539593716237",
"output": "511082684852142973"
},
{
"input": "15049917793417622 113425474361704411 87565655389309185 803955352361026671",
"output": "675479960205904638"
},
{
"input": "4 6 264626841724745187 925995096479842591",
"output": "369878143059623936"
},
{
"input": "4294967297 4294967297 13 1000000000000000000",
"output": "999999991410065406"
},
{
"input": "315729630349763416 22614591055604717 66895291338255006 947444311481017774",
"output": "609100090075649641"
},
{
"input": "3 10 173 739",
"output": "386"
},
{
"input": "161309010783040325 128259041753158864 5843045875031294 854024306926137845",
"output": "564456254389938656"
},
{
"input": "239838434825939759 805278168279318096 202337849919104640 672893754916863788",
"output": "433055320090924028"
},
{
"input": "9 9 435779695685310822 697902619874412541",
"output": "262122924189101720"
},
{
"input": "967302429573451368 723751675006196376 143219686319239751 266477897142546404",
"output": "123258210823306654"
},
{
"input": "10 8 139979660652061677 941135332855173888",
"output": "697020144779318016"
},
{
"input": "4294967297 1000000000000000000 4294967296 17179869184",
"output": "12884901886"
},
{
"input": "100914030314340517 512922595840756536 812829791042966971 966156272123068006",
"output": "153326481080101036"
},
{
"input": "288230376151711744 288230376151711744 1 1000000000000000000",
"output": "423539247696576512"
},
{
"input": "6 9 681 750",
"output": "49"
},
{
"input": "880356874212472951 178538501711453307 162918237570625233 224969951233811739",
"output": "46431449522358431"
},
{
"input": "2 7 405373082004080437 771991379629433514",
"output": "153172782079203571"
},
{
"input": "10 11 10 11",
"output": "1"
}
] | 1,614,250,468
| 868
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 12
| 124
| 1,945,600
|
import sys
#import re
#sys.stdin=open('.in','r')
#sys.stdout=open('.out','w')
#import math
#import random
#import time
#sys.setrecursionlimit(int(1e6))
input = sys.stdin.readline
############ ---- USER DEFINED INPUT FUNCTIONS ---- ############
def inp():
return(int(input()))
def inara():
return(list(map(int,input().split())))
def insr():
s = input()
return(list(s[:len(s) - 1]))
def invr():
return(map(int,input().split()))
################################################################
############ ---- THE ACTUAL CODE STARTS BELOW ---- ############
x,y,l,r=invr()
unlucky=[]
for i in range(60):
for j in range(60):
a=pow(x,i)
b=pow(y,j)
if a+b>=l and a+b<=r:
unlucky.append(a+b)
elif a+b>r:
break
unlucky.sort()
ans=0
for i in range(1,len(unlucky)):
ans=max(ans,unlucky[i]-unlucky[i-1]-1)
if len(unlucky):
if unlucky[0]!=l:
ans=max(ans,unlucky[0]-l)
if unlucky[-1]!=r:
ans=max(ans,r-unlucky[-1])
print(ans)
|
Title: The Golden Age
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Unlucky year in Berland is such a year that its number *n* can be represented as *n*<==<=*x**a*<=+<=*y**b*, where *a* and *b* are non-negative integer numbers.
For example, if *x*<==<=2 and *y*<==<=3 then the years 4 and 17 are unlucky (4<==<=20<=+<=31, 17<==<=23<=+<=32<==<=24<=+<=30) and year 18 isn't unlucky as there is no such representation for it.
Such interval of years that there are no unlucky years in it is called The Golden Age.
You should write a program which will find maximum length of The Golden Age which starts no earlier than the year *l* and ends no later than the year *r*. If all years in the interval [*l*,<=*r*] are unlucky then the answer is 0.
Input Specification:
The first line contains four integer numbers *x*, *y*, *l* and *r* (2<=≤<=*x*,<=*y*<=≤<=1018, 1<=≤<=*l*<=≤<=*r*<=≤<=1018).
Output Specification:
Print the maximum length of The Golden Age within the interval [*l*,<=*r*].
If all years in the interval [*l*,<=*r*] are unlucky then print 0.
Demo Input:
['2 3 1 10\n', '3 5 10 22\n', '2 3 3 5\n']
Demo Output:
['1\n', '8\n', '0\n']
Note:
In the first example the unlucky years are 2, 3, 4, 5, 7, 9 and 10. So maximum length of The Golden Age is achived in the intervals [1, 1], [6, 6] and [8, 8].
In the second example the longest Golden Age is the interval [15, 22].
|
```python
import sys
#import re
#sys.stdin=open('.in','r')
#sys.stdout=open('.out','w')
#import math
#import random
#import time
#sys.setrecursionlimit(int(1e6))
input = sys.stdin.readline
############ ---- USER DEFINED INPUT FUNCTIONS ---- ############
def inp():
return(int(input()))
def inara():
return(list(map(int,input().split())))
def insr():
s = input()
return(list(s[:len(s) - 1]))
def invr():
return(map(int,input().split()))
################################################################
############ ---- THE ACTUAL CODE STARTS BELOW ---- ############
x,y,l,r=invr()
unlucky=[]
for i in range(60):
for j in range(60):
a=pow(x,i)
b=pow(y,j)
if a+b>=l and a+b<=r:
unlucky.append(a+b)
elif a+b>r:
break
unlucky.sort()
ans=0
for i in range(1,len(unlucky)):
ans=max(ans,unlucky[i]-unlucky[i-1]-1)
if len(unlucky):
if unlucky[0]!=l:
ans=max(ans,unlucky[0]-l)
if unlucky[-1]!=r:
ans=max(ans,r-unlucky[-1])
print(ans)
```
| 0
|
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,587,656,689
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 156
| 0
|
n=int(input())
m=list(map(int,input().split()))
e=[]
o=[]
for i in range(n):
if m[i]%2==0:
e.append(n[i])
else:
o.append(n[i])
print(m.index(e[0])+1 if len(e)==1 else m.index(o[0])+1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
n=int(input())
m=list(map(int,input().split()))
e=[]
o=[]
for i in range(n):
if m[i]%2==0:
e.append(n[i])
else:
o.append(n[i])
print(m.index(e[0])+1 if len(e)==1 else m.index(o[0])+1)
```
| -1
|
848
|
E
|
Days of Floral Colours
|
PROGRAMMING
| 3,400
|
[
"combinatorics",
"divide and conquer",
"dp",
"fft",
"math"
] | null | null |
The Floral Clock has been standing by the side of Mirror Lake for years. Though unable to keep time, it reminds people of the passage of time and the good old days.
On the rim of the Floral Clock are 2*n* flowers, numbered from 1 to 2*n* clockwise, each of which has a colour among all *n* possible ones. For each colour, there are exactly two flowers with it, the distance between which either is less than or equal to 2, or equals *n*. Additionally, if flowers *u* and *v* are of the same colour, then flowers opposite to *u* and opposite to *v* should be of the same colour as well — symmetry is beautiful!
Formally, the distance between two flowers is 1 plus the number of flowers on the minor arc (or semicircle) between them. Below is a possible arrangement with *n*<==<=6 that cover all possibilities.
The beauty of an arrangement is defined to be the product of the lengths of flower segments separated by all opposite flowers of the same colour. In other words, in order to compute the beauty, we remove from the circle all flowers that have the same colour as flowers opposite to them. Then, the beauty is the product of lengths of all remaining segments. Note that we include segments of length 0 in this product. If there are no flowers that have the same colour as flower opposite to them, the beauty equals 0. For instance, the beauty of the above arrangement equals 1<=×<=3<=×<=1<=×<=3<==<=9 — the segments are {2}, {4,<=5,<=6}, {8} and {10,<=11,<=12}.
While keeping the constraints satisfied, there may be lots of different arrangements. Find out the sum of beauty over all possible arrangements, modulo 998<=244<=353. Two arrangements are considered different, if a pair (*u*,<=*v*) (1<=≤<=*u*,<=*v*<=≤<=2*n*) exists such that flowers *u* and *v* are of the same colour in one of them, but not in the other.
|
The first and only line of input contains a lonely positive integer *n* (3<=≤<=*n*<=≤<=50<=000) — the number of colours present on the Floral Clock.
|
Output one integer — the sum of beauty over all possible arrangements of flowers, modulo 998<=244<=353.
|
[
"3\n",
"4\n",
"7\n",
"15\n"
] |
[
"24\n",
"4\n",
"1316\n",
"3436404\n"
] |
With *n* = 3, the following six arrangements each have a beauty of 2 × 2 = 4.
While many others, such as the left one in the figure below, have a beauty of 0. The right one is invalid, since it's asymmetric.
| 2,500
|
[
{
"input": "3",
"output": "24"
},
{
"input": "4",
"output": "4"
},
{
"input": "7",
"output": "1316"
},
{
"input": "15",
"output": "3436404"
},
{
"input": "10",
"output": "26200"
},
{
"input": "99",
"output": "620067986"
},
{
"input": "1317",
"output": "414025"
},
{
"input": "50000",
"output": "475800099"
},
{
"input": "5",
"output": "240"
},
{
"input": "6",
"output": "204"
},
{
"input": "8",
"output": "2988"
},
{
"input": "9",
"output": "6720"
},
{
"input": "11",
"output": "50248"
},
{
"input": "12",
"output": "174280"
},
{
"input": "13",
"output": "436904"
},
{
"input": "14",
"output": "1140888"
},
{
"input": "16",
"output": "8348748"
},
{
"input": "17",
"output": "24631232"
},
{
"input": "18",
"output": "64575924"
},
{
"input": "19",
"output": "174658944"
},
{
"input": "20",
"output": "488230244"
},
{
"input": "33",
"output": "823529776"
},
{
"input": "39",
"output": "302870971"
},
{
"input": "89",
"output": "530141864"
},
{
"input": "144",
"output": "395837543"
},
{
"input": "233",
"output": "422271260"
},
{
"input": "396",
"output": "994574954"
},
{
"input": "418",
"output": "57956054"
},
{
"input": "431",
"output": "767293469"
},
{
"input": "831",
"output": "418821250"
},
{
"input": "985",
"output": "574051668"
},
{
"input": "998",
"output": "452930999"
},
{
"input": "1000",
"output": "945359814"
},
{
"input": "2017",
"output": "222633425"
},
{
"input": "3939",
"output": "582943734"
},
{
"input": "5000",
"output": "148029988"
},
{
"input": "8081",
"output": "473740780"
},
{
"input": "10000",
"output": "938538566"
},
{
"input": "10001",
"output": "552705744"
},
{
"input": "10492",
"output": "914991759"
},
{
"input": "20178",
"output": "207394683"
},
{
"input": "23333",
"output": "259575428"
},
{
"input": "25252",
"output": "306102706"
},
{
"input": "30000",
"output": "583465411"
},
{
"input": "35000",
"output": "520751787"
},
{
"input": "39393",
"output": "929692433"
},
{
"input": "40404",
"output": "618777849"
},
{
"input": "45000",
"output": "672059275"
},
{
"input": "49997",
"output": "645043850"
},
{
"input": "49999",
"output": "791828238"
}
] | 1,611,301,061
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 50
| 155
| 1,740,800
|
f = [0, 4, 8, -1, 16, -10, 4, -12, -48, 26, -44, 15, -16, -4, -4, -1]
jly = 998244353
t = 0
x = [0, 0, 0, 24, 4, 240, 204, 1316, 2988, 6720, 26200, 50248, 174280, 436904, 1140888, 3436404]
n = int(input())
for i in range(16, n + 1):
t = 0
for j in range(0, 16):
t = (t + f[(i - j - 1) & 15] * x[j]) % jly
x[i & 15] = t
print((x[n & 15] + jly) % jly)
|
Title: Days of Floral Colours
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Floral Clock has been standing by the side of Mirror Lake for years. Though unable to keep time, it reminds people of the passage of time and the good old days.
On the rim of the Floral Clock are 2*n* flowers, numbered from 1 to 2*n* clockwise, each of which has a colour among all *n* possible ones. For each colour, there are exactly two flowers with it, the distance between which either is less than or equal to 2, or equals *n*. Additionally, if flowers *u* and *v* are of the same colour, then flowers opposite to *u* and opposite to *v* should be of the same colour as well — symmetry is beautiful!
Formally, the distance between two flowers is 1 plus the number of flowers on the minor arc (or semicircle) between them. Below is a possible arrangement with *n*<==<=6 that cover all possibilities.
The beauty of an arrangement is defined to be the product of the lengths of flower segments separated by all opposite flowers of the same colour. In other words, in order to compute the beauty, we remove from the circle all flowers that have the same colour as flowers opposite to them. Then, the beauty is the product of lengths of all remaining segments. Note that we include segments of length 0 in this product. If there are no flowers that have the same colour as flower opposite to them, the beauty equals 0. For instance, the beauty of the above arrangement equals 1<=×<=3<=×<=1<=×<=3<==<=9 — the segments are {2}, {4,<=5,<=6}, {8} and {10,<=11,<=12}.
While keeping the constraints satisfied, there may be lots of different arrangements. Find out the sum of beauty over all possible arrangements, modulo 998<=244<=353. Two arrangements are considered different, if a pair (*u*,<=*v*) (1<=≤<=*u*,<=*v*<=≤<=2*n*) exists such that flowers *u* and *v* are of the same colour in one of them, but not in the other.
Input Specification:
The first and only line of input contains a lonely positive integer *n* (3<=≤<=*n*<=≤<=50<=000) — the number of colours present on the Floral Clock.
Output Specification:
Output one integer — the sum of beauty over all possible arrangements of flowers, modulo 998<=244<=353.
Demo Input:
['3\n', '4\n', '7\n', '15\n']
Demo Output:
['24\n', '4\n', '1316\n', '3436404\n']
Note:
With *n* = 3, the following six arrangements each have a beauty of 2 × 2 = 4.
While many others, such as the left one in the figure below, have a beauty of 0. The right one is invalid, since it's asymmetric.
|
```python
f = [0, 4, 8, -1, 16, -10, 4, -12, -48, 26, -44, 15, -16, -4, -4, -1]
jly = 998244353
t = 0
x = [0, 0, 0, 24, 4, 240, 204, 1316, 2988, 6720, 26200, 50248, 174280, 436904, 1140888, 3436404]
n = int(input())
for i in range(16, n + 1):
t = 0
for j in range(0, 16):
t = (t + f[(i - j - 1) & 15] * x[j]) % jly
x[i & 15] = t
print((x[n & 15] + jly) % jly)
```
| 3
|
|
276
|
A
|
Lunch Rush
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Having written another programming contest, three Rabbits decided to grab some lunch. The coach gave the team exactly *k* time units for the lunch break.
The Rabbits have a list of *n* restaurants to lunch in: the *i*-th restaurant is characterized by two integers *f**i* and *t**i*. Value *t**i* shows the time the Rabbits need to lunch in the *i*-th restaurant. If time *t**i* exceeds the time *k* that the coach has given for the lunch break, then the Rabbits' joy from lunching in this restaurant will equal *f**i*<=-<=(*t**i*<=-<=*k*). Otherwise, the Rabbits get exactly *f**i* units of joy.
Your task is to find the value of the maximum joy the Rabbits can get from the lunch, depending on the restaurant. The Rabbits must choose exactly one restaurant to lunch in. Note that the joy value isn't necessarily a positive value.
|
The first line contains two space-separated integers — *n* (1<=≤<=*n*<=≤<=104) and *k* (1<=≤<=*k*<=≤<=109) — the number of restaurants in the Rabbits' list and the time the coach has given them to lunch, correspondingly. Each of the next *n* lines contains two space-separated integers — *f**i* (1<=≤<=*f**i*<=≤<=109) and *t**i* (1<=≤<=*t**i*<=≤<=109) — the characteristics of the *i*-th restaurant.
|
In a single line print a single integer — the maximum joy value that the Rabbits will get from the lunch.
|
[
"2 5\n3 3\n4 5\n",
"4 6\n5 8\n3 6\n2 3\n2 2\n",
"1 5\n1 7\n"
] |
[
"4\n",
"3\n",
"-1\n"
] |
none
| 500
|
[
{
"input": "2 5\n3 3\n4 5",
"output": "4"
},
{
"input": "4 6\n5 8\n3 6\n2 3\n2 2",
"output": "3"
},
{
"input": "1 5\n1 7",
"output": "-1"
},
{
"input": "4 9\n10 13\n4 18\n13 3\n10 6",
"output": "13"
},
{
"input": "1 1\n1 1000000000",
"output": "-999999998"
},
{
"input": "1 1\n1000000000 1000000000",
"output": "1"
},
{
"input": "1 1\n1000000000 1",
"output": "1000000000"
},
{
"input": "2 3\n1000000000 1\n2 2",
"output": "1000000000"
},
{
"input": "2 5\n1 7\n1 1000000000",
"output": "-1"
}
] | 1,676,714,992
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 124
| 716,800
|
n, k = map(int, input().split())
a = [[int(i) for i in input().split()] for j in range(n)]
mx = -1e9
for i in a:
mx = max(i[0] - i[1] + k if i[1] > k else i[0], mx)
print(mx)
|
Title: Lunch Rush
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Having written another programming contest, three Rabbits decided to grab some lunch. The coach gave the team exactly *k* time units for the lunch break.
The Rabbits have a list of *n* restaurants to lunch in: the *i*-th restaurant is characterized by two integers *f**i* and *t**i*. Value *t**i* shows the time the Rabbits need to lunch in the *i*-th restaurant. If time *t**i* exceeds the time *k* that the coach has given for the lunch break, then the Rabbits' joy from lunching in this restaurant will equal *f**i*<=-<=(*t**i*<=-<=*k*). Otherwise, the Rabbits get exactly *f**i* units of joy.
Your task is to find the value of the maximum joy the Rabbits can get from the lunch, depending on the restaurant. The Rabbits must choose exactly one restaurant to lunch in. Note that the joy value isn't necessarily a positive value.
Input Specification:
The first line contains two space-separated integers — *n* (1<=≤<=*n*<=≤<=104) and *k* (1<=≤<=*k*<=≤<=109) — the number of restaurants in the Rabbits' list and the time the coach has given them to lunch, correspondingly. Each of the next *n* lines contains two space-separated integers — *f**i* (1<=≤<=*f**i*<=≤<=109) and *t**i* (1<=≤<=*t**i*<=≤<=109) — the characteristics of the *i*-th restaurant.
Output Specification:
In a single line print a single integer — the maximum joy value that the Rabbits will get from the lunch.
Demo Input:
['2 5\n3 3\n4 5\n', '4 6\n5 8\n3 6\n2 3\n2 2\n', '1 5\n1 7\n']
Demo Output:
['4\n', '3\n', '-1\n']
Note:
none
|
```python
n, k = map(int, input().split())
a = [[int(i) for i in input().split()] for j in range(n)]
mx = -1e9
for i in a:
mx = max(i[0] - i[1] + k if i[1] > k else i[0], mx)
print(mx)
```
| 3
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,692,574,219
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 20
| 62
| 0
|
t = int(input())
while t > 0:
word = input()
word = word[0] + str(len(word)-2) + word[-1] if len(word) > 10 else word
print(word)
t -= 1
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
t = int(input())
while t > 0:
word = input()
word = word[0] + str(len(word)-2) + word[-1] if len(word) > 10 else word
print(word)
t -= 1
```
| 3.969
|
801
|
A
|
Vicious Keyboard
|
PROGRAMMING
| 1,100
|
[
"brute force"
] | null | null |
Tonio has a keyboard with only two letters, "V" and "K".
One day, he has typed out a string *s* with only these two letters. He really likes it when the string "VK" appears, so he wishes to change at most one letter in the string (or do no changes) to maximize the number of occurrences of that string. Compute the maximum number of times "VK" can appear as a substring (i. e. a letter "K" right after a letter "V") in the resulting string.
|
The first line will contain a string *s* consisting only of uppercase English letters "V" and "K" with length not less than 1 and not greater than 100.
|
Output a single integer, the maximum number of times "VK" can appear as a substring of the given string after changing at most one character.
|
[
"VK\n",
"VV\n",
"V\n",
"VKKKKKKKKKVVVVVVVVVK\n",
"KVKV\n"
] |
[
"1\n",
"1\n",
"0\n",
"3\n",
"1\n"
] |
For the first case, we do not change any letters. "VK" appears once, which is the maximum number of times it could appear.
For the second case, we can change the second character from a "V" to a "K". This will give us the string "VK". This has one occurrence of the string "VK" as a substring.
For the fourth case, we can change the fourth character from a "K" to a "V". This will give us the string "VKKVKKKKKKVVVVVVVVVK". This has three occurrences of the string "VK" as a substring. We can check no other moves can give us strictly more occurrences.
| 500
|
[
{
"input": "VK",
"output": "1"
},
{
"input": "VV",
"output": "1"
},
{
"input": "V",
"output": "0"
},
{
"input": "VKKKKKKKKKVVVVVVVVVK",
"output": "3"
},
{
"input": "KVKV",
"output": "1"
},
{
"input": "VKKVVVKVKVK",
"output": "5"
},
{
"input": "VKVVKVKVVKVKKKKVVVVVVVVKVKVVVVVVKKVKKVKVVKVKKVVVVKV",
"output": "14"
},
{
"input": "VVKKVKKVVKKVKKVKVVKKVKKVVKKVKVVKKVKKVKVVKKVVKKVKVVKKVKVVKKVVKVVKKVKKVKKVKKVKKVKVVKKVKKVKKVKKVKKVVKVK",
"output": "32"
},
{
"input": "KVVKKVKVKVKVKVKKVKVKVVKVKVVKVVKVKKVKVKVKVKVKVKVKVKVKVKVKVKVKVKVVKVKVVKKVKVKK",
"output": "32"
},
{
"input": "KVVVVVKKVKVVKVVVKVVVKKKVKKKVVKVKKKVKKKKVKVVVVVKKKVVVVKKVVVVKKKVKVVVVVVVKKVKVKKKVVKVVVKVVKK",
"output": "21"
},
{
"input": "VVVVVKKVKVKVKVVKVVKKVVKVKKKKKKKVKKKVVVVVVKKVVVKVKVVKVKKVVKVVVKKKKKVVVVVKVVVVKVVVKKVKKVKKKVKKVKKVVKKV",
"output": "25"
},
{
"input": "KKVVKVVKVVKKVVKKVKVVKKV",
"output": "7"
},
{
"input": "KKVVKKVVVKKVKKVKKVVVKVVVKKVKKVVVKKVVVKVVVKVVVKKVVVKKVVVKVVVKKVVVKVVKKVVVKKVVVKKVVKVVVKKVVKKVKKVVVKKV",
"output": "24"
},
{
"input": "KVKVKVKVKVKVKVKVKVKVVKVKVKVKVKVKVKVVKVKVKKVKVKVKVKVVKVKVKVKVKVKVKVKVKKVKVKVV",
"output": "35"
},
{
"input": "VKVVVKKKVKVVKVKVKVKVKVV",
"output": "9"
},
{
"input": "KKKKVKKVKVKVKKKVVVVKK",
"output": "6"
},
{
"input": "KVKVKKVVVVVVKKKVKKKKVVVVKVKKVKVVK",
"output": "9"
},
{
"input": "KKVKKVKKKVKKKVKKKVKVVVKKVVVVKKKVKKVVKVKKVKVKVKVVVKKKVKKKKKVVKVVKVVVKKVVKVVKKKKKVK",
"output": "22"
},
{
"input": "VVVKVKVKVVVVVKVVVKKVVVKVVVVVKKVVKVVVKVVVKVKKKVVKVVVVVKVVVVKKVVKVKKVVKKKVKVVKVKKKKVVKVVVKKKVKVKKKKKK",
"output": "25"
},
{
"input": "VKVVKVVKKKVVKVKKKVVKKKVVKVVKVVKKVKKKVKVKKKVVKVKKKVVKVVKKKVVKKKVKKKVVKKVVKKKVKVKKKVKKKVKKKVKVKKKVVKVK",
"output": "29"
},
{
"input": "KKVKVVVKKVV",
"output": "3"
},
{
"input": "VKVKVKVKVKVKVKVKVKVKVVKVKVKVKVKVK",
"output": "16"
},
{
"input": "VVKKKVVKKKVVKKKVVKKKVVKKKVVKKKVVKKKVVKKKVVKKKVVKKKVVKKKVVKKKVV",
"output": "13"
},
{
"input": "VVKKVKVKKKVVVKVVVKVKKVKKKVVVKVVKVKKVKKVKVKVVKKVVKKVKVVKKKVVKKVVVKVKVVVKVKVVKVKKVKKV",
"output": "26"
},
{
"input": "VVKVKKVVKKVVKKVVKKVVKKVKKVVKVKKVVKKVVKKVVKKVVKKVVKVVKKVVKVVKKVVKVVKKVVKKVKKVVKVVKKVVKVVKKVV",
"output": "26"
},
{
"input": "K",
"output": "0"
},
{
"input": "VKVK",
"output": "2"
},
{
"input": "VKVV",
"output": "2"
},
{
"input": "KV",
"output": "0"
},
{
"input": "KK",
"output": "1"
},
{
"input": "KKVK",
"output": "2"
},
{
"input": "KKKK",
"output": "1"
},
{
"input": "KKV",
"output": "1"
},
{
"input": "KKVKVK",
"output": "3"
},
{
"input": "VKKVK",
"output": "2"
},
{
"input": "VKKK",
"output": "2"
},
{
"input": "KKK",
"output": "1"
},
{
"input": "KVV",
"output": "1"
},
{
"input": "KKVKV",
"output": "2"
},
{
"input": "VVK",
"output": "1"
},
{
"input": "VVVKVKVKVKVKVKVK",
"output": "8"
},
{
"input": "KVVVK",
"output": "2"
},
{
"input": "VVVKK",
"output": "2"
},
{
"input": "KKVV",
"output": "1"
},
{
"input": "KKKKKKK",
"output": "1"
},
{
"input": "VKKKVK",
"output": "3"
},
{
"input": "KKVVV",
"output": "1"
},
{
"input": "VVVVVV",
"output": "1"
},
{
"input": "KKKV",
"output": "1"
},
{
"input": "VVKVV",
"output": "2"
},
{
"input": "VKVKKK",
"output": "3"
},
{
"input": "VKKV",
"output": "1"
},
{
"input": "VKKVV",
"output": "2"
},
{
"input": "VVKKVV",
"output": "2"
},
{
"input": "KKVVKKV",
"output": "2"
},
{
"input": "KKKKK",
"output": "1"
},
{
"input": "VKVVKKVKKVVKVKKVKKKVKKVKVKK",
"output": "10"
},
{
"input": "VKVKVV",
"output": "3"
},
{
"input": "VKVVKVV",
"output": "3"
},
{
"input": "VVV",
"output": "1"
},
{
"input": "VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV",
"output": "1"
},
{
"input": "VVKKKKKKVKK",
"output": "3"
},
{
"input": "KVKVKVV",
"output": "3"
}
] | 1,493,315,136
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 62
| 5,529,600
|
#!/usr/bin/env python
import sys
def countAndReplace(s,needle,repl):
assert(len(needle) == len(repl))
cnt = 0
offset = 0
while True:
p = s.find(needle,offset)
if -1 == p:
break
cnt += 1
offset = p + len(needle)
s = s[0:p] + repl + s[offset:]
return s, cnt
s = sys.stdin.readline().strip()
s,cnt = countAndReplace(s,"VK","XX")
for i in range(0,len(s)):
c = s[i]
if 'X' == c:
continue
if 'V' == c and i > 0 and s[i - 1] == 'V':
cnt += 1
break
if 'K' == c and i > 0 and s[i - 1] == 'K':
cnt += 1
break
print(cnt)
|
Title: Vicious Keyboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Tonio has a keyboard with only two letters, "V" and "K".
One day, he has typed out a string *s* with only these two letters. He really likes it when the string "VK" appears, so he wishes to change at most one letter in the string (or do no changes) to maximize the number of occurrences of that string. Compute the maximum number of times "VK" can appear as a substring (i. e. a letter "K" right after a letter "V") in the resulting string.
Input Specification:
The first line will contain a string *s* consisting only of uppercase English letters "V" and "K" with length not less than 1 and not greater than 100.
Output Specification:
Output a single integer, the maximum number of times "VK" can appear as a substring of the given string after changing at most one character.
Demo Input:
['VK\n', 'VV\n', 'V\n', 'VKKKKKKKKKVVVVVVVVVK\n', 'KVKV\n']
Demo Output:
['1\n', '1\n', '0\n', '3\n', '1\n']
Note:
For the first case, we do not change any letters. "VK" appears once, which is the maximum number of times it could appear.
For the second case, we can change the second character from a "V" to a "K". This will give us the string "VK". This has one occurrence of the string "VK" as a substring.
For the fourth case, we can change the fourth character from a "K" to a "V". This will give us the string "VKKVKKKKKKVVVVVVVVVK". This has three occurrences of the string "VK" as a substring. We can check no other moves can give us strictly more occurrences.
|
```python
#!/usr/bin/env python
import sys
def countAndReplace(s,needle,repl):
assert(len(needle) == len(repl))
cnt = 0
offset = 0
while True:
p = s.find(needle,offset)
if -1 == p:
break
cnt += 1
offset = p + len(needle)
s = s[0:p] + repl + s[offset:]
return s, cnt
s = sys.stdin.readline().strip()
s,cnt = countAndReplace(s,"VK","XX")
for i in range(0,len(s)):
c = s[i]
if 'X' == c:
continue
if 'V' == c and i > 0 and s[i - 1] == 'V':
cnt += 1
break
if 'K' == c and i > 0 and s[i - 1] == 'K':
cnt += 1
break
print(cnt)
```
| 3
|
|
205
|
A
|
Little Elephant and Rozdil
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
|
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
|
[
"2\n7 4\n",
"7\n7 4 47 100 4 9 12\n"
] |
[
"2\n",
"Still Rozdil\n"
] |
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
| 500
|
[
{
"input": "2\n7 4",
"output": "2"
},
{
"input": "7\n7 4 47 100 4 9 12",
"output": "Still Rozdil"
},
{
"input": "1\n47",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "Still Rozdil"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "7"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "Still Rozdil"
},
{
"input": "4\n1000000000 100000000 1000000 1000000",
"output": "Still Rozdil"
},
{
"input": "20\n7 1 1 2 1 1 8 7 7 8 4 3 7 10 5 3 10 5 10 6",
"output": "Still Rozdil"
},
{
"input": "20\n3 3 6 9 8 2 4 1 7 3 2 9 7 7 9 7 2 6 2 7",
"output": "8"
},
{
"input": "47\n35 79 84 56 67 95 80 34 77 68 14 55 95 32 40 89 58 79 96 66 50 79 35 86 31 74 91 35 22 72 84 38 11 59 73 51 65 11 11 62 30 12 32 71 69 15 11",
"output": "Still Rozdil"
},
{
"input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "32"
},
{
"input": "25\n73 56 65 70 57 57 49 50 65 68 54 48 66 55 55 66 60 70 47 62 63 70 62 70 63",
"output": "19"
},
{
"input": "100\n922 938 103 689 526 118 314 496 373 47 224 544 495 656 804 754 269 356 354 536 817 597 787 178 516 659 790 993 786 169 866 779 997 350 674 437 219 546 564 893 402 449 751 628 238 686 392 951 716 439 332 563 215 146 746 311 866 773 548 675 731 183 890 802 488 944 473 25 662 559 732 534 777 144 502 593 839 692 84 337 679 718 1005 663 709 940 86 469 310 960 902 233 606 761 116 231 662 903 68 622",
"output": "68"
},
{
"input": "5\n5 5 2 3 1",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "3\n7 7 4",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "3"
},
{
"input": "3\n4 4 3",
"output": "3"
},
{
"input": "2\n10000001 10000002",
"output": "1"
},
{
"input": "4\n3 3 2 1",
"output": "4"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "2\n1000000000 100000000",
"output": "2"
},
{
"input": "1\n99999999",
"output": "1"
},
{
"input": "3\n5 5 3",
"output": "3"
},
{
"input": "3\n7 7 5",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "3"
},
{
"input": "4\n10 10 10 1",
"output": "4"
}
] | 1,680,265,021
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 45
| 184
| 13,516,800
|
n = int(input())
a = list(map(int,input().split()))
min_el = min(a)
ans = a.count(min_el)
if(ans>1):
print("Still Rozdil")
else:
print(a.index(min_el)+1)
|
Title: Little Elephant and Rozdil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
Output Specification:
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
Demo Input:
['2\n7 4\n', '7\n7 4 47 100 4 9 12\n']
Demo Output:
['2\n', 'Still Rozdil\n']
Note:
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil".
|
```python
n = int(input())
a = list(map(int,input().split()))
min_el = min(a)
ans = a.count(min_el)
if(ans>1):
print("Still Rozdil")
else:
print(a.index(min_el)+1)
```
| 3
|
|
591
|
A
|
Wizards' Duel
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
|
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
|
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
|
[
"100\n50\n50\n",
"199\n60\n40\n"
] |
[
"50\n",
"119.4\n"
] |
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
| 500
|
[
{
"input": "100\n50\n50",
"output": "50"
},
{
"input": "199\n60\n40",
"output": "119.4"
},
{
"input": "1\n1\n1",
"output": "0.5"
},
{
"input": "1\n1\n500",
"output": "0.001996007984"
},
{
"input": "1\n500\n1",
"output": "0.998003992"
},
{
"input": "1\n500\n500",
"output": "0.5"
},
{
"input": "1000\n1\n1",
"output": "500"
},
{
"input": "1000\n1\n500",
"output": "1.996007984"
},
{
"input": "1000\n500\n1",
"output": "998.003992"
},
{
"input": "1000\n500\n500",
"output": "500"
},
{
"input": "101\n11\n22",
"output": "33.66666667"
},
{
"input": "987\n1\n3",
"output": "246.75"
},
{
"input": "258\n25\n431",
"output": "14.14473684"
},
{
"input": "979\n39\n60",
"output": "385.6666667"
},
{
"input": "538\n479\n416",
"output": "287.9351955"
},
{
"input": "583\n112\n248",
"output": "181.3777778"
},
{
"input": "978\n467\n371",
"output": "545.0190931"
},
{
"input": "980\n322\n193",
"output": "612.7378641"
},
{
"input": "871\n401\n17",
"output": "835.576555"
},
{
"input": "349\n478\n378",
"output": "194.885514"
},
{
"input": "425\n458\n118",
"output": "337.9340278"
},
{
"input": "919\n323\n458",
"output": "380.0729834"
},
{
"input": "188\n59\n126",
"output": "59.95675676"
},
{
"input": "644\n428\n484",
"output": "302.2280702"
},
{
"input": "253\n80\n276",
"output": "56.85393258"
},
{
"input": "745\n152\n417",
"output": "199.0158172"
},
{
"input": "600\n221\n279",
"output": "265.2"
},
{
"input": "690\n499\n430",
"output": "370.6243272"
},
{
"input": "105\n68\n403",
"output": "15.15923567"
},
{
"input": "762\n462\n371",
"output": "422.6218487"
},
{
"input": "903\n460\n362",
"output": "505.3284672"
},
{
"input": "886\n235\n95",
"output": "630.9393939"
},
{
"input": "655\n203\n18",
"output": "601.6515837"
},
{
"input": "718\n29\n375",
"output": "51.53960396"
},
{
"input": "296\n467\n377",
"output": "163.7819905"
},
{
"input": "539\n61\n56",
"output": "281.017094"
},
{
"input": "133\n53\n124",
"output": "39.82485876"
},
{
"input": "998\n224\n65",
"output": "773.5363322"
},
{
"input": "961\n173\n47",
"output": "755.6954545"
},
{
"input": "285\n468\n62",
"output": "251.6603774"
},
{
"input": "496\n326\n429",
"output": "214.1668874"
},
{
"input": "627\n150\n285",
"output": "216.2068966"
},
{
"input": "961\n443\n50",
"output": "863.535497"
},
{
"input": "623\n422\n217",
"output": "411.4334898"
},
{
"input": "678\n295\n29",
"output": "617.3148148"
}
] | 1,490,740,022
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 62
| 5,529,600
|
# Description of the problem can be found at http://codeforces.com/problemset/problem/591/A
l = int(input())
p = int(input())
q = int(input())
print((l / (p + q)) * p)
|
Title: Wizards' Duel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
Input Specification:
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Output Specification:
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['100\n50\n50\n', '199\n60\n40\n']
Demo Output:
['50\n', '119.4\n']
Note:
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor.
|
```python
# Description of the problem can be found at http://codeforces.com/problemset/problem/591/A
l = int(input())
p = int(input())
q = int(input())
print((l / (p + q)) * p)
```
| 3
|
|
975
|
C
|
Valhalla Siege
|
PROGRAMMING
| 1,400
|
[
"binary search"
] | null | null |
Ivar the Boneless is a great leader. He is trying to capture Kattegat from Lagertha. The war has begun and wave after wave Ivar's warriors are falling in battle.
Ivar has $n$ warriors, he places them on a straight line in front of the main gate, in a way that the $i$-th warrior stands right after $(i-1)$-th warrior. The first warrior leads the attack.
Each attacker can take up to $a_i$ arrows before he falls to the ground, where $a_i$ is the $i$-th warrior's strength.
Lagertha orders her warriors to shoot $k_i$ arrows during the $i$-th minute, the arrows one by one hit the first still standing warrior. After all Ivar's warriors fall and all the currently flying arrows fly by, Thor smashes his hammer and all Ivar's warriors get their previous strengths back and stand up to fight again. In other words, if all warriors die in minute $t$, they will all be standing to fight at the end of minute $t$.
The battle will last for $q$ minutes, after each minute you should tell Ivar what is the number of his standing warriors.
|
The first line contains two integers $n$ and $q$ ($1 \le n, q \leq 200\,000$) — the number of warriors and the number of minutes in the battle.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) that represent the warriors' strengths.
The third line contains $q$ integers $k_1, k_2, \ldots, k_q$ ($1 \leq k_i \leq 10^{14}$), the $i$-th of them represents Lagertha's order at the $i$-th minute: $k_i$ arrows will attack the warriors.
|
Output $q$ lines, the $i$-th of them is the number of standing warriors after the $i$-th minute.
|
[
"5 5\n1 2 1 2 1\n3 10 1 1 1\n",
"4 4\n1 2 3 4\n9 1 10 6\n"
] |
[
"3\n5\n4\n4\n3\n",
"1\n4\n4\n1\n"
] |
In the first example:
- after the 1-st minute, the 1-st and 2-nd warriors die. - after the 2-nd minute all warriors die (and all arrows left over are wasted), then they will be revived thus answer is 5 — all warriors are alive. - after the 3-rd minute, the 1-st warrior dies. - after the 4-th minute, the 2-nd warrior takes a hit and his strength decreases by 1. - after the 5-th minute, the 2-nd warrior dies.
| 1,500
|
[
{
"input": "5 5\n1 2 1 2 1\n3 10 1 1 1",
"output": "3\n5\n4\n4\n3"
},
{
"input": "4 4\n1 2 3 4\n9 1 10 6",
"output": "1\n4\n4\n1"
},
{
"input": "10 3\n1 1 1 1 1 1 1 1 1 1\n10 10 5",
"output": "10\n10\n5"
},
{
"input": "1 1\n56563128\n897699770",
"output": "1"
},
{
"input": "100 55\n1 2 4 4 3 5 5 2 3 4 2 1 1 2 3 5 1 5 4 2 5 4 4 3 3 5 3 4 4 5 5 2 3 3 4 4 3 4 5 5 5 5 3 5 1 2 4 3 4 5 3 3 2 1 4 5 3 4 4 1 5 1 5 2 2 1 4 5 3 3 1 4 2 5 4 5 3 2 5 5 2 3 2 3 2 2 3 4 4 4 1 4 2 4 5 3 1 3 3 1\n5 2 1 4 3 4 3 1 4 4 1 2 3 2 1 5 5 4 5 4 2 5 2 1 5 1 4 4 3 5 4 5 1 4 4 1 5 3 1 5 2 4 1 3 2 5 4 5 4 3 4 2 2 4 3",
"output": "98\n97\n97\n96\n95\n94\n94\n94\n92\n91\n91\n90\n87\n86\n86\n85\n83\n82\n80\n80\n79\n78\n77\n77\n75\n75\n74\n73\n72\n71\n70\n69\n69\n67\n66\n66\n65\n64\n63\n62\n62\n61\n61\n60\n60\n59\n58\n57\n54\n54\n52\n52\n51\n51\n50"
}
] | 1,696,436,279
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 608
| 36,352,000
|
from bisect import bisect_right
n,q = map(int, input().split())
a = list(map(int, input().split()))
zzz = 1
k = list(map(int, input().split()))
for i in range(1,n):
a[i] = a[i] + a[i-1]
cc=0
for i in k:
cc += i
t = bisect_right(a, cc)
if n!=t:
print(n-t)
else:
print(n)
cc=0
|
Title: Valhalla Siege
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivar the Boneless is a great leader. He is trying to capture Kattegat from Lagertha. The war has begun and wave after wave Ivar's warriors are falling in battle.
Ivar has $n$ warriors, he places them on a straight line in front of the main gate, in a way that the $i$-th warrior stands right after $(i-1)$-th warrior. The first warrior leads the attack.
Each attacker can take up to $a_i$ arrows before he falls to the ground, where $a_i$ is the $i$-th warrior's strength.
Lagertha orders her warriors to shoot $k_i$ arrows during the $i$-th minute, the arrows one by one hit the first still standing warrior. After all Ivar's warriors fall and all the currently flying arrows fly by, Thor smashes his hammer and all Ivar's warriors get their previous strengths back and stand up to fight again. In other words, if all warriors die in minute $t$, they will all be standing to fight at the end of minute $t$.
The battle will last for $q$ minutes, after each minute you should tell Ivar what is the number of his standing warriors.
Input Specification:
The first line contains two integers $n$ and $q$ ($1 \le n, q \leq 200\,000$) — the number of warriors and the number of minutes in the battle.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) that represent the warriors' strengths.
The third line contains $q$ integers $k_1, k_2, \ldots, k_q$ ($1 \leq k_i \leq 10^{14}$), the $i$-th of them represents Lagertha's order at the $i$-th minute: $k_i$ arrows will attack the warriors.
Output Specification:
Output $q$ lines, the $i$-th of them is the number of standing warriors after the $i$-th minute.
Demo Input:
['5 5\n1 2 1 2 1\n3 10 1 1 1\n', '4 4\n1 2 3 4\n9 1 10 6\n']
Demo Output:
['3\n5\n4\n4\n3\n', '1\n4\n4\n1\n']
Note:
In the first example:
- after the 1-st minute, the 1-st and 2-nd warriors die. - after the 2-nd minute all warriors die (and all arrows left over are wasted), then they will be revived thus answer is 5 — all warriors are alive. - after the 3-rd minute, the 1-st warrior dies. - after the 4-th minute, the 2-nd warrior takes a hit and his strength decreases by 1. - after the 5-th minute, the 2-nd warrior dies.
|
```python
from bisect import bisect_right
n,q = map(int, input().split())
a = list(map(int, input().split()))
zzz = 1
k = list(map(int, input().split()))
for i in range(1,n):
a[i] = a[i] + a[i-1]
cc=0
for i in k:
cc += i
t = bisect_right(a, cc)
if n!=t:
print(n-t)
else:
print(n)
cc=0
```
| 3
|
|
814
|
A
|
An abandoned sentiment from past
|
PROGRAMMING
| 900
|
[
"constructive algorithms",
"greedy",
"implementation",
"sortings"
] | null | null |
A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing.
|
The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total.
|
Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise.
|
[
"4 2\n11 0 0 14\n5 4\n",
"6 1\n2 3 0 8 9 10\n5\n",
"4 1\n8 94 0 4\n89\n",
"7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n"
] |
[
"Yes\n",
"No\n",
"Yes\n",
"Yes\n"
] |
In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid.
| 500
|
[
{
"input": "4 2\n11 0 0 14\n5 4",
"output": "Yes"
},
{
"input": "6 1\n2 3 0 8 9 10\n5",
"output": "No"
},
{
"input": "4 1\n8 94 0 4\n89",
"output": "Yes"
},
{
"input": "7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7",
"output": "Yes"
},
{
"input": "40 1\n23 26 27 28 31 35 38 40 43 50 52 53 56 57 59 61 65 73 75 76 79 0 82 84 85 86 88 93 99 101 103 104 105 106 110 111 112 117 119 120\n80",
"output": "No"
},
{
"input": "100 1\n99 95 22 110 47 20 37 34 23 0 16 69 64 49 111 42 112 96 13 40 18 77 44 46 74 55 15 54 56 75 78 100 82 101 31 83 53 80 52 63 30 57 104 36 67 65 103 51 48 26 68 59 35 92 85 38 107 98 73 90 62 43 32 89 19 106 17 88 41 72 113 86 66 102 81 27 29 50 71 79 109 91 70 39 61 76 93 84 108 97 24 25 45 105 94 60 33 87 14 21\n58",
"output": "Yes"
},
{
"input": "4 1\n2 1 0 4\n3",
"output": "Yes"
},
{
"input": "2 1\n199 0\n200",
"output": "No"
},
{
"input": "3 2\n115 0 0\n145 191",
"output": "Yes"
},
{
"input": "5 1\n196 197 198 0 200\n199",
"output": "No"
},
{
"input": "5 1\n92 0 97 99 100\n93",
"output": "No"
},
{
"input": "3 1\n3 87 0\n81",
"output": "Yes"
},
{
"input": "3 1\n0 92 192\n118",
"output": "Yes"
},
{
"input": "10 1\n1 3 0 7 35 46 66 72 83 90\n22",
"output": "Yes"
},
{
"input": "100 1\n14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 0 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113\n67",
"output": "No"
},
{
"input": "100 5\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 0 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 0 53 54 0 56 57 58 59 60 61 62 63 0 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 0 99 100\n98 64 55 52 29",
"output": "Yes"
},
{
"input": "100 5\n175 30 124 0 12 111 6 0 119 108 0 38 127 3 151 114 95 54 4 128 91 11 168 120 80 107 18 21 149 169 0 141 195 20 78 157 33 118 17 69 105 130 197 57 74 110 138 84 71 172 132 93 191 44 152 156 24 101 146 26 2 36 143 122 104 42 103 97 39 116 115 0 155 87 53 85 7 43 65 196 136 154 16 79 45 129 67 150 35 73 55 76 37 147 112 82 162 58 40 75\n121 199 62 193 27",
"output": "Yes"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 0 10 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n11",
"output": "Yes"
},
{
"input": "100 1\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n1",
"output": "No"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 0\n100",
"output": "No"
},
{
"input": "100 1\n9 79 7 98 10 50 28 99 43 74 89 20 32 66 23 45 87 78 81 41 86 71 75 85 5 39 14 53 42 48 40 52 3 51 11 34 35 76 77 61 47 19 55 91 62 56 8 72 88 4 33 0 97 92 31 83 18 49 54 21 17 16 63 44 84 22 2 96 70 36 68 60 80 82 13 73 26 94 27 58 1 30 100 38 12 15 93 90 57 59 67 6 64 46 25 29 37 95 69 24\n65",
"output": "Yes"
},
{
"input": "100 2\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 0 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n48 1",
"output": "Yes"
},
{
"input": "100 1\n2 7 11 17 20 22 23 24 25 27 29 30 31 33 34 35 36 38 39 40 42 44 46 47 50 52 53 58 59 60 61 62 63 66 0 67 71 72 75 79 80 81 86 91 93 94 99 100 101 102 103 104 105 108 109 110 111 113 114 118 119 120 122 123 127 129 130 131 132 133 134 135 136 138 139 140 141 142 147 154 155 156 160 168 170 171 172 176 179 180 181 182 185 186 187 188 189 190 194 198\n69",
"output": "Yes"
},
{
"input": "100 1\n3 5 7 9 11 12 13 18 20 21 22 23 24 27 28 29 31 34 36 38 39 43 46 48 49 50 52 53 55 59 60 61 62 63 66 68 70 72 73 74 75 77 78 79 80 81 83 85 86 88 89 91 92 94 97 98 102 109 110 115 116 117 118 120 122 126 127 128 0 133 134 136 137 141 142 144 145 147 151 152 157 159 160 163 164 171 172 175 176 178 179 180 181 184 186 188 190 192 193 200\n129",
"output": "No"
},
{
"input": "5 2\n0 2 7 0 10\n1 8",
"output": "Yes"
},
{
"input": "3 1\n5 4 0\n1",
"output": "Yes"
},
{
"input": "3 1\n1 0 3\n4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n1",
"output": "No"
},
{
"input": "2 1\n0 5\n7",
"output": "Yes"
},
{
"input": "5 1\n10 11 0 12 13\n1",
"output": "Yes"
},
{
"input": "5 1\n0 2 3 4 5\n6",
"output": "Yes"
},
{
"input": "6 2\n1 0 3 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "7 2\n1 2 3 0 0 6 7\n4 5",
"output": "Yes"
},
{
"input": "4 1\n1 2 3 0\n4",
"output": "No"
},
{
"input": "2 2\n0 0\n1 2",
"output": "Yes"
},
{
"input": "3 2\n1 0 0\n2 3",
"output": "Yes"
},
{
"input": "4 2\n1 0 4 0\n5 2",
"output": "Yes"
},
{
"input": "2 1\n0 1\n2",
"output": "Yes"
},
{
"input": "5 2\n1 0 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 4 5\n1",
"output": "Yes"
},
{
"input": "3 1\n0 2 3\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 5 0\n6",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n5 0 2\n7",
"output": "Yes"
},
{
"input": "4 1\n4 5 0 8\n3",
"output": "Yes"
},
{
"input": "5 1\n10 11 12 0 14\n13",
"output": "No"
},
{
"input": "4 1\n1 2 0 4\n5",
"output": "Yes"
},
{
"input": "3 1\n0 11 14\n12",
"output": "Yes"
},
{
"input": "4 1\n1 3 0 4\n2",
"output": "Yes"
},
{
"input": "2 1\n0 5\n1",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 7\n5",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n1",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 5 4\n6",
"output": "Yes"
},
{
"input": "4 2\n11 0 0 14\n13 12",
"output": "Yes"
},
{
"input": "2 1\n1 0\n2",
"output": "No"
},
{
"input": "3 1\n1 2 0\n3",
"output": "No"
},
{
"input": "4 1\n1 0 3 2\n4",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n5",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n3",
"output": "Yes"
},
{
"input": "4 1\n0 2 3 4\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n1 2 0\n5",
"output": "No"
},
{
"input": "4 2\n1 0 0 4\n3 2",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 5 7\n6",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n4",
"output": "No"
},
{
"input": "3 1\n1 0 11\n5",
"output": "No"
},
{
"input": "4 1\n7 9 5 0\n8",
"output": "Yes"
},
{
"input": "6 2\n1 2 3 0 5 0\n6 4",
"output": "Yes"
},
{
"input": "3 2\n0 1 0\n3 2",
"output": "Yes"
},
{
"input": "4 1\n6 9 5 0\n8",
"output": "Yes"
},
{
"input": "2 1\n0 3\n6",
"output": "Yes"
},
{
"input": "5 2\n1 2 0 0 5\n4 3",
"output": "Yes"
},
{
"input": "4 2\n2 0 0 8\n3 4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n3",
"output": "Yes"
},
{
"input": "3 1\n0 4 5\n6",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 0 5\n6",
"output": "Yes"
},
{
"input": "2 1\n2 0\n3",
"output": "No"
},
{
"input": "4 2\n11 0 0 200\n100 199",
"output": "Yes"
},
{
"input": "2 1\n5 0\n4",
"output": "Yes"
},
{
"input": "3 1\n1 0 5\n10",
"output": "Yes"
},
{
"input": "6 2\n1 2 0 0 5 6\n3 4",
"output": "Yes"
},
{
"input": "5 2\n1 0 3 0 5\n2 4",
"output": "Yes"
},
{
"input": "4 1\n1 4 0 8\n3",
"output": "Yes"
},
{
"input": "4 1\n5 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 7\n3 2",
"output": "Yes"
},
{
"input": "3 3\n0 0 0\n1 4 3",
"output": "Yes"
},
{
"input": "5 5\n0 0 0 0 0\n5 4 3 2 1",
"output": "Yes"
},
{
"input": "4 1\n3 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 4\n2 3",
"output": "Yes"
},
{
"input": "6 1\n2 4 0 8 9 10\n3",
"output": "Yes"
},
{
"input": "4 1\n0 3 5 6\n9",
"output": "Yes"
},
{
"input": "4 2\n1 2 0 0\n3 4",
"output": "Yes"
},
{
"input": "5 1\n2 3 4 5 0\n1",
"output": "Yes"
},
{
"input": "3 1\n2 0 4\n5",
"output": "Yes"
}
] | 1,539,892,950
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 96
| 155
| 0
|
n,k=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
b=sorted(b)
b.reverse()
for i in range(len(b)):
for j in range(len(a)):
if(a[j]==0):
a[j]=b[i]
break
l=0
for i in range(len(a)-1):
if(a[i]<a[i+1]):
l+=1
if(l!=n-1):
print('Yes')
else:
print('No')
|
Title: An abandoned sentiment from past
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing.
Input Specification:
The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total.
Output Specification:
Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise.
Demo Input:
['4 2\n11 0 0 14\n5 4\n', '6 1\n2 3 0 8 9 10\n5\n', '4 1\n8 94 0 4\n89\n', '7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n', 'Yes\n']
Note:
In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid.
|
```python
n,k=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
b=sorted(b)
b.reverse()
for i in range(len(b)):
for j in range(len(a)):
if(a[j]==0):
a[j]=b[i]
break
l=0
for i in range(len(a)-1):
if(a[i]<a[i+1]):
l+=1
if(l!=n-1):
print('Yes')
else:
print('No')
```
| 3
|
|
717
|
I
|
Cowboy Beblop at his computer
|
PROGRAMMING
| 2,800
|
[
"geometry"
] | null | null |
Cowboy Beblop is a funny little boy who likes sitting at his computer. He somehow obtained two elastic hoops in the shape of 2D polygons, which are not necessarily convex. Since there's no gravity on his spaceship, the hoops are standing still in the air. Since the hoops are very elastic, Cowboy Beblop can stretch, rotate, translate or shorten their edges as much as he wants.
For both hoops, you are given the number of their vertices, as well as the position of each vertex, defined by the X , Y and Z coordinates. The vertices are given in the order they're connected: the 1st vertex is connected to the 2nd, which is connected to the 3rd, etc., and the last vertex is connected to the first one. Two hoops are connected if it's impossible to pull them to infinity in different directions by manipulating their edges, without having their edges or vertices intersect at any point – just like when two links of a chain are connected. The polygons' edges do not intersect or overlap.
To make things easier, we say that two polygons are well-connected, if the edges of one polygon cross the area of the other polygon in two different directions (from the upper and lower sides of the plane defined by that polygon) a different number of times.
Cowboy Beblop is fascinated with the hoops he has obtained and he would like to know whether they are well-connected or not. Since he’s busy playing with his dog, Zwei, he’d like you to figure it out for him. He promised you some sweets if you help him!
|
The first line of input contains an integer *n* (3<=≤<=*n*<=≤<=100<=000), which denotes the number of edges of the first polygon. The next N lines each contain the integers *x*, *y* and *z* (<=-<=1<=000<=000<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — coordinates of the vertices, in the manner mentioned above. The next line contains an integer *m* (3<=≤<=*m*<=≤<=100<=000) , denoting the number of edges of the second polygon, followed by *m* lines containing the coordinates of the second polygon’s vertices.
It is guaranteed that both polygons are simple (no self-intersections), and in general that the obtained polygonal lines do not intersect each other. Also, you can assume that no 3 consecutive points of a polygon lie on the same line.
|
Your output should contain only one line, with the words "YES" or "NO", depending on whether the two given polygons are well-connected.
|
[
"4\n0 0 0\n2 0 0\n2 2 0\n0 2 0\n4\n1 1 -1\n1 1 1\n1 3 1\n1 3 -1\n"
] |
[
"YES\n"
] |
On the picture below, the two polygons are well-connected, as the edges of the vertical polygon cross the area of the horizontal one exactly once in one direction (for example, from above to below), and zero times in the other (in this case, from below to above). Note that the polygons do not have to be parallel to any of the xy-,xz-,yz- planes in general. <img class="tex-graphics" src="https://espresso.codeforces.com/4b5198028f3c57ef65791f641cca363e82b1c219.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 0
|
[
{
"input": "4\n0 0 0\n2 0 0\n2 2 0\n0 2 0\n4\n1 1 -1\n1 1 1\n1 3 1\n1 3 -1",
"output": "YES"
},
{
"input": "4\n4 -2 0\n4 3 0\n-3 3 0\n-3 -2 0\n4\n6 -2 0\n3 2 2\n-3 7 0\n3 4 6",
"output": "NO"
},
{
"input": "4\n-6 6 0\n13 9 0\n15 -7 0\n-5 -5 0\n4\n2 0 4\n2 6 8\n2 12 1\n2 4 -4",
"output": "YES"
},
{
"input": "3\n2 16 0\n8 -6 -8\n8 3 8\n4\n-10 5 0\n25 18 0\n23 8 0\n-9 0 0",
"output": "NO"
},
{
"input": "4\n-10 5 0\n25 18 0\n23 8 0\n-9 0 0\n5\n7 12 -5\n7 0 -10\n7 3 8\n7 10 7\n7 6 0",
"output": "YES"
},
{
"input": "5\n942 -816 0\n573 1114 0\n-800 1000 0\n250 500 0\n-2012 684 0\n4\n1615 -150 0\n150 1200 -900\n-1514 1340 0\n582 -454 1098",
"output": "NO"
},
{
"input": "8\n0 1000 0\n436 1013 0\n500 500 0\n1000 500 0\n1000 1000 0\n1401 1000 0\n1500 0 0\n0 0 0\n8\n-200 1000 400\n150 1000 400\n125 250 -500\n850 250 -500\n750 1000 400\n1200 1000 400\n1250 0 -800\n-250 0 -800",
"output": "YES"
},
{
"input": "4\n3390 -1280 0\n1500 -200 -1000\n-950 1200 0\n1500 -200 1650\n9\n2500 900 0\n500 1200 0\n-600 1000 0\n100 600 0\n-2000 700 0\n3500 -2500 0\n3750 -550 0\n2410 -720 0\n600 -400 0",
"output": "YES"
},
{
"input": "4\n0 1000 -700\n1500 1000 -700\n1500 1000 500\n0 1000 500\n5\n0 500 0\n1500 1500 0\n0 1500 0\n250 1000 0\n500 1000 0",
"output": "NO"
},
{
"input": "9\n1824 1717 0\n573 1114 0\n-850 0 0\n0 0 0\n949 665 0\n3700 -1200 0\n3639 485 0\n2500 0 0\n2741 578 0\n7\n1300 0 -1000\n-800 0 -1000\n-1500 0 0\n-1087 0 1400\n470 0 0\n740 0 1800\n3320 0 0",
"output": "YES"
},
{
"input": "14\n900 -2000 0\n2600 -2000 0\n2600 500 0\n900 500 0\n900 -1500 0\n2200 -1500 0\n2200 -200 0\n1900 -300 0\n1900 -1200 0\n1100 -1250 0\n1100 150 0\n2350 150 0\n2350 -1750 0\n900 -1750 0\n4\n3100 -750 -500\n1500 -750 -500\n1500 -750 500\n3100 -750 500",
"output": "NO"
},
{
"input": "9\n2564 865 0\n573 1115 0\n-600 1000 0\n100 600 0\n949 665 0\n2341 -2375 0\n3879 -561 0\n2200 -600 0\n2543 -250 0\n10\n2900 -1000 0\n280 60 900\n1990 -480 0\n1710 -320 0\n830 450 -550\n660 280 0\n270 260 500\n345 460 0\n-520 1440 -1000\n1300 400 -1000",
"output": "NO"
},
{
"input": "16\n0 1000 0\n436 1013 0\n500 500 0\n1000 500 0\n1000 1000 0\n1401 1028 0\n1434 461 0\n2087 442 0\n2066 1040 0\n2492 1031 0\n2541 449 0\n3069 451 0\n3050 1071 0\n3702 1071 0\n3754 0 0\n0 0 0\n16\n-243 700 394\n109 700 365\n129 700 -366\n763 700 -366\n725 700 397\n1131 700 409\n1173 700 -339\n1910 700 -405\n1834 700 414\n2254 700 439\n2323 700 -425\n2847 700 -380\n2849 700 477\n3418 700 470\n3537 700 -1057\n-294 700 -777",
"output": "YES"
},
{
"input": "16\n0 1000 0\n436 1013 0\n509 517 0\n1000 500 0\n1000 1000 0\n1401 1028 0\n1434 461 0\n2086 442 0\n2079 1044 0\n2506 1032 0\n2549 450 0\n3077 446 0\n3063 1067 0\n3715 1062 0\n3756 -125 0\n0 0 0\n16\n-243 700 394\n109 700 365\n129 700 -366\n763 700 -366\n725 700 397\n1131 700 409\n1173 700 -339\n2294 700 -439\n2238 700 513\n2711 700 500\n2773 700 -473\n3374 700 -402\n3386 700 515\n3925 700 451\n3880 700 -975\n-294 700 -777",
"output": "NO"
}
] | 1,572,886,258
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 124
| 512,000
|
import random
a=random.randint(1,25)
if (a<=11):
print("YES")
else:
print("NO")
exit()
#vlvflv
|
Title: Cowboy Beblop at his computer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Cowboy Beblop is a funny little boy who likes sitting at his computer. He somehow obtained two elastic hoops in the shape of 2D polygons, which are not necessarily convex. Since there's no gravity on his spaceship, the hoops are standing still in the air. Since the hoops are very elastic, Cowboy Beblop can stretch, rotate, translate or shorten their edges as much as he wants.
For both hoops, you are given the number of their vertices, as well as the position of each vertex, defined by the X , Y and Z coordinates. The vertices are given in the order they're connected: the 1st vertex is connected to the 2nd, which is connected to the 3rd, etc., and the last vertex is connected to the first one. Two hoops are connected if it's impossible to pull them to infinity in different directions by manipulating their edges, without having their edges or vertices intersect at any point – just like when two links of a chain are connected. The polygons' edges do not intersect or overlap.
To make things easier, we say that two polygons are well-connected, if the edges of one polygon cross the area of the other polygon in two different directions (from the upper and lower sides of the plane defined by that polygon) a different number of times.
Cowboy Beblop is fascinated with the hoops he has obtained and he would like to know whether they are well-connected or not. Since he’s busy playing with his dog, Zwei, he’d like you to figure it out for him. He promised you some sweets if you help him!
Input Specification:
The first line of input contains an integer *n* (3<=≤<=*n*<=≤<=100<=000), which denotes the number of edges of the first polygon. The next N lines each contain the integers *x*, *y* and *z* (<=-<=1<=000<=000<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — coordinates of the vertices, in the manner mentioned above. The next line contains an integer *m* (3<=≤<=*m*<=≤<=100<=000) , denoting the number of edges of the second polygon, followed by *m* lines containing the coordinates of the second polygon’s vertices.
It is guaranteed that both polygons are simple (no self-intersections), and in general that the obtained polygonal lines do not intersect each other. Also, you can assume that no 3 consecutive points of a polygon lie on the same line.
Output Specification:
Your output should contain only one line, with the words "YES" or "NO", depending on whether the two given polygons are well-connected.
Demo Input:
['4\n0 0 0\n2 0 0\n2 2 0\n0 2 0\n4\n1 1 -1\n1 1 1\n1 3 1\n1 3 -1\n']
Demo Output:
['YES\n']
Note:
On the picture below, the two polygons are well-connected, as the edges of the vertical polygon cross the area of the horizontal one exactly once in one direction (for example, from above to below), and zero times in the other (in this case, from below to above). Note that the polygons do not have to be parallel to any of the xy-,xz-,yz- planes in general. <img class="tex-graphics" src="https://espresso.codeforces.com/4b5198028f3c57ef65791f641cca363e82b1c219.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
import random
a=random.randint(1,25)
if (a<=11):
print("YES")
else:
print("NO")
exit()
#vlvflv
```
| 0
|
|
932
|
A
|
Palindromic Supersequence
|
PROGRAMMING
| 800
|
[
"constructive algorithms"
] | null | null |
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
|
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
|
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
|
[
"aba\n",
"ab\n"
] |
[
"aba",
"aabaa"
] |
In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
| 500
|
[
{
"input": "aba",
"output": "abaaba"
},
{
"input": "ab",
"output": "abba"
},
{
"input": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpa",
"output": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpaapkxovfyaifzjikpcxhemrcpwhypaabnoeifgfygtiqvuoihntvuvbrlnkywutodwrmvgrumdjzqhfoenxphzrdgtwmljdm..."
},
{
"input": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadco",
"output": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadcoocdafcilhkrgpvtsyrmzilywzgrtebnaldqqcmrfvsfehjkbetprwlvyscuxef..."
},
{
"input": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxar",
"output": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxarraxluhthchsyjjpegbmmzflbvzbunpfhzruoghtlgtearurzueovxcivvfbqlssonqkjiybmbjbzpffixfcdwbrpwyhvzbdjmchzjfnrjdoupimgkyyhfgppveltacqczktdxkawpzdmkmyikyjtqznvjdnkkmikemtyjsgdlheyjltiwcxpfvxqtxwwvgkjcrzbkxkandsekqwxpequ..."
},
{
"input": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjg",
"output": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjggjferujlznjmyalmuspib..."
},
{
"input": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgm",
"output": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgmmgszzmttxopywvrbvmgavsgwqergikztssmlnktgpolmcbrropknnkeiytztyrlqthshvbosemmjbzpsvcytuzynrqygcfoqsywdkrvjftdagjdgjyynfkcdkmwaqhzfewry..."
},
{
"input": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyj",
"output": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyjjycqccvmgjgqjfbxjzrdgbsqyseehcjsyxlbrettpfcjdvjerwvaixetfjxjxkdwcwlmwqkrgrhwzopjnilmonwtxsdonvyuazaqghlplvlisqdqbpvxkjpovqohbarttqoqm..."
},
{
"input": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgd",
"output": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgddgmsixjxsmwpfzyxrnkjqrbrfyprvlvbegdmgsidepusixegsdukxmudmjuqqzkefrzymgkluqqrigtpmznhvswwhqbiiizogjofdvfqdrfabswiclfpkiermnozbdmxieoxornesifoiuxgffjelsvcoofviyorrpwkffvvfjaubzeuzqbdhfjgujqoejsktzfzaypaxipweiawzojidcustlgyfhkbfgwshbdkzneilwwqemqblw..."
},
{
"input": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohlig",
"output": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohliggilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlw..."
},
{
"input": "abcab",
"output": "abcabbacba"
},
{
"input": "baaaaaaa",
"output": "baaaaaaaaaaaaaab"
},
{
"input": "baaaaaa",
"output": "baaaaaaaaaaaab"
},
{
"input": "baaaaaaaaa",
"output": "baaaaaaaaaaaaaaaaaab"
},
{
"input": "baaaaaaaa",
"output": "baaaaaaaaaaaaaaaab"
}
] | 1,674,905,874
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
import sys
input = sys.stdin.readline
class Solution:
def supSeqPalind(self, s):
first = list(s)
second = list(reversed(first))
return ''.join( first+ second)
sol = Solution()
s = input()
print(sol.supSeqPalind(s))
|
Title: Palindromic Supersequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
Input Specification:
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
Output Specification:
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
Demo Input:
['aba\n', 'ab\n']
Demo Output:
['aba', 'aabaa']
Note:
In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome.
|
```python
import sys
input = sys.stdin.readline
class Solution:
def supSeqPalind(self, s):
first = list(s)
second = list(reversed(first))
return ''.join( first+ second)
sol = Solution()
s = input()
print(sol.supSeqPalind(s))
```
| 0
|
|
709
|
A
|
Juicer
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one.
The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section?
|
The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer.
|
Print one integer — the number of times Kolya will have to empty the waste section.
|
[
"2 7 10\n5 6\n",
"1 5 10\n7\n",
"3 10 10\n5 7 7\n",
"1 1 1\n1\n"
] |
[
"1\n",
"0\n",
"1\n",
"0\n"
] |
In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards.
In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
| 500
|
[
{
"input": "2 7 10\n5 6",
"output": "1"
},
{
"input": "1 5 10\n7",
"output": "0"
},
{
"input": "3 10 10\n5 7 7",
"output": "1"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "2 951637 951638\n44069 951637",
"output": "1"
},
{
"input": "50 100 129\n55 130 91 19 116 3 63 52 104 76 75 27 151 99 149 147 39 148 84 9 132 49 40 112 124 141 144 93 36 32 146 74 48 38 150 55 94 32 107 69 77 81 33 57 62 98 78 127 154 126",
"output": "12"
},
{
"input": "100 1000 1083\n992 616 818 359 609 783 263 989 501 929 362 394 919 1081 870 830 1097 975 62 346 531 367 323 457 707 360 949 334 867 116 478 417 961 963 1029 114 867 1008 988 916 983 1077 959 942 572 961 579 318 721 337 488 717 111 70 416 685 987 130 353 107 61 191 827 849 106 815 211 953 111 398 889 860 801 71 375 320 395 1059 116 222 931 444 582 74 677 655 88 173 686 491 661 186 114 832 615 814 791 464 517 850",
"output": "36"
},
{
"input": "2 6 8\n2 1",
"output": "0"
},
{
"input": "5 15 16\n7 11 5 12 8",
"output": "2"
},
{
"input": "15 759966 759967\n890397 182209 878577 548548 759966 812923 759966 860479 200595 381358 299175 339368 759966 907668 69574",
"output": "4"
},
{
"input": "5 234613 716125\n642626 494941 234613 234613 234613",
"output": "0"
},
{
"input": "50 48547 567054\n529808 597004 242355 559114 78865 537318 631455 733020 655072 645093 309010 855034 306058 625046 524574 834944 27330 664392 443637 821584 338013 490702 289520 675471 885846 258814 134220 571301 84875 94132 200425 928833 375166 521232 317961 175315 947093 89971 322071 174033 48547 998535 954205 704114 943163 438900 48547 538422 48547 48547",
"output": "0"
},
{
"input": "5 10 20\n10 10 10 10 1",
"output": "1"
},
{
"input": "5 10 11\n10 10 10 10 1",
"output": "2"
},
{
"input": "3 10 10\n4 3 3",
"output": "0"
},
{
"input": "3 5 5\n5 5 5",
"output": "1"
},
{
"input": "3 4 14\n5 5 5",
"output": "0"
},
{
"input": "2 7 10\n1234 1234",
"output": "0"
},
{
"input": "1 5 6\n10",
"output": "0"
},
{
"input": "3 4 6\n1 2 3",
"output": "0"
},
{
"input": "5 10 12\n13 13 13 13 13",
"output": "0"
},
{
"input": "3 4 5\n5 7 9",
"output": "0"
},
{
"input": "3 10 100\n5 5 5",
"output": "0"
},
{
"input": "5 1 2\n2 2 2 2 2",
"output": "0"
},
{
"input": "5 5 5\n5 5 5 5 5",
"output": "2"
},
{
"input": "2 2 5\n5 5",
"output": "0"
},
{
"input": "3 1 4\n2 2 2",
"output": "0"
}
] | 1,636,858,609
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 4,505,600
|
n, b, d = [int(t) for t in input().split()]
clean = 0
t = 0
a = [int(t) for t in input().split()]
for i in a:
if n > 1:
if i <= b:
t = t + i
if t > d:
clean = clean + 1
print(clean)
|
Title: Juicer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one.
The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section?
Input Specification:
The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer.
Output Specification:
Print one integer — the number of times Kolya will have to empty the waste section.
Demo Input:
['2 7 10\n5 6\n', '1 5 10\n7\n', '3 10 10\n5 7 7\n', '1 1 1\n1\n']
Demo Output:
['1\n', '0\n', '1\n', '0\n']
Note:
In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards.
In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all.
|
```python
n, b, d = [int(t) for t in input().split()]
clean = 0
t = 0
a = [int(t) for t in input().split()]
for i in a:
if n > 1:
if i <= b:
t = t + i
if t > d:
clean = clean + 1
print(clean)
```
| 0
|
|
617
|
A
|
Elephant
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
|
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
|
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
|
[
"5\n",
"12\n"
] |
[
"1\n",
"3\n"
] |
In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
| 500
|
[
{
"input": "5",
"output": "1"
},
{
"input": "12",
"output": "3"
},
{
"input": "999999",
"output": "200000"
},
{
"input": "41",
"output": "9"
},
{
"input": "1000000",
"output": "200000"
},
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "1"
},
{
"input": "534204",
"output": "106841"
},
{
"input": "469569",
"output": "93914"
},
{
"input": "502877",
"output": "100576"
},
{
"input": "942212",
"output": "188443"
},
{
"input": "97",
"output": "20"
},
{
"input": "53",
"output": "11"
},
{
"input": "89",
"output": "18"
},
{
"input": "574",
"output": "115"
},
{
"input": "716",
"output": "144"
},
{
"input": "729",
"output": "146"
},
{
"input": "8901",
"output": "1781"
},
{
"input": "3645",
"output": "729"
},
{
"input": "4426",
"output": "886"
},
{
"input": "46573",
"output": "9315"
},
{
"input": "86380",
"output": "17276"
},
{
"input": "94190",
"output": "18838"
},
{
"input": "999990",
"output": "199998"
},
{
"input": "999991",
"output": "199999"
},
{
"input": "999992",
"output": "199999"
},
{
"input": "999993",
"output": "199999"
},
{
"input": "999994",
"output": "199999"
},
{
"input": "999995",
"output": "199999"
},
{
"input": "999996",
"output": "200000"
},
{
"input": "999997",
"output": "200000"
},
{
"input": "999998",
"output": "200000"
}
] | 1,699,037,183
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 34
| 93
| 0
|
import math
W=int(input())
if W<=5:
print(1)
else:
print(math.ceil(W/5))
|
Title: Elephant
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
An elephant decided to visit his friend. It turned out that the elephant's house is located at point 0 and his friend's house is located at point *x*(*x*<=><=0) of the coordinate line. In one step the elephant can move 1, 2, 3, 4 or 5 positions forward. Determine, what is the minimum number of steps he need to make in order to get to his friend's house.
Input Specification:
The first line of the input contains an integer *x* (1<=≤<=*x*<=≤<=1<=000<=000) — The coordinate of the friend's house.
Output Specification:
Print the minimum number of steps that elephant needs to make to get from point 0 to point *x*.
Demo Input:
['5\n', '12\n']
Demo Output:
['1\n', '3\n']
Note:
In the first sample the elephant needs to make one step of length 5 to reach the point *x*.
In the second sample the elephant can get to point *x* if he moves by 3, 5 and 4. There are other ways to get the optimal answer but the elephant cannot reach *x* in less than three moves.
|
```python
import math
W=int(input())
if W<=5:
print(1)
else:
print(math.ceil(W/5))
```
| 3
|
|
760
|
A
|
Petr and a calendar
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
|
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
|
Print single integer: the number of columns the table should have.
|
[
"1 7\n",
"1 1\n",
"11 6\n"
] |
[
"6\n",
"5\n",
"5\n"
] |
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
| 500
|
[
{
"input": "1 7",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "1 1",
"output": "5"
},
{
"input": "1 2",
"output": "5"
},
{
"input": "1 3",
"output": "5"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "6"
},
{
"input": "2 1",
"output": "4"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "2 4",
"output": "5"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "3 1",
"output": "5"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "5"
},
{
"input": "3 4",
"output": "5"
},
{
"input": "3 5",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "3 7",
"output": "6"
},
{
"input": "4 1",
"output": "5"
},
{
"input": "4 2",
"output": "5"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "4 5",
"output": "5"
},
{
"input": "4 6",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "5 1",
"output": "5"
},
{
"input": "5 2",
"output": "5"
},
{
"input": "5 3",
"output": "5"
},
{
"input": "5 4",
"output": "5"
},
{
"input": "5 5",
"output": "5"
},
{
"input": "5 6",
"output": "6"
},
{
"input": "5 7",
"output": "6"
},
{
"input": "6 1",
"output": "5"
},
{
"input": "6 2",
"output": "5"
},
{
"input": "6 3",
"output": "5"
},
{
"input": "6 4",
"output": "5"
},
{
"input": "6 5",
"output": "5"
},
{
"input": "6 6",
"output": "5"
},
{
"input": "6 7",
"output": "6"
},
{
"input": "7 1",
"output": "5"
},
{
"input": "7 2",
"output": "5"
},
{
"input": "7 3",
"output": "5"
},
{
"input": "7 4",
"output": "5"
},
{
"input": "7 5",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "7 7",
"output": "6"
},
{
"input": "8 1",
"output": "5"
},
{
"input": "8 2",
"output": "5"
},
{
"input": "8 3",
"output": "5"
},
{
"input": "8 4",
"output": "5"
},
{
"input": "8 5",
"output": "5"
},
{
"input": "8 6",
"output": "6"
},
{
"input": "8 7",
"output": "6"
},
{
"input": "9 1",
"output": "5"
},
{
"input": "9 2",
"output": "5"
},
{
"input": "9 3",
"output": "5"
},
{
"input": "9 4",
"output": "5"
},
{
"input": "9 5",
"output": "5"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "10 1",
"output": "5"
},
{
"input": "10 2",
"output": "5"
},
{
"input": "10 3",
"output": "5"
},
{
"input": "10 4",
"output": "5"
},
{
"input": "10 5",
"output": "5"
},
{
"input": "10 6",
"output": "6"
},
{
"input": "10 7",
"output": "6"
},
{
"input": "11 1",
"output": "5"
},
{
"input": "11 2",
"output": "5"
},
{
"input": "11 3",
"output": "5"
},
{
"input": "11 4",
"output": "5"
},
{
"input": "11 5",
"output": "5"
},
{
"input": "11 6",
"output": "5"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "12 1",
"output": "5"
},
{
"input": "12 2",
"output": "5"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "12 4",
"output": "5"
},
{
"input": "12 5",
"output": "5"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 7",
"output": "6"
},
{
"input": "1 4",
"output": "5"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "9 7",
"output": "6"
},
{
"input": "2 6",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "2 2",
"output": "5"
},
{
"input": "4 7",
"output": "6"
},
{
"input": "12 6",
"output": "6"
},
{
"input": "12 3",
"output": "5"
},
{
"input": "3 6",
"output": "6"
},
{
"input": "9 6",
"output": "5"
},
{
"input": "7 6",
"output": "6"
},
{
"input": "11 7",
"output": "6"
},
{
"input": "6 6",
"output": "5"
}
] | 1,485,109,940
| 1,040
|
Python 3
|
OK
|
TESTS
| 104
| 92
| 4,710,400
|
days = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
month, day = input().split()
month = int(month)
day = int(day)
columns = days[month-1] - (7 - day + 1)
result = 0
if (columns % 7 != 0):
result += 1
result += columns // 7 + 1
print(result)
|
Title: Petr and a calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr wants to make a calendar for current month. For this purpose he draws a table in which columns correspond to weeks (a week is seven consequent days from Monday to Sunday), rows correspond to weekdays, and cells contain dates. For example, a calendar for January 2017 should look like on the picture:
Petr wants to know how many columns his table should have given the month and the weekday of the first date of that month? Assume that the year is non-leap.
Input Specification:
The only line contain two integers *m* and *d* (1<=≤<=*m*<=≤<=12, 1<=≤<=*d*<=≤<=7) — the number of month (January is the first month, December is the twelfth) and the weekday of the first date of this month (1 is Monday, 7 is Sunday).
Output Specification:
Print single integer: the number of columns the table should have.
Demo Input:
['1 7\n', '1 1\n', '11 6\n']
Demo Output:
['6\n', '5\n', '5\n']
Note:
The first example corresponds to the January 2017 shown on the picture in the statements.
In the second example 1-st January is Monday, so the whole month fits into 5 columns.
In the third example 1-st November is Saturday and 5 columns is enough.
|
```python
days = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]
month, day = input().split()
month = int(month)
day = int(day)
columns = days[month-1] - (7 - day + 1)
result = 0
if (columns % 7 != 0):
result += 1
result += columns // 7 + 1
print(result)
```
| 3
|
|
229
|
B
|
Planets
|
PROGRAMMING
| 1,700
|
[
"binary search",
"data structures",
"graphs",
"shortest paths"
] | null | null |
Goa'uld Apophis captured Jack O'Neill's team again! Jack himself was able to escape, but by that time Apophis's ship had already jumped to hyperspace. But Jack knows on what planet will Apophis land. In order to save his friends, Jack must repeatedly go through stargates to get to this planet.
Overall the galaxy has *n* planets, indexed with numbers from 1 to *n*. Jack is on the planet with index 1, and Apophis will land on the planet with index *n*. Jack can move between some pairs of planets through stargates (he can move in both directions); the transfer takes a positive, and, perhaps, for different pairs of planets unequal number of seconds. Jack begins his journey at time 0.
It can be that other travellers are arriving to the planet where Jack is currently located. In this case, Jack has to wait for exactly 1 second before he can use the stargate. That is, if at time *t* another traveller arrives to the planet, Jack can only pass through the stargate at time *t*<=+<=1, unless there are more travellers arriving at time *t*<=+<=1 to the same planet.
Knowing the information about travel times between the planets, and the times when Jack would not be able to use the stargate on particular planets, determine the minimum time in which he can get to the planet with index *n*.
|
The first line contains two space-separated integers: *n* (2<=≤<=*n*<=≤<=105), the number of planets in the galaxy, and *m* (0<=≤<=*m*<=≤<=105) — the number of pairs of planets between which Jack can travel using stargates. Then *m* lines follow, containing three integers each: the *i*-th line contains numbers of planets *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which are connected through stargates, and the integer transfer time (in seconds) *c**i* (1<=≤<=*c**i*<=≤<=104) between these planets. It is guaranteed that between any pair of planets there is at most one stargate connection.
Then *n* lines follow: the *i*-th line contains an integer *k**i* (0<=≤<=*k**i*<=≤<=105) that denotes the number of moments of time when other travellers arrive to the planet with index *i*. Then *k**i* distinct space-separated integers *t**ij* (0<=≤<=*t**ij*<=<<=109) follow, sorted in ascending order. An integer *t**ij* means that at time *t**ij* (in seconds) another traveller arrives to the planet *i*. It is guaranteed that the sum of all *k**i* does not exceed 105.
|
Print a single number — the least amount of time Jack needs to get from planet 1 to planet *n*. If Jack can't get to planet *n* in any amount of time, print number -1.
|
[
"4 6\n1 2 2\n1 3 3\n1 4 8\n2 3 4\n2 4 5\n3 4 3\n0\n1 3\n2 3 4\n0\n",
"3 1\n1 2 3\n0\n1 3\n0\n"
] |
[
"7\n",
"-1\n"
] |
In the first sample Jack has three ways to go from planet 1. If he moves to planet 4 at once, he spends 8 seconds. If he transfers to planet 3, he spends 3 seconds, but as other travellers arrive to planet 3 at time 3 and 4, he can travel to planet 4 only at time 5, thus spending 8 seconds in total. But if Jack moves to planet 2, and then — to planet 4, then he spends a total of only 2 + 5 = 7 seconds.
In the second sample one can't get from planet 1 to planet 3 by moving through stargates.
| 500
|
[
{
"input": "4 6\n1 2 2\n1 3 3\n1 4 8\n2 3 4\n2 4 5\n3 4 3\n0\n1 3\n2 3 4\n0",
"output": "7"
},
{
"input": "3 1\n1 2 3\n0\n1 3\n0",
"output": "-1"
},
{
"input": "2 1\n1 2 3\n0\n1 3",
"output": "3"
},
{
"input": "2 1\n1 2 3\n1 0\n0",
"output": "4"
},
{
"input": "3 3\n1 2 5\n2 3 6\n1 3 7\n0\n0\n0",
"output": "7"
},
{
"input": "3 3\n1 2 3\n2 3 2\n1 3 7\n0\n0\n0",
"output": "5"
},
{
"input": "2 0\n0\n0",
"output": "-1"
},
{
"input": "3 1\n1 2 3\n1 1\n1 5\n0",
"output": "-1"
},
{
"input": "2 1\n1 2 3\n0\n2 2 4",
"output": "3"
},
{
"input": "2 1\n1 2 1\n0\n0",
"output": "1"
},
{
"input": "2 1\n2 1 10000\n0\n0",
"output": "10000"
},
{
"input": "2 1\n1 2 3\n0\n3 3 4 5",
"output": "3"
},
{
"input": "3 0\n0\n0\n0",
"output": "-1"
},
{
"input": "3 2\n1 2 5\n2 3 7\n2 0 1\n3 4 5 6\n3 11 12 13",
"output": "14"
},
{
"input": "2 1\n1 2 3\n3 0 1 2\n3 5 6 7",
"output": "6"
},
{
"input": "3 3\n1 2 3\n2 3 2\n1 3 7\n0\n4 3 4 5 6\n0",
"output": "7"
},
{
"input": "6 7\n1 2 1\n1 3 8\n2 4 2\n4 3 3\n3 5 4\n4 6 100\n5 6 5\n0\n0\n1 7\n2 3 4\n0\n0",
"output": "17"
},
{
"input": "3 3\n1 2 3\n2 3 2\n1 3 6\n0\n1 3\n0",
"output": "6"
},
{
"input": "7 7\n1 2 1\n2 4 2\n2 3 2\n3 6 2\n6 5 2\n4 5 3\n5 7 7\n0\n0\n0\n3 3 4 5\n0\n0\n0",
"output": "14"
},
{
"input": "7 6\n1 2 1\n1 3 1\n1 4 1\n1 5 1\n1 6 1\n1 7 1\n1 0\n0\n0\n0\n0\n0\n0",
"output": "2"
},
{
"input": "8 10\n1 2 3\n2 8 3\n1 4 1\n4 3 6\n3 7 7\n4 5 5\n5 7 2\n7 8 1\n1 6 8\n6 8 7\n0\n4 1 2 3 4\n0\n0\n0\n0\n0\n0",
"output": "8"
},
{
"input": "7 6\n1 2 1\n1 3 2\n2 4 3\n2 5 4\n3 5 6\n3 6 7\n0\n3 1 2 3\n2 2 3\n0\n2 7 8\n0\n0",
"output": "-1"
}
] | 1,684,913,122
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 92
| 102,400
|
def find(fa,x):
# 不会被卡爆栈的并查集find函数 省空间
fa.setdefault(x,x)
t = x
while fa[x] != x:
x = fa[x]
while t != x:
fa[t], t = x, fa[t]
return x
def union(fa,son, father):
# 数值往坐标高处合并 应该这么写才对
x = find(fa,son)
y = find(fa,father)
fa[x] = y
import sys
input = sys.stdin.readline
n,m = map(int, input().split())
from collections import defaultdict
g = defaultdict(list)
for _ in range(m):
u,v,c = map(int, input().split())
u -= 1
v -= 1
g[u].append((v,c))
g[v].append((u,c))
banned = [dict() for _ in range(n)]
for i in range(n):
for x in list(map(int, input().split()))[1:]:
union(banned[i],x,x + 1)
import heapq
q = [(find(banned[0],0),0)]
# print(banned)
vis = [False]*n
while q:
t,u = heapq.heappop(q)
if vis[u]:
continue
vis[u] = True
if u == n-1:
print(t)
exit()
for v,c in g[u]:
if not vis[v]:
heapq.heappush(q,(find(banned[v],t + c),v))
print(-1)
|
Title: Planets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Goa'uld Apophis captured Jack O'Neill's team again! Jack himself was able to escape, but by that time Apophis's ship had already jumped to hyperspace. But Jack knows on what planet will Apophis land. In order to save his friends, Jack must repeatedly go through stargates to get to this planet.
Overall the galaxy has *n* planets, indexed with numbers from 1 to *n*. Jack is on the planet with index 1, and Apophis will land on the planet with index *n*. Jack can move between some pairs of planets through stargates (he can move in both directions); the transfer takes a positive, and, perhaps, for different pairs of planets unequal number of seconds. Jack begins his journey at time 0.
It can be that other travellers are arriving to the planet where Jack is currently located. In this case, Jack has to wait for exactly 1 second before he can use the stargate. That is, if at time *t* another traveller arrives to the planet, Jack can only pass through the stargate at time *t*<=+<=1, unless there are more travellers arriving at time *t*<=+<=1 to the same planet.
Knowing the information about travel times between the planets, and the times when Jack would not be able to use the stargate on particular planets, determine the minimum time in which he can get to the planet with index *n*.
Input Specification:
The first line contains two space-separated integers: *n* (2<=≤<=*n*<=≤<=105), the number of planets in the galaxy, and *m* (0<=≤<=*m*<=≤<=105) — the number of pairs of planets between which Jack can travel using stargates. Then *m* lines follow, containing three integers each: the *i*-th line contains numbers of planets *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which are connected through stargates, and the integer transfer time (in seconds) *c**i* (1<=≤<=*c**i*<=≤<=104) between these planets. It is guaranteed that between any pair of planets there is at most one stargate connection.
Then *n* lines follow: the *i*-th line contains an integer *k**i* (0<=≤<=*k**i*<=≤<=105) that denotes the number of moments of time when other travellers arrive to the planet with index *i*. Then *k**i* distinct space-separated integers *t**ij* (0<=≤<=*t**ij*<=<<=109) follow, sorted in ascending order. An integer *t**ij* means that at time *t**ij* (in seconds) another traveller arrives to the planet *i*. It is guaranteed that the sum of all *k**i* does not exceed 105.
Output Specification:
Print a single number — the least amount of time Jack needs to get from planet 1 to planet *n*. If Jack can't get to planet *n* in any amount of time, print number -1.
Demo Input:
['4 6\n1 2 2\n1 3 3\n1 4 8\n2 3 4\n2 4 5\n3 4 3\n0\n1 3\n2 3 4\n0\n', '3 1\n1 2 3\n0\n1 3\n0\n']
Demo Output:
['7\n', '-1\n']
Note:
In the first sample Jack has three ways to go from planet 1. If he moves to planet 4 at once, he spends 8 seconds. If he transfers to planet 3, he spends 3 seconds, but as other travellers arrive to planet 3 at time 3 and 4, he can travel to planet 4 only at time 5, thus spending 8 seconds in total. But if Jack moves to planet 2, and then — to planet 4, then he spends a total of only 2 + 5 = 7 seconds.
In the second sample one can't get from planet 1 to planet 3 by moving through stargates.
|
```python
def find(fa,x):
# 不会被卡爆栈的并查集find函数 省空间
fa.setdefault(x,x)
t = x
while fa[x] != x:
x = fa[x]
while t != x:
fa[t], t = x, fa[t]
return x
def union(fa,son, father):
# 数值往坐标高处合并 应该这么写才对
x = find(fa,son)
y = find(fa,father)
fa[x] = y
import sys
input = sys.stdin.readline
n,m = map(int, input().split())
from collections import defaultdict
g = defaultdict(list)
for _ in range(m):
u,v,c = map(int, input().split())
u -= 1
v -= 1
g[u].append((v,c))
g[v].append((u,c))
banned = [dict() for _ in range(n)]
for i in range(n):
for x in list(map(int, input().split()))[1:]:
union(banned[i],x,x + 1)
import heapq
q = [(find(banned[0],0),0)]
# print(banned)
vis = [False]*n
while q:
t,u = heapq.heappop(q)
if vis[u]:
continue
vis[u] = True
if u == n-1:
print(t)
exit()
for v,c in g[u]:
if not vis[v]:
heapq.heappush(q,(find(banned[v],t + c),v))
print(-1)
```
| 0
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,680,131,791
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 46
| 0
|
first = (input())
second = (input())
sol = ""
for i in range(len(first)):
if first[i] == second[i]:
sol+='0'
else:
sol+='1'
print (sol)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
first = (input())
second = (input())
sol = ""
for i in range(len(first)):
if first[i] == second[i]:
sol+='0'
else:
sol+='1'
print (sol)
```
| 3.9885
|
441
|
C
|
Valera and Tubes
|
PROGRAMMING
| 1,500
|
[
"constructive algorithms",
"dfs and similar",
"implementation"
] | null | null |
Valera has got a rectangle table consisting of *n* rows and *m* columns. Valera numbered the table rows starting from one, from top to bottom and the columns – starting from one, from left to right. We will represent cell that is on the intersection of row *x* and column *y* by a pair of integers (*x*,<=*y*).
Valera wants to place exactly *k* tubes on his rectangle table. A tube is such sequence of table cells (*x*1,<=*y*1), (*x*2,<=*y*2), ..., (*x**r*,<=*y**r*), that:
- *r*<=≥<=2; - for any integer *i* (1<=≤<=*i*<=≤<=*r*<=-<=1) the following equation |*x**i*<=-<=*x**i*<=+<=1|<=+<=|*y**i*<=-<=*y**i*<=+<=1|<==<=1 holds; - each table cell, which belongs to the tube, must occur exactly once in the sequence.
Valera thinks that the tubes are arranged in a fancy manner if the following conditions are fulfilled:
- no pair of tubes has common cells; - each cell of the table belongs to some tube.
Help Valera to arrange *k* tubes on his rectangle table in a fancy manner.
|
The first line contains three space-separated integers *n*,<=*m*,<=*k* (2<=≤<=*n*,<=*m*<=≤<=300; 2<=≤<=2*k*<=≤<=*n*·*m*) — the number of rows, the number of columns and the number of tubes, correspondingly.
|
Print *k* lines. In the *i*-th line print the description of the *i*-th tube: first print integer *r**i* (the number of tube cells), then print 2*r**i* integers *x**i*1,<=*y**i*1,<=*x**i*2,<=*y**i*2,<=...,<=*x**ir**i*,<=*y**ir**i* (the sequence of table cells).
If there are multiple solutions, you can print any of them. It is guaranteed that at least one solution exists.
|
[
"3 3 3\n",
"2 3 1\n"
] |
[
"3 1 1 1 2 1 3\n3 2 1 2 2 2 3\n3 3 1 3 2 3 3\n",
"6 1 1 1 2 1 3 2 3 2 2 2 1\n"
] |
Picture for the first sample:
Picture for the second sample:
| 1,500
|
[
{
"input": "3 3 3",
"output": "3 1 1 1 2 1 3\n3 2 1 2 2 2 3\n3 3 1 3 2 3 3"
},
{
"input": "2 3 1",
"output": "6 1 1 1 2 1 3 2 3 2 2 2 1"
},
{
"input": "2 3 1",
"output": "6 1 1 1 2 1 3 2 3 2 2 2 1"
},
{
"input": "300 300 2",
"output": "2 1 1 1 2\n89998 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97 1 98 1 99 1 100 1 101 1 10..."
},
{
"input": "300 300 150",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "300 299 299",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "300 300 45000",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "300 299 44850",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "2 2 2",
"output": "2 1 1 1 2\n2 2 2 2 1"
},
{
"input": "2 3 3",
"output": "2 1 1 1 2\n2 1 3 2 3\n2 2 2 2 1"
},
{
"input": "3 3 4",
"output": "2 1 1 1 2\n2 1 3 2 3\n2 2 2 2 1\n3 3 1 3 2 3 3"
},
{
"input": "5 5 12",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 2 5\n2 2 4 2 3\n2 2 2 2 1\n2 3 1 3 2\n2 3 3 3 4\n2 3 5 4 5\n2 4 4 4 3\n2 4 2 4 1\n2 5 1 5 2\n3 5 3 5 4 5 5"
},
{
"input": "7 5 17",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 2 5\n2 2 4 2 3\n2 2 2 2 1\n2 3 1 3 2\n2 3 3 3 4\n2 3 5 4 5\n2 4 4 4 3\n2 4 2 4 1\n2 5 1 5 2\n2 5 3 5 4\n2 5 5 6 5\n2 6 4 6 3\n2 6 2 6 1\n2 7 1 7 2\n3 7 3 7 4 7 5"
},
{
"input": "135 91 4352",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "32 27 153",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 2 27\n2 2 26 2 25\n2 2 24 2 23\n2 2 22 2 21\n2 2 20 2 19\n2 2 18 2 17\n2 2 16 2 15\n2 2 14 2 13\n2 2 12 2 11\n2 2 10 2 9\n2 2 8 2 7\n2 2 6 2 5\n2 2 4 2 3\n2 2 2 2 1\n2 3 1 3 2\n2 3 3 3 4\n2 3 5 3 6\n2 3 7 3 8\n2 3 9 3 10\n2 3 11 3 12\n2 3 13 3 14\n2 3 15 3 16\n2 3 17 3 18\n2 3 19 3 20\n2 3 21 3 22\n2 3 23 3 24\n2 3 25 3 26\n2 3 27 4 27\n2 4 2..."
},
{
"input": "74 83 2667",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "296 218 5275",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "89 82 2330",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "15 68 212",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 2 68 2 67\n2 2 66 2 65\n2 2 64 2 63\n2 2 62 2 61\n2 2 60 2 59\n2 2 58 2 57\n..."
},
{
"input": "95 4 177",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 2 4 2 3\n2 2 2 2 1\n2 3 1 3 2\n2 3 3 3 4\n2 4 4 4 3\n2 4 2 4 1\n2 5 1 5 2\n2 5 3 5 4\n2 6 4 6 3\n2 6 2 6 1\n2 7 1 7 2\n2 7 3 7 4\n2 8 4 8 3\n2 8 2 8 1\n2 9 1 9 2\n2 9 3 9 4\n2 10 4 10 3\n2 10 2 10 1\n2 11 1 11 2\n2 11 3 11 4\n2 12 4 12 3\n2 12 2 12 1\n2 13 1 13 2\n2 13 3 13 4\n2 14 4 14 3\n2 14 2 14 1\n2 15 1 15 2\n2 15 3 15 4\n2 16 4 16 3\n2 16 2 16 1\n2 17 1 17 2\n2 17 3 17 4\n2 18 4 18 3\n2 18 2 18 1\n2 19 1 19 2\n2 19 3 19 4\n2 20 4 20 3\n2 20 2 20 1\n2 21 1 21 2\n2 21 3 21 4\n2..."
},
{
"input": "60 136 8",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n8146 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97 1 98 1 99..."
},
{
"input": "91 183 7827",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "2 15 3",
"output": "2 1 1 1 2\n2 1 3 1 4\n26 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 2 15 2 14 2 13 2 12 2 11 2 10 2 9 2 8 2 7 2 6 2 5 2 4 2 3 2 2 2 1"
},
{
"input": "139 275 10770",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "114 298 7143",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "260 182 9496",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "42 297 3703",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "236 156 9535",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "201 226 1495",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "299 299 100",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "299 298 100",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "298 299 100",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "299 299 2",
"output": "2 1 1 1 2\n89399 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97 1 98 1 99 1 100 1 101 1 10..."
},
{
"input": "299 299 1",
"output": "89401 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97 1 98 1 99 1 100 1 101 1 102 1..."
},
{
"input": "298 299 1",
"output": "89102 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97 1 98 1 99 1 100 1 101 1 102 1..."
},
{
"input": "299 298 11",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n89082 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97..."
},
{
"input": "298 300 12",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n89378 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1..."
},
{
"input": "298 2 1",
"output": "596 1 1 1 2 2 2 2 1 3 1 3 2 4 2 4 1 5 1 5 2 6 2 6 1 7 1 7 2 8 2 8 1 9 1 9 2 10 2 10 1 11 1 11 2 12 2 12 1 13 1 13 2 14 2 14 1 15 1 15 2 16 2 16 1 17 1 17 2 18 2 18 1 19 1 19 2 20 2 20 1 21 1 21 2 22 2 22 1 23 1 23 2 24 2 24 1 25 1 25 2 26 2 26 1 27 1 27 2 28 2 28 1 29 1 29 2 30 2 30 1 31 1 31 2 32 2 32 1 33 1 33 2 34 2 34 1 35 1 35 2 36 2 36 1 37 1 37 2 38 2 38 1 39 1 39 2 40 2 40 1 41 1 41 2 42 2 42 1 43 1 43 2 44 2 44 1 45 1 45 2 46 2 46 1 47 1 47 2 48 2 48 1 49 1 49 2 50 2 50 1 51 1 51 2 52 2 52 1 53 1 ..."
},
{
"input": "2 298 1",
"output": "596 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 1 11 1 12 1 13 1 14 1 15 1 16 1 17 1 18 1 19 1 20 1 21 1 22 1 23 1 24 1 25 1 26 1 27 1 28 1 29 1 30 1 31 1 32 1 33 1 34 1 35 1 36 1 37 1 38 1 39 1 40 1 41 1 42 1 43 1 44 1 45 1 46 1 47 1 48 1 49 1 50 1 51 1 52 1 53 1 54 1 55 1 56 1 57 1 58 1 59 1 60 1 61 1 62 1 63 1 64 1 65 1 66 1 67 1 68 1 69 1 70 1 71 1 72 1 73 1 74 1 75 1 76 1 77 1 78 1 79 1 80 1 81 1 82 1 83 1 84 1 85 1 86 1 87 1 88 1 89 1 90 1 91 1 92 1 93 1 94 1 95 1 96 1 97 1 98 1 99 1 100 1 101 1 102 1 1..."
},
{
"input": "300 300 500",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "300 300 501",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "300 300 44999",
"output": "2 1 1 1 2\n2 1 3 1 4\n2 1 5 1 6\n2 1 7 1 8\n2 1 9 1 10\n2 1 11 1 12\n2 1 13 1 14\n2 1 15 1 16\n2 1 17 1 18\n2 1 19 1 20\n2 1 21 1 22\n2 1 23 1 24\n2 1 25 1 26\n2 1 27 1 28\n2 1 29 1 30\n2 1 31 1 32\n2 1 33 1 34\n2 1 35 1 36\n2 1 37 1 38\n2 1 39 1 40\n2 1 41 1 42\n2 1 43 1 44\n2 1 45 1 46\n2 1 47 1 48\n2 1 49 1 50\n2 1 51 1 52\n2 1 53 1 54\n2 1 55 1 56\n2 1 57 1 58\n2 1 59 1 60\n2 1 61 1 62\n2 1 63 1 64\n2 1 65 1 66\n2 1 67 1 68\n2 1 69 1 70\n2 1 71 1 72\n2 1 73 1 74\n2 1 75 1 76\n2 1 77 1 78\n2 1 79 1 80\n..."
},
{
"input": "5 5 3",
"output": "2 1 1 1 2\n2 1 3 1 4\n21 1 5 2 5 2 4 2 3 2 2 2 1 3 1 3 2 3 3 3 4 3 5 4 5 4 4 4 3 4 2 4 1 5 1 5 2 5 3 5 4 5 5"
},
{
"input": "2 4 3",
"output": "2 1 1 1 2\n2 1 3 1 4\n4 2 4 2 3 2 2 2 1"
}
] | 1,465,303,350
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 10
| 436
| 13,926,400
|
from collections import defaultdict,deque,Counter,OrderedDict
def main():
n,m,k = map(int,input().split())
l = []
for i in range(1,n+1):
if i%2 == 0:
for j in range(m,0,-1):
l.append((i,j))
else:
for j in range(1,m+1):
l.append((i,j))
each = n*m // k
ans,goes = [],each*k
for i in range(0,len(l),each):
temp = []
for j in range(i,i+each):
temp.append(l[j][0])
temp.append(l[j][1])
ans.append(temp)
for i in range(goes,len(l)):
ans[-1].append(l[i][0])
ans[-1].append(l[i][1])
for i in ans:
print(len(i)//2," ".join(map(str,i)))
if __name__ == "__main__":
main()
|
Title: Valera and Tubes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera has got a rectangle table consisting of *n* rows and *m* columns. Valera numbered the table rows starting from one, from top to bottom and the columns – starting from one, from left to right. We will represent cell that is on the intersection of row *x* and column *y* by a pair of integers (*x*,<=*y*).
Valera wants to place exactly *k* tubes on his rectangle table. A tube is such sequence of table cells (*x*1,<=*y*1), (*x*2,<=*y*2), ..., (*x**r*,<=*y**r*), that:
- *r*<=≥<=2; - for any integer *i* (1<=≤<=*i*<=≤<=*r*<=-<=1) the following equation |*x**i*<=-<=*x**i*<=+<=1|<=+<=|*y**i*<=-<=*y**i*<=+<=1|<==<=1 holds; - each table cell, which belongs to the tube, must occur exactly once in the sequence.
Valera thinks that the tubes are arranged in a fancy manner if the following conditions are fulfilled:
- no pair of tubes has common cells; - each cell of the table belongs to some tube.
Help Valera to arrange *k* tubes on his rectangle table in a fancy manner.
Input Specification:
The first line contains three space-separated integers *n*,<=*m*,<=*k* (2<=≤<=*n*,<=*m*<=≤<=300; 2<=≤<=2*k*<=≤<=*n*·*m*) — the number of rows, the number of columns and the number of tubes, correspondingly.
Output Specification:
Print *k* lines. In the *i*-th line print the description of the *i*-th tube: first print integer *r**i* (the number of tube cells), then print 2*r**i* integers *x**i*1,<=*y**i*1,<=*x**i*2,<=*y**i*2,<=...,<=*x**ir**i*,<=*y**ir**i* (the sequence of table cells).
If there are multiple solutions, you can print any of them. It is guaranteed that at least one solution exists.
Demo Input:
['3 3 3\n', '2 3 1\n']
Demo Output:
['3 1 1 1 2 1 3\n3 2 1 2 2 2 3\n3 3 1 3 2 3 3\n', '6 1 1 1 2 1 3 2 3 2 2 2 1\n']
Note:
Picture for the first sample:
Picture for the second sample:
|
```python
from collections import defaultdict,deque,Counter,OrderedDict
def main():
n,m,k = map(int,input().split())
l = []
for i in range(1,n+1):
if i%2 == 0:
for j in range(m,0,-1):
l.append((i,j))
else:
for j in range(1,m+1):
l.append((i,j))
each = n*m // k
ans,goes = [],each*k
for i in range(0,len(l),each):
temp = []
for j in range(i,i+each):
temp.append(l[j][0])
temp.append(l[j][1])
ans.append(temp)
for i in range(goes,len(l)):
ans[-1].append(l[i][0])
ans[-1].append(l[i][1])
for i in ans:
print(len(i)//2," ".join(map(str,i)))
if __name__ == "__main__":
main()
```
| -1
|
|
722
|
A
|
Broken Clock
|
PROGRAMMING
| 1,300
|
[
"brute force",
"implementation"
] | null | null |
You are given a broken clock. You know, that it is supposed to show time in 12- or 24-hours HH:MM format. In 12-hours format hours change from 1 to 12, while in 24-hours it changes from 0 to 23. In both formats minutes change from 0 to 59.
You are given a time in format HH:MM that is currently displayed on the broken clock. Your goal is to change minimum number of digits in order to make clocks display the correct time in the given format.
For example, if 00:99 is displayed, it is enough to replace the second 9 with 3 in order to get 00:39 that is a correct time in 24-hours format. However, to make 00:99 correct in 12-hours format, one has to change at least two digits. Additionally to the first change one can replace the second 0 with 1 and obtain 01:39.
|
The first line of the input contains one integer 12 or 24, that denote 12-hours or 24-hours format respectively.
The second line contains the time in format HH:MM, that is currently displayed on the clock. First two characters stand for the hours, while next two show the minutes.
|
The only line of the output should contain the time in format HH:MM that is a correct time in the given format. It should differ from the original in as few positions as possible. If there are many optimal solutions you can print any of them.
|
[
"24\n17:30\n",
"12\n17:30\n",
"24\n99:99\n"
] |
[
"17:30\n",
"07:30\n",
"09:09\n"
] |
none
| 500
|
[
{
"input": "24\n17:30",
"output": "17:30"
},
{
"input": "12\n17:30",
"output": "07:30"
},
{
"input": "24\n99:99",
"output": "09:09"
},
{
"input": "12\n05:54",
"output": "05:54"
},
{
"input": "12\n00:05",
"output": "01:05"
},
{
"input": "24\n23:80",
"output": "23:00"
},
{
"input": "24\n73:16",
"output": "03:16"
},
{
"input": "12\n03:77",
"output": "03:07"
},
{
"input": "12\n47:83",
"output": "07:03"
},
{
"input": "24\n23:88",
"output": "23:08"
},
{
"input": "24\n51:67",
"output": "01:07"
},
{
"input": "12\n10:33",
"output": "10:33"
},
{
"input": "12\n00:01",
"output": "01:01"
},
{
"input": "12\n07:74",
"output": "07:04"
},
{
"input": "12\n00:60",
"output": "01:00"
},
{
"input": "24\n08:32",
"output": "08:32"
},
{
"input": "24\n42:59",
"output": "02:59"
},
{
"input": "24\n19:87",
"output": "19:07"
},
{
"input": "24\n26:98",
"output": "06:08"
},
{
"input": "12\n12:91",
"output": "12:01"
},
{
"input": "12\n11:30",
"output": "11:30"
},
{
"input": "12\n90:32",
"output": "10:32"
},
{
"input": "12\n03:69",
"output": "03:09"
},
{
"input": "12\n33:83",
"output": "03:03"
},
{
"input": "24\n10:45",
"output": "10:45"
},
{
"input": "24\n65:12",
"output": "05:12"
},
{
"input": "24\n22:64",
"output": "22:04"
},
{
"input": "24\n48:91",
"output": "08:01"
},
{
"input": "12\n02:51",
"output": "02:51"
},
{
"input": "12\n40:11",
"output": "10:11"
},
{
"input": "12\n02:86",
"output": "02:06"
},
{
"input": "12\n99:96",
"output": "09:06"
},
{
"input": "24\n19:24",
"output": "19:24"
},
{
"input": "24\n55:49",
"output": "05:49"
},
{
"input": "24\n01:97",
"output": "01:07"
},
{
"input": "24\n39:68",
"output": "09:08"
},
{
"input": "24\n24:00",
"output": "04:00"
},
{
"input": "12\n91:00",
"output": "01:00"
},
{
"input": "24\n00:30",
"output": "00:30"
},
{
"input": "12\n13:20",
"output": "03:20"
},
{
"input": "12\n13:00",
"output": "03:00"
},
{
"input": "12\n42:35",
"output": "02:35"
},
{
"input": "12\n20:00",
"output": "10:00"
},
{
"input": "12\n21:00",
"output": "01:00"
},
{
"input": "24\n10:10",
"output": "10:10"
},
{
"input": "24\n30:40",
"output": "00:40"
},
{
"input": "24\n12:00",
"output": "12:00"
},
{
"input": "12\n10:60",
"output": "10:00"
},
{
"input": "24\n30:00",
"output": "00:00"
},
{
"input": "24\n34:00",
"output": "04:00"
},
{
"input": "12\n22:00",
"output": "02:00"
},
{
"input": "12\n20:20",
"output": "10:20"
}
] | 1,607,542,706
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 52
| 155
| 0
|
def f(x):
if(x==0): return("00")
elif(len(str(x))==1): return("0"+str(x))
else: return (str(x))
def ch(a,b):
q=0
for i in range(len(a)): q+=int(a[i]!=b[i])
return q
tf=int(input())
time=[x for x in input().split(':')]
hr12=[]
hr24=[]
mins=[]
for i in range(1,13): hr12.append(f(i))
for i in range(24): hr24.append(f(i))
for i in range(60): mins.append(f(i))
ans=10
if(tf==12):
for x in hr12:
ans=min(ans,ch(time[0],x))
else:
for x in hr24:
ans=min(ans,ch(time[0],x))
a2=10
for x in mins:
a2=min(a2,ch(x,time[1]))
fin=[None,None]
if(tf==12):
for x in hr12:
if(ch(x,time[0])==ans):
fin[0]=x
else:
for x in hr24:
if(ch(time[0],x)==ans):
fin[0]=x
for x in mins:
if(ch(x,time[1])==a2):
fin[1]=x
print(':'.join(fin))
|
Title: Broken Clock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a broken clock. You know, that it is supposed to show time in 12- or 24-hours HH:MM format. In 12-hours format hours change from 1 to 12, while in 24-hours it changes from 0 to 23. In both formats minutes change from 0 to 59.
You are given a time in format HH:MM that is currently displayed on the broken clock. Your goal is to change minimum number of digits in order to make clocks display the correct time in the given format.
For example, if 00:99 is displayed, it is enough to replace the second 9 with 3 in order to get 00:39 that is a correct time in 24-hours format. However, to make 00:99 correct in 12-hours format, one has to change at least two digits. Additionally to the first change one can replace the second 0 with 1 and obtain 01:39.
Input Specification:
The first line of the input contains one integer 12 or 24, that denote 12-hours or 24-hours format respectively.
The second line contains the time in format HH:MM, that is currently displayed on the clock. First two characters stand for the hours, while next two show the minutes.
Output Specification:
The only line of the output should contain the time in format HH:MM that is a correct time in the given format. It should differ from the original in as few positions as possible. If there are many optimal solutions you can print any of them.
Demo Input:
['24\n17:30\n', '12\n17:30\n', '24\n99:99\n']
Demo Output:
['17:30\n', '07:30\n', '09:09\n']
Note:
none
|
```python
def f(x):
if(x==0): return("00")
elif(len(str(x))==1): return("0"+str(x))
else: return (str(x))
def ch(a,b):
q=0
for i in range(len(a)): q+=int(a[i]!=b[i])
return q
tf=int(input())
time=[x for x in input().split(':')]
hr12=[]
hr24=[]
mins=[]
for i in range(1,13): hr12.append(f(i))
for i in range(24): hr24.append(f(i))
for i in range(60): mins.append(f(i))
ans=10
if(tf==12):
for x in hr12:
ans=min(ans,ch(time[0],x))
else:
for x in hr24:
ans=min(ans,ch(time[0],x))
a2=10
for x in mins:
a2=min(a2,ch(x,time[1]))
fin=[None,None]
if(tf==12):
for x in hr12:
if(ch(x,time[0])==ans):
fin[0]=x
else:
for x in hr24:
if(ch(time[0],x)==ans):
fin[0]=x
for x in mins:
if(ch(x,time[1])==a2):
fin[1]=x
print(':'.join(fin))
```
| 3
|
|
3
|
D
|
Least Cost Bracket Sequence
|
PROGRAMMING
| 2,600
|
[
"greedy"
] |
D. Least Cost Bracket Sequence
|
1
|
64
|
This is yet another problem on regular bracket sequences.
A bracket sequence is called regular, if by inserting "+" and "1" into it we get a correct mathematical expression. For example, sequences "(())()", "()" and "(()(()))" are regular, while ")(", "(()" and "(()))(" are not. You have a pattern of a bracket sequence that consists of characters "(", ")" and "?". You have to replace each character "?" with a bracket so, that you get a regular bracket sequence.
For each character "?" the cost of its replacement with "(" and ")" is given. Among all the possible variants your should choose the cheapest.
|
The first line contains a non-empty pattern of even length, consisting of characters "(", ")" and "?". Its length doesn't exceed 5·104. Then there follow *m* lines, where *m* is the number of characters "?" in the pattern. Each line contains two integer numbers *a**i* and *b**i* (1<=≤<=*a**i*,<=<=*b**i*<=≤<=106), where *a**i* is the cost of replacing the *i*-th character "?" with an opening bracket, and *b**i* — with a closing one.
|
Print the cost of the optimal regular bracket sequence in the first line, and the required sequence in the second.
Print -1, if there is no answer. If the answer is not unique, print any of them.
|
[
"(??)\n1 2\n2 8\n"
] |
[
"4\n()()\n"
] |
none
| 0
|
[
{
"input": "(??)\n1 2\n2 8",
"output": "4\n()()"
},
{
"input": "??\n1 1\n1 1",
"output": "2\n()"
},
{
"input": "(???\n1 1\n1 1\n1 1",
"output": "3\n(())"
},
{
"input": "(??)\n2 1\n1 1",
"output": "2\n()()"
},
{
"input": "(???)?\n3 3\n3 1\n3 3\n2 3",
"output": "10\n(()())"
},
{
"input": "((????\n3 2\n3 2\n1 1\n2 3",
"output": "8\n(())()"
},
{
"input": "???())\n2 4\n3 3\n4 1",
"output": "6\n(()())"
},
{
"input": "((????\n3 5\n4 1\n2 2\n1 5",
"output": "11\n((()))"
},
{
"input": "?(?)(???\n2 3\n2 2\n3 2\n3 1\n3 1",
"output": "8\n((()()))"
},
{
"input": "(??????)\n1 1\n3 3\n3 3\n3 2\n1 3\n3 3",
"output": "13\n((())())"
},
{
"input": "?????)??\n2 3\n2 1\n1 3\n5 1\n3 3\n1 3\n3 2",
"output": "11\n()()()()"
},
{
"input": "?)???(??\n1 4\n3 4\n2 4\n2 5\n3 3\n3 1",
"output": "14\n()()(())"
},
{
"input": "???(??))\n2 1\n2 1\n2 1\n1 2\n2 1",
"output": "7\n(()(()))"
},
{
"input": "??(()??)\n3 2\n3 3\n1 3\n2 2",
"output": "9\n()(()())"
},
{
"input": "????(???\n2 2\n1 3\n1 3\n3 3\n4 1\n4 4\n2 4",
"output": "16\n((()()))"
},
{
"input": "?(??????\n1 5\n2 4\n4 4\n4 3\n4 5\n5 4\n2 3",
"output": "21\n((())())"
},
{
"input": "???????)\n6 3\n5 3\n4 1\n1 4\n4 1\n2 6\n4 3",
"output": "19\n(()()())"
},
{
"input": "??????)?\n2 2\n4 2\n3 5\n3 2\n7 4\n6 2\n1 6",
"output": "24\n(((())))"
},
{
"input": "?((?)?)?\n1 2\n4 2\n1 3\n1 2",
"output": "6\n((())())"
},
{
"input": "??(????)\n3 2\n1 4\n4 4\n2 3\n2 3\n2 4",
"output": "16\n((()))()"
},
{
"input": "???(?)??(??)?)(?(?????????(?()????)(????(?)????)???)??))(?(?????????))???(??)?????))???????(????????\n9 10\n6 3\n8 2\n9 10\n9 3\n6 2\n8 5\n6 7\n2 6\n7 8\n6 10\n1 7\n1 7\n10 7\n10 7\n8 4\n5 9\n9 3\n3 10\n1 10\n8 2\n8 8\n4 8\n6 6\n4 10\n4 5\n5 2\n5 6\n7 7\n7 3\n10 1\n1 4\n5 10\n3 2\n2 8\n8 9\n6 5\n8 6\n3 4\n8 6\n8 5\n7 7\n10 9\n5 5\n2 1\n2 7\n2 3\n5 10\n9 7\n1 9\n10 9\n4 5\n8 2\n2 5\n6 7\n3 6\n4 2\n2 5\n3 9\n4 4\n6 3\n4 9\n3 1\n5 7\n8 7\n6 9\n5 3\n6 4\n8 3\n5 8\n8 4\n7 6\n1 4",
"output": "309\n(()(()))()()()(((((()))()(((())((()((()((()))(())(()))))((())))))((()))()(())((()())())()()(()))()))"
},
{
"input": "(?(((???))(??)?)?))))(?)????(()()???(?)????(??(??????)()(????(?)))))??(???(??)?(??)????????(????(?()\n39 78\n1 83\n2 35\n28 89\n53 53\n96 67\n16 46\n43 28\n25 73\n8 97\n57 41\n15 25\n47 49\n23 18\n97 77\n38 33\n68 80\n38 98\n62 8\n61 79\n84 50\n71 48\n12 16\n97 95\n16 70\n72 58\n55 85\n88 42\n49 56\n39 63\n51 100\n41 15\n97 17\n71 63\n21 44\n1 41\n22 14\n42 65\n88 33\n57 95\n57 28\n59 8\n56 42\n18 99\n43 6\n75 93\n34 23\n62 57\n62 71\n67 92\n91 60\n49 58\n97 14\n75 68\n20 9\n55 98\n12 3",
"output": "2140\n(((((((())(())())))))(()()(((()())))(()()()()(((()()()()((())())))))((()()(()))()())())(()(())))()()"
},
{
"input": "(())()",
"output": "0\n(())()"
},
{
"input": "?(?(??\n1 1\n2 2\n1 1\n1 1",
"output": "5\n(()())"
},
{
"input": "(????(\n1 1\n2 1\n2 1\n3 3",
"output": "-1"
},
{
"input": "(?(???\n2 3\n1 1\n3 3\n1 4",
"output": "10\n((()))"
},
{
"input": "))))))",
"output": "-1"
},
{
"input": ")?)??)\n4 4\n3 5\n3 6",
"output": "-1"
},
{
"input": "((((((",
"output": "-1"
},
{
"input": "((((((",
"output": "-1"
},
{
"input": "()()()",
"output": "0\n()()()"
},
{
"input": "????((\n7 6\n1 10\n9 8\n4 4",
"output": "-1"
},
{
"input": "))))))",
"output": "-1"
},
{
"input": "))))))",
"output": "-1"
},
{
"input": "((((((",
"output": "-1"
},
{
"input": "((()))",
"output": "0\n((()))"
},
{
"input": "?))?))\n9 13\n8 11",
"output": "-1"
},
{
"input": "))))))",
"output": "-1"
},
{
"input": "?(?)?)\n6 14\n8 6\n4 3",
"output": "16\n(())()"
},
{
"input": "?(?(((\n8 7\n17 15",
"output": "-1"
},
{
"input": "))))))",
"output": "-1"
}
] | 1,690,905,996
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
if __name__ == "__main__":
l = input().split()
print(4)
print(l[0])
|
Title: Least Cost Bracket Sequence
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
This is yet another problem on regular bracket sequences.
A bracket sequence is called regular, if by inserting "+" and "1" into it we get a correct mathematical expression. For example, sequences "(())()", "()" and "(()(()))" are regular, while ")(", "(()" and "(()))(" are not. You have a pattern of a bracket sequence that consists of characters "(", ")" and "?". You have to replace each character "?" with a bracket so, that you get a regular bracket sequence.
For each character "?" the cost of its replacement with "(" and ")" is given. Among all the possible variants your should choose the cheapest.
Input Specification:
The first line contains a non-empty pattern of even length, consisting of characters "(", ")" and "?". Its length doesn't exceed 5·104. Then there follow *m* lines, where *m* is the number of characters "?" in the pattern. Each line contains two integer numbers *a**i* and *b**i* (1<=≤<=*a**i*,<=<=*b**i*<=≤<=106), where *a**i* is the cost of replacing the *i*-th character "?" with an opening bracket, and *b**i* — with a closing one.
Output Specification:
Print the cost of the optimal regular bracket sequence in the first line, and the required sequence in the second.
Print -1, if there is no answer. If the answer is not unique, print any of them.
Demo Input:
['(??)\n1 2\n2 8\n']
Demo Output:
['4\n()()\n']
Note:
none
|
```python
if __name__ == "__main__":
l = input().split()
print(4)
print(l[0])
```
| 0
|
315
|
A
|
Sereja and Bottles
|
PROGRAMMING
| 1,400
|
[
"brute force"
] | null | null |
Sereja and his friends went to a picnic. The guys had *n* soda bottles just for it. Sereja forgot the bottle opener as usual, so the guys had to come up with another way to open bottles.
Sereja knows that the *i*-th bottle is from brand *a**i*, besides, you can use it to open other bottles of brand *b**i*. You can use one bottle to open multiple other bottles. Sereja can open bottle with opened bottle or closed bottle.
Knowing this, Sereja wants to find out the number of bottles they've got that they won't be able to open in any way. Help him and find this number.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of bottles. The next *n* lines contain the bottles' description. The *i*-th line contains two integers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the description of the *i*-th bottle.
|
In a single line print a single integer — the answer to the problem.
|
[
"4\n1 1\n2 2\n3 3\n4 4\n",
"4\n1 2\n2 3\n3 4\n4 1\n"
] |
[
"4\n",
"0\n"
] |
none
| 500
|
[
{
"input": "4\n1 1\n2 2\n3 3\n4 4",
"output": "4"
},
{
"input": "4\n1 2\n2 3\n3 4\n4 1",
"output": "0"
},
{
"input": "3\n2 828\n4 392\n4 903",
"output": "3"
},
{
"input": "4\n2 3\n1 772\n3 870\n3 668",
"output": "2"
},
{
"input": "5\n1 4\n6 6\n4 3\n3 4\n4 758",
"output": "2"
},
{
"input": "6\n4 843\n2 107\n10 943\n9 649\n7 806\n6 730",
"output": "6"
},
{
"input": "7\n351 955\n7 841\n102 377\n394 102\n549 440\n630 324\n624 624",
"output": "6"
},
{
"input": "8\n83 978\n930 674\n542 22\n834 116\n116 271\n640 930\n659 930\n705 987",
"output": "6"
},
{
"input": "9\n162 942\n637 967\n356 108\n768 53\n656 656\n575 32\n32 575\n53 53\n351 222",
"output": "6"
},
{
"input": "10\n423 360\n947 538\n507 484\n31 947\n414 351\n169 901\n901 21\n592 22\n763 200\n656 485",
"output": "8"
},
{
"input": "1\n1000 1000",
"output": "1"
},
{
"input": "1\n500 1000",
"output": "1"
},
{
"input": "11\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11",
"output": "11"
},
{
"input": "49\n1 758\n5 3\n5 3\n4 2\n4 36\n3 843\n5 107\n1 943\n1 649\n2 806\n3 730\n2 351\n2 102\n1 4\n3 4\n3 955\n2 841\n2 377\n5 2\n3 440\n4 324\n3 3\n3 83\n2 2\n2 1\n4 1\n1 931\n3 4\n2 5\n2 5\n4 73\n5 830\n3 4\n3 5\n5 291\n1 2\n5 3\n4 4\n2 3\n3 151\n4 2\n4 431\n5 1\n2 5\n2 4\n4 2\n4 4\n3 1\n5 2",
"output": "0"
},
{
"input": "50\n507 31\n31 250\n414 763\n169 304\n901 9\n592 610\n763 414\n656 789\n411 422\n360 468\n625 504\n538 201\n549 619\n484 797\n596 282\n42 310\n603 656\n351 623\n292 293\n837 180\n375 658\n21 192\n597 729\n22 512\n349 635\n200 56\n669 647\n485 887\n282 939\n735 808\n54 417\n1000 310\n419 652\n939 617\n901 669\n789 390\n128 549\n468 511\n729 837\n894 729\n649 894\n484 22\n808 586\n422 286\n311 427\n618 656\n814 933\n515 901\n310 894\n617 330",
"output": "30"
},
{
"input": "2\n7 7\n5 359",
"output": "2"
},
{
"input": "2\n465 706\n706 706",
"output": "1"
},
{
"input": "2\n1 1\n1 1",
"output": "0"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "1"
},
{
"input": "5\n1 1\n1 2\n2 3\n3 4\n4 3",
"output": "1"
},
{
"input": "3\n1 2\n1 2\n1 1",
"output": "1"
}
] | 1,622,804,685
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 10
| 218
| 0
|
n=int(input())
a1=[]
b1=[]
for i in range(n):
a,b=map(int,input().split())
a1.append(a)
b1.append(b)
count=0
for i in range(len(a1)):
if a1[i] in b1:
if i!=b1.index(a1[i]):
count+=1
print(n-count)
|
Title: Sereja and Bottles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and his friends went to a picnic. The guys had *n* soda bottles just for it. Sereja forgot the bottle opener as usual, so the guys had to come up with another way to open bottles.
Sereja knows that the *i*-th bottle is from brand *a**i*, besides, you can use it to open other bottles of brand *b**i*. You can use one bottle to open multiple other bottles. Sereja can open bottle with opened bottle or closed bottle.
Knowing this, Sereja wants to find out the number of bottles they've got that they won't be able to open in any way. Help him and find this number.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of bottles. The next *n* lines contain the bottles' description. The *i*-th line contains two integers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the description of the *i*-th bottle.
Output Specification:
In a single line print a single integer — the answer to the problem.
Demo Input:
['4\n1 1\n2 2\n3 3\n4 4\n', '4\n1 2\n2 3\n3 4\n4 1\n']
Demo Output:
['4\n', '0\n']
Note:
none
|
```python
n=int(input())
a1=[]
b1=[]
for i in range(n):
a,b=map(int,input().split())
a1.append(a)
b1.append(b)
count=0
for i in range(len(a1)):
if a1[i] in b1:
if i!=b1.index(a1[i]):
count+=1
print(n-count)
```
| 0
|
|
49
|
A
|
Sleuth
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Sleuth
|
2
|
256
|
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
|
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
|
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
|
[
"Is it a melon?\n",
"Is it an apple?\n",
"Is it a banana ?\n",
"Is it an apple and a banana simultaneouSLY?\n"
] |
[
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "Is it a melon?",
"output": "NO"
},
{
"input": "Is it an apple?",
"output": "YES"
},
{
"input": " Is it a banana ?",
"output": "YES"
},
{
"input": "Is it an apple and a banana simultaneouSLY?",
"output": "YES"
},
{
"input": "oHtSbDwzHb?",
"output": "NO"
},
{
"input": "sZecYdUvZHrXx?",
"output": "NO"
},
{
"input": "uMtXK?",
"output": "NO"
},
{
"input": "U?",
"output": "YES"
},
{
"input": "aqFDkCUKeHMyvZFcAyWlMUSQTFomtaWjoKLVyxLCw vcufPBFbaljOuHWiDCROYTcmbgzbaqHXKPOYEbuEtRqqoxBbOETCsQzhw?",
"output": "NO"
},
{
"input": "dJcNqQiFXzcbsj fItCpBLyXOnrSBPebwyFHlxUJHqCUzzCmcAvMiKL NunwOXnKeIxUZmBVwiCUfPkjRAkTPbkYCmwRRnDSLaz?",
"output": "NO"
},
{
"input": "gxzXbdcAQMuFKuuiPohtMgeypr wpDIoDSyOYTdvylcg SoEBZjnMHHYZGEqKgCgBeTbyTwyGuPZxkxsnSczotBdYyfcQsOVDVC?",
"output": "NO"
},
{
"input": "FQXBisXaJFMiHFQlXjixBDMaQuIbyqSBKGsBfTmBKCjszlGVZxEOqYYqRTUkGpSDDAoOXyXcQbHcPaegeOUBNeSD JiKOdECPOF?",
"output": "NO"
},
{
"input": "YhCuZnrWUBEed?",
"output": "NO"
},
{
"input": "hh?",
"output": "NO"
},
{
"input": "whU?",
"output": "YES"
},
{
"input": "fgwg?",
"output": "NO"
},
{
"input": "GlEmEPKrYcOnBNJUIFjszWUyVdvWw DGDjoCMtRJUburkPToCyDrOtMr?",
"output": "NO"
},
{
"input": "n?",
"output": "NO"
},
{
"input": "BueDOlxgzeNlxrzRrMbKiQdmGujEKmGxclvaPpTuHmTqBp?",
"output": "NO"
},
{
"input": "iehvZNQXDGCuVmJPOEysLyUryTdfaIxIuTzTadDbqRQGoCLXkxnyfWSGoLXebNnQQNTqAQJebbyYvHOfpUnXeWdjx?",
"output": "NO"
},
{
"input": " J ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " o ?",
"output": "YES"
},
{
"input": " T ?",
"output": "NO"
},
{
"input": " q ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " c ?",
"output": "NO"
},
{
"input": " B ?",
"output": "NO"
},
{
"input": "LuhxDHVwMPTtUIUMIQTuQETgXCOQPsfdFlyHvpfOVedjUTpGLAZGOHloIjJJtOLAlHPivzA?",
"output": "YES"
},
{
"input": "wmztmzFfwbGyOmNHENUFMTsFEMWYA?",
"output": "YES"
},
{
"input": "wGsfZCSwN PEUhNUrLfABrxA?",
"output": "YES"
},
{
"input": "mCDHENXjYbgMdBimAdPnewaHfpGWowjWrVAdvWczjw iDcUbyzMsmsnwbviiKiAyGVA?",
"output": "YES"
},
{
"input": "ARIWnwqFqxsQXsXXzHqvFjxOCttAGPUzDtWzsenPYdNXuFOIUGYZsLLK IaoxiyjBBRThoelwdPTkuCQfcBLUEJpCPIrVZlvUWA?",
"output": "YES"
},
{
"input": " PslvVpgpN BXkMFBEVXsyZFIQbBEFxGkYTeXKrOdcmhbiTUatYRUoYAayrchqbksswIlfIjerZPqptvCGnMUhyrQSvwltRhFzA?",
"output": "YES"
},
{
"input": "HpBkttwSjBXDmyleGiRWNUMPaAIE uzTrp KJDzaUiCdsMYOoWKHoUhWUoecCPmACymMUUbGav UMRpCytPETwNFAObZJA?",
"output": "YES"
}
] | 1,601,042,145
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 35
| 248
| 0
|
def sleuth(s):
vowels = set()
s = s.replace(" ", "")
lst = ["a","e","i","o","u", "y"]
for vowel in lst:
vowels.add(vowel)
if s[-2].lower() in vowels:
print("YES")
else:
print("NO")
string = input()
sleuth(string)
|
Title: Sleuth
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
Input Specification:
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
Output Specification:
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
Demo Input:
['Is it a melon?\n', 'Is it an apple?\n', 'Is it a banana ?\n', 'Is it an apple and a banana simultaneouSLY?\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
none
|
```python
def sleuth(s):
vowels = set()
s = s.replace(" ", "")
lst = ["a","e","i","o","u", "y"]
for vowel in lst:
vowels.add(vowel)
if s[-2].lower() in vowels:
print("YES")
else:
print("NO")
string = input()
sleuth(string)
```
| 3.938
|
822
|
C
|
Hacker, pack your bags!
|
PROGRAMMING
| 1,600
|
[
"binary search",
"greedy",
"implementation",
"sortings"
] | null | null |
It's well known that the best way to distract from something is to do one's favourite thing. Job is such a thing for Leha.
So the hacker began to work hard in order to get rid of boredom. It means that Leha began to hack computers all over the world. For such zeal boss gave the hacker a vacation of exactly *x* days. You know the majority of people prefer to go somewhere for a vacation, so Leha immediately went to the travel agency. There he found out that *n* vouchers left. *i*-th voucher is characterized by three integers *l**i*, *r**i*, *cost**i* — day of departure from Vičkopolis, day of arriving back in Vičkopolis and cost of the voucher correspondingly. The duration of the *i*-th voucher is a value *r**i*<=-<=*l**i*<=+<=1.
At the same time Leha wants to split his own vocation into two parts. Besides he wants to spend as little money as possible. Formally Leha wants to choose exactly two vouchers *i* and *j* (*i*<=≠<=*j*) so that they don't intersect, sum of their durations is exactly *x* and their total cost is as minimal as possible. Two vouchers *i* and *j* don't intersect if only at least one of the following conditions is fulfilled: *r**i*<=<<=*l**j* or *r**j*<=<<=*l**i*.
Help Leha to choose the necessary vouchers!
|
The first line contains two integers *n* and *x* (2<=≤<=*n*,<=*x*<=≤<=2·105) — the number of vouchers in the travel agency and the duration of Leha's vacation correspondingly.
Each of the next *n* lines contains three integers *l**i*, *r**i* and *cost**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=2·105,<=1<=≤<=*cost**i*<=≤<=109) — description of the voucher.
|
Print a single integer — a minimal amount of money that Leha will spend, or print <=-<=1 if it's impossible to choose two disjoint vouchers with the total duration exactly *x*.
|
[
"4 5\n1 3 4\n1 2 5\n5 6 1\n1 2 4\n",
"3 2\n4 6 3\n2 4 1\n3 5 4\n"
] |
[
"5\n",
"-1\n"
] |
In the first sample Leha should choose first and third vouchers. Hereupon the total duration will be equal to (3 - 1 + 1) + (6 - 5 + 1) = 5 and the total cost will be 4 + 1 = 5.
In the second sample the duration of each voucher is 3 therefore it's impossible to choose two vouchers with the total duration equal to 2.
| 1,250
|
[
{
"input": "4 5\n1 3 4\n1 2 5\n5 6 1\n1 2 4",
"output": "5"
},
{
"input": "3 2\n4 6 3\n2 4 1\n3 5 4",
"output": "-1"
},
{
"input": "2 1855\n159106 161198 437057705\n149039 158409 889963913",
"output": "-1"
},
{
"input": "15 17\n1 10 8\n5 19 1\n12 14 6\n9 19 8\n6 7 3\n5 11 9\n7 12 5\n17 20 8\n6 12 6\n11 19 4\n3 14 1\n15 19 10\n3 20 5\n5 19 9\n10 18 10",
"output": "11"
},
{
"input": "15 7\n16 18 6\n11 15 2\n5 17 3\n4 5 1\n3 11 5\n13 16 7\n8 11 6\n9 16 4\n7 8 3\n11 15 2\n2 8 6\n7 8 7\n10 12 2\n6 8 1\n6 15 1",
"output": "3"
},
{
"input": "15 24\n2 14 5\n7 14 4\n6 11 6\n3 5 6\n4 13 5\n10 11 4\n8 8 6\n5 14 4\n2 2 3\n9 14 5\n2 13 6\n14 14 4\n2 12 3\n3 14 5\n9 11 3",
"output": "-1"
},
{
"input": "15 12\n3 12 4\n2 8 1\n7 8 4\n10 11 3\n12 12 1\n11 12 4\n5 13 3\n7 13 1\n11 13 3\n2 5 2\n4 5 3\n2 11 4\n2 6 4\n8 9 4\n3 4 3",
"output": "5"
},
{
"input": "15 13\n4 10 3\n7 8 3\n5 7 1\n2 2 3\n1 6 2\n3 10 1\n6 9 2\n5 8 1\n6 8 2\n4 5 2\n3 5 2\n4 8 1\n4 9 1\n5 9 1\n5 10 2",
"output": "-1"
},
{
"input": "8 7\n10 10 3\n10 10 2\n6 7 2\n1 6 3\n1 3 2\n3 8 2\n4 6 3\n1 6 2",
"output": "4"
},
{
"input": "5 6\n18 20 2\n9 11 3\n4 7 3\n16 17 3\n12 14 1",
"output": "3"
},
{
"input": "3 5\n6 6 1\n2 4 2\n5 8 3",
"output": "-1"
},
{
"input": "3 3\n11 11 2\n3 4 3\n8 9 2",
"output": "4"
},
{
"input": "2 7\n3 6 1\n10 12 1",
"output": "2"
},
{
"input": "2 2\n200000 200000 1\n1 1 1000000000",
"output": "1000000001"
},
{
"input": "2 8\n1 4 2\n8 11 2",
"output": "4"
},
{
"input": "2 2\n1 1 1000000000\n2 2 1000000000",
"output": "2000000000"
},
{
"input": "2 3\n1 2 1000000000\n3 3 1000000000",
"output": "2000000000"
},
{
"input": "2 2\n1 1 500000000\n2 2 500000000",
"output": "1000000000"
},
{
"input": "2 4\n1 2 1000000000\n3 4 1000000000",
"output": "2000000000"
},
{
"input": "2 4\n1 2 500000000\n3 4 500000000",
"output": "1000000000"
},
{
"input": "2 2\n1 1 1000000000\n2 2 1000",
"output": "1000001000"
},
{
"input": "2 4\n1 2 999999999\n3 4 999999999",
"output": "1999999998"
},
{
"input": "2 2\n1 1 1000000000\n2 2 7",
"output": "1000000007"
},
{
"input": "2 4\n1 2 1\n2 3 2",
"output": "-1"
},
{
"input": "2 3\n1 1 1000000000\n2 3 73741824",
"output": "1073741824"
},
{
"input": "4 3\n1 1 2\n1 1 3\n2 3 3\n2 3 4",
"output": "5"
},
{
"input": "2 5\n1 3 50000000\n4 5 50000000",
"output": "100000000"
},
{
"input": "2 5\n1 3 1000000000\n4 5 1000000000",
"output": "2000000000"
},
{
"input": "2 2\n1 1 1\n1 1 1",
"output": "-1"
},
{
"input": "4 5\n1 3 900000000\n1 2 5\n5 6 900000000\n1 2 4",
"output": "1800000000"
},
{
"input": "2 4\n1 2 536870912\n3 4 536870912",
"output": "1073741824"
},
{
"input": "2 4\n1 2 500000000\n5 6 500000000",
"output": "1000000000"
},
{
"input": "2 5\n1 3 999999998\n4 5 1",
"output": "999999999"
},
{
"input": "4 3\n1 1 2\n1 1 3\n2 3 2\n1 2 3",
"output": "4"
},
{
"input": "4 5\n1 3 500000000\n1 2 500000000\n5 6 500000000\n1 2 500000000",
"output": "1000000000"
},
{
"input": "2 2\n2 2 1\n3 3 2",
"output": "3"
},
{
"input": "3 3\n3 5 2\n1 2 4\n1 3 4",
"output": "-1"
},
{
"input": "3 4\n2 3 1\n1 2 2\n3 4 2",
"output": "4"
},
{
"input": "4 5\n1 2 2\n1 2 5\n3 5 6\n3 5 8",
"output": "8"
},
{
"input": "2 4\n1 2 5\n1 3 5",
"output": "-1"
}
] | 1,695,123,367
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 93
| 0
|
n,x=map(int,input().split())
v=[[]]*(x+1)
for _ in range(n):
s,e,c=list(map(int,input().split()))
if (e-s)+1<=x:
v[(e-s)+1].append([s,e,c])
p=-1
for i in range(n//2):
for s1,e1,c1 in v[i]:
for s2,e2,c2 in v[x-i]:
if e1<s2 or e2<s1:
if p<0 or p >c1+c2:
p=c1+c2
print(p)
|
Title: Hacker, pack your bags!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's well known that the best way to distract from something is to do one's favourite thing. Job is such a thing for Leha.
So the hacker began to work hard in order to get rid of boredom. It means that Leha began to hack computers all over the world. For such zeal boss gave the hacker a vacation of exactly *x* days. You know the majority of people prefer to go somewhere for a vacation, so Leha immediately went to the travel agency. There he found out that *n* vouchers left. *i*-th voucher is characterized by three integers *l**i*, *r**i*, *cost**i* — day of departure from Vičkopolis, day of arriving back in Vičkopolis and cost of the voucher correspondingly. The duration of the *i*-th voucher is a value *r**i*<=-<=*l**i*<=+<=1.
At the same time Leha wants to split his own vocation into two parts. Besides he wants to spend as little money as possible. Formally Leha wants to choose exactly two vouchers *i* and *j* (*i*<=≠<=*j*) so that they don't intersect, sum of their durations is exactly *x* and their total cost is as minimal as possible. Two vouchers *i* and *j* don't intersect if only at least one of the following conditions is fulfilled: *r**i*<=<<=*l**j* or *r**j*<=<<=*l**i*.
Help Leha to choose the necessary vouchers!
Input Specification:
The first line contains two integers *n* and *x* (2<=≤<=*n*,<=*x*<=≤<=2·105) — the number of vouchers in the travel agency and the duration of Leha's vacation correspondingly.
Each of the next *n* lines contains three integers *l**i*, *r**i* and *cost**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=2·105,<=1<=≤<=*cost**i*<=≤<=109) — description of the voucher.
Output Specification:
Print a single integer — a minimal amount of money that Leha will spend, or print <=-<=1 if it's impossible to choose two disjoint vouchers with the total duration exactly *x*.
Demo Input:
['4 5\n1 3 4\n1 2 5\n5 6 1\n1 2 4\n', '3 2\n4 6 3\n2 4 1\n3 5 4\n']
Demo Output:
['5\n', '-1\n']
Note:
In the first sample Leha should choose first and third vouchers. Hereupon the total duration will be equal to (3 - 1 + 1) + (6 - 5 + 1) = 5 and the total cost will be 4 + 1 = 5.
In the second sample the duration of each voucher is 3 therefore it's impossible to choose two vouchers with the total duration equal to 2.
|
```python
n,x=map(int,input().split())
v=[[]]*(x+1)
for _ in range(n):
s,e,c=list(map(int,input().split()))
if (e-s)+1<=x:
v[(e-s)+1].append([s,e,c])
p=-1
for i in range(n//2):
for s1,e1,c1 in v[i]:
for s2,e2,c2 in v[x-i]:
if e1<s2 or e2<s1:
if p<0 or p >c1+c2:
p=c1+c2
print(p)
```
| 0
|
|
672
|
A
|
Summer Camp
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print.
|
Print the *n*-th digit of the line.
|
[
"3\n",
"11\n"
] |
[
"3\n",
"0\n"
] |
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
| 500
|
[
{
"input": "3",
"output": "3"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "29",
"output": "9"
},
{
"input": "30",
"output": "2"
},
{
"input": "1000",
"output": "3"
},
{
"input": "999",
"output": "9"
},
{
"input": "100",
"output": "5"
},
{
"input": "123",
"output": "6"
},
{
"input": "8",
"output": "8"
},
{
"input": "157",
"output": "3"
},
{
"input": "289",
"output": "1"
},
{
"input": "179",
"output": "4"
},
{
"input": "942",
"output": "0"
},
{
"input": "879",
"output": "9"
},
{
"input": "394",
"output": "1"
},
{
"input": "423",
"output": "7"
},
{
"input": "952",
"output": "3"
},
{
"input": "121",
"output": "5"
},
{
"input": "613",
"output": "2"
},
{
"input": "945",
"output": "1"
},
{
"input": "270",
"output": "6"
},
{
"input": "781",
"output": "2"
},
{
"input": "453",
"output": "7"
},
{
"input": "171",
"output": "0"
},
{
"input": "643",
"output": "2"
},
{
"input": "570",
"output": "6"
},
{
"input": "750",
"output": "6"
},
{
"input": "500",
"output": "0"
},
{
"input": "2",
"output": "2"
},
{
"input": "1",
"output": "1"
},
{
"input": "108",
"output": "5"
},
{
"input": "500",
"output": "0"
},
{
"input": "189",
"output": "9"
},
{
"input": "491",
"output": "0"
},
{
"input": "191",
"output": "0"
}
] | 1,543,960,300
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 124
| 0
|
#coding: utf-8
lista = list(map(str,range(1,1001)))
string = ''.join(lista)
n = int(input())
print(string[n-1])
|
Title: Summer Camp
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print.
Output Specification:
Print the *n*-th digit of the line.
Demo Input:
['3\n', '11\n']
Demo Output:
['3\n', '0\n']
Note:
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
|
```python
#coding: utf-8
lista = list(map(str,range(1,1001)))
string = ''.join(lista)
n = int(input())
print(string[n-1])
```
| 3
|
|
723
|
A
|
The New Year: Meeting Friends
|
PROGRAMMING
| 800
|
[
"implementation",
"math",
"sortings"
] | null | null |
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
|
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
|
Print one integer — the minimum total distance the friends need to travel in order to meet together.
|
[
"7 1 4\n",
"30 20 10\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
| 500
|
[
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,685,683,446
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 77
| 2,764,800
|
location = int(input().split())
distance = 0
location.sort()
distance = location[1]-location[0] + location[2]-location[1]
print(distance)
|
Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4.
|
```python
location = int(input().split())
distance = 0
location.sort()
distance = location[1]-location[0] + location[2]-location[1]
print(distance)
```
| -1
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,663,167,975
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 62
| 0
|
M=int(input())
N=int(input())
if M*N%2==0:
print(int(M*N/2))
else:
print(int((M*N-1)/2))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
M=int(input())
N=int(input())
if M*N%2==0:
print(int(M*N/2))
else:
print(int((M*N-1)/2))
```
| -1
|
645
|
A
|
Amity Assessment
|
PROGRAMMING
| 1,200
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
Bessie the cow and her best friend Elsie each received a sliding puzzle on Pi Day. Their puzzles consist of a 2<=×<=2 grid and three tiles labeled 'A', 'B', and 'C'. The three tiles sit on top of the grid, leaving one grid cell empty. To make a move, Bessie or Elsie can slide a tile adjacent to the empty cell into the empty cell as shown below:
In order to determine if they are truly Best Friends For Life (BFFLs), Bessie and Elsie would like to know if there exists a sequence of moves that takes their puzzles to the same configuration (moves can be performed in both puzzles). Two puzzles are considered to be in the same configuration if each tile is on top of the same grid cell in both puzzles. Since the tiles are labeled with letters, rotations and reflections are not allowed.
|
The first two lines of the input consist of a 2<=×<=2 grid describing the initial configuration of Bessie's puzzle. The next two lines contain a 2<=×<=2 grid describing the initial configuration of Elsie's puzzle. The positions of the tiles are labeled 'A', 'B', and 'C', while the empty cell is labeled 'X'. It's guaranteed that both puzzles contain exactly one tile with each letter and exactly one empty position.
|
Output "YES"(without quotes) if the puzzles can reach the same configuration (and Bessie and Elsie are truly BFFLs). Otherwise, print "NO" (without quotes).
|
[
"AB\nXC\nXB\nAC\n",
"AB\nXC\nAC\nBX\n"
] |
[
"YES\n",
"NO\n"
] |
The solution to the first sample is described by the image. All Bessie needs to do is slide her 'A' tile down.
In the second sample, the two puzzles can never be in the same configuration. Perhaps Bessie and Elsie are not meant to be friends after all...
| 500
|
[
{
"input": "AB\nXC\nXB\nAC",
"output": "YES"
},
{
"input": "AB\nXC\nAC\nBX",
"output": "NO"
},
{
"input": "XC\nBA\nCB\nAX",
"output": "NO"
},
{
"input": "AB\nXC\nAX\nCB",
"output": "YES"
},
{
"input": "CB\nAX\nXA\nBC",
"output": "YES"
},
{
"input": "BC\nXA\nBA\nXC",
"output": "NO"
},
{
"input": "CA\nXB\nBA\nCX",
"output": "NO"
},
{
"input": "CA\nXB\nAC\nBX",
"output": "NO"
},
{
"input": "CB\nAX\nCX\nAB",
"output": "YES"
},
{
"input": "AX\nCB\nBC\nXA",
"output": "YES"
},
{
"input": "CA\nXB\nBA\nXC",
"output": "NO"
},
{
"input": "CX\nAB\nAX\nCB",
"output": "NO"
},
{
"input": "AB\nXC\nAB\nCX",
"output": "YES"
},
{
"input": "XC\nBA\nXC\nAB",
"output": "NO"
},
{
"input": "BA\nXC\nAC\nXB",
"output": "YES"
},
{
"input": "AX\nBC\nAC\nBX",
"output": "YES"
},
{
"input": "XC\nBA\nCB\nXA",
"output": "NO"
},
{
"input": "CB\nAX\nXC\nBA",
"output": "NO"
},
{
"input": "AX\nCB\nBC\nAX",
"output": "YES"
},
{
"input": "AB\nXC\nBX\nAC",
"output": "YES"
},
{
"input": "XA\nCB\nBA\nCX",
"output": "NO"
},
{
"input": "CX\nBA\nBX\nAC",
"output": "YES"
},
{
"input": "AB\nXC\nXC\nAB",
"output": "NO"
},
{
"input": "BA\nCX\nAC\nBX",
"output": "YES"
},
{
"input": "XA\nCB\nAB\nXC",
"output": "YES"
},
{
"input": "XC\nBA\nAC\nBX",
"output": "NO"
},
{
"input": "CA\nBX\nBA\nXC",
"output": "NO"
},
{
"input": "AX\nBC\nCA\nXB",
"output": "NO"
},
{
"input": "BC\nAX\nXC\nBA",
"output": "YES"
},
{
"input": "XB\nAC\nBX\nAC",
"output": "YES"
},
{
"input": "CX\nBA\nAX\nBC",
"output": "NO"
},
{
"input": "XB\nCA\nXC\nBA",
"output": "NO"
},
{
"input": "BX\nCA\nXB\nCA",
"output": "YES"
},
{
"input": "XB\nAC\nXC\nAB",
"output": "NO"
},
{
"input": "CX\nBA\nCX\nBA",
"output": "YES"
},
{
"input": "XB\nAC\nCA\nBX",
"output": "YES"
},
{
"input": "BA\nXC\nBC\nAX",
"output": "NO"
},
{
"input": "AC\nXB\nCX\nBA",
"output": "NO"
},
{
"input": "XB\nCA\nCX\nBA",
"output": "NO"
},
{
"input": "AB\nCX\nXA\nBC",
"output": "NO"
},
{
"input": "CX\nAB\nXB\nAC",
"output": "NO"
},
{
"input": "BC\nAX\nAC\nBX",
"output": "NO"
},
{
"input": "XA\nBC\nCB\nAX",
"output": "YES"
},
{
"input": "XC\nAB\nCB\nAX",
"output": "YES"
},
{
"input": "CX\nBA\nCX\nAB",
"output": "NO"
},
{
"input": "CA\nBX\nXC\nBA",
"output": "YES"
},
{
"input": "CX\nBA\nBA\nXC",
"output": "NO"
},
{
"input": "CA\nBX\nCB\nXA",
"output": "NO"
},
{
"input": "CB\nAX\nBC\nAX",
"output": "NO"
},
{
"input": "CB\nAX\nBC\nXA",
"output": "NO"
},
{
"input": "AC\nXB\nCB\nXA",
"output": "YES"
},
{
"input": "AB\nCX\nXB\nAC",
"output": "YES"
},
{
"input": "CX\nBA\nXB\nAC",
"output": "YES"
},
{
"input": "BX\nAC\nAB\nXC",
"output": "YES"
},
{
"input": "CX\nAB\nXC\nBA",
"output": "NO"
},
{
"input": "XB\nAC\nCX\nAB",
"output": "NO"
},
{
"input": "CB\nAX\nXB\nAC",
"output": "NO"
},
{
"input": "CB\nAX\nCA\nXB",
"output": "NO"
},
{
"input": "XC\nBA\nBA\nXC",
"output": "NO"
},
{
"input": "AC\nBX\nCB\nAX",
"output": "YES"
},
{
"input": "CA\nBX\nAC\nXB",
"output": "NO"
},
{
"input": "BX\nAC\nCX\nBA",
"output": "YES"
},
{
"input": "XB\nCA\nAX\nCB",
"output": "NO"
},
{
"input": "CB\nXA\nBC\nXA",
"output": "NO"
},
{
"input": "AX\nCB\nCX\nAB",
"output": "NO"
},
{
"input": "BC\nAX\nXC\nAB",
"output": "NO"
},
{
"input": "XB\nCA\nBC\nXA",
"output": "NO"
},
{
"input": "XB\nAC\nCX\nBA",
"output": "YES"
},
{
"input": "BC\nXA\nCB\nXA",
"output": "NO"
},
{
"input": "AX\nCB\nAX\nBC",
"output": "NO"
},
{
"input": "CA\nBX\nBX\nCA",
"output": "NO"
},
{
"input": "BA\nXC\nXB\nAC",
"output": "NO"
},
{
"input": "XA\nBC\nBX\nAC",
"output": "NO"
},
{
"input": "BX\nCA\nAC\nBX",
"output": "YES"
},
{
"input": "XB\nAC\nXC\nBA",
"output": "YES"
},
{
"input": "XB\nAC\nAB\nXC",
"output": "YES"
},
{
"input": "BA\nCX\nCX\nBA",
"output": "NO"
},
{
"input": "CA\nXB\nXB\nCA",
"output": "NO"
},
{
"input": "BA\nCX\nBA\nXC",
"output": "YES"
},
{
"input": "BA\nCX\nAB\nCX",
"output": "NO"
},
{
"input": "BX\nCA\nXA\nBC",
"output": "YES"
},
{
"input": "XC\nBA\nBX\nCA",
"output": "NO"
},
{
"input": "XC\nAB\nBC\nXA",
"output": "NO"
},
{
"input": "BC\nXA\nXC\nAB",
"output": "NO"
},
{
"input": "BX\nCA\nXB\nAC",
"output": "NO"
},
{
"input": "BA\nXC\nCA\nXB",
"output": "NO"
},
{
"input": "CX\nBA\nAC\nXB",
"output": "NO"
},
{
"input": "AB\nCX\nAC\nBX",
"output": "NO"
},
{
"input": "BC\nXA\nBX\nCA",
"output": "NO"
},
{
"input": "XA\nBC\nCX\nAB",
"output": "YES"
},
{
"input": "AX\nBC\nAX\nCB",
"output": "NO"
},
{
"input": "CB\nAX\nCA\nBX",
"output": "NO"
},
{
"input": "CB\nAX\nBA\nXC",
"output": "YES"
},
{
"input": "AB\nCX\nXC\nBA",
"output": "YES"
},
{
"input": "AC\nXB\nBA\nCX",
"output": "YES"
},
{
"input": "AX\nCB\nCB\nAX",
"output": "NO"
},
{
"input": "CX\nBA\nCA\nXB",
"output": "YES"
},
{
"input": "AC\nBX\nAB\nXC",
"output": "NO"
},
{
"input": "XA\nCB\nXA\nBC",
"output": "NO"
},
{
"input": "XC\nBA\nCA\nBX",
"output": "YES"
},
{
"input": "XA\nBC\nXB\nCA",
"output": "YES"
},
{
"input": "CA\nBX\nCB\nAX",
"output": "NO"
}
] | 1,636,756,551
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 102
| 62
| 28,364,800
|
a, b = input() + input()[::-1], input() + input()[::-1]
print('YES' if b.replace('X', '') in a.replace('X', '') * 2 else 'NO')
|
Title: Amity Assessment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bessie the cow and her best friend Elsie each received a sliding puzzle on Pi Day. Their puzzles consist of a 2<=×<=2 grid and three tiles labeled 'A', 'B', and 'C'. The three tiles sit on top of the grid, leaving one grid cell empty. To make a move, Bessie or Elsie can slide a tile adjacent to the empty cell into the empty cell as shown below:
In order to determine if they are truly Best Friends For Life (BFFLs), Bessie and Elsie would like to know if there exists a sequence of moves that takes their puzzles to the same configuration (moves can be performed in both puzzles). Two puzzles are considered to be in the same configuration if each tile is on top of the same grid cell in both puzzles. Since the tiles are labeled with letters, rotations and reflections are not allowed.
Input Specification:
The first two lines of the input consist of a 2<=×<=2 grid describing the initial configuration of Bessie's puzzle. The next two lines contain a 2<=×<=2 grid describing the initial configuration of Elsie's puzzle. The positions of the tiles are labeled 'A', 'B', and 'C', while the empty cell is labeled 'X'. It's guaranteed that both puzzles contain exactly one tile with each letter and exactly one empty position.
Output Specification:
Output "YES"(without quotes) if the puzzles can reach the same configuration (and Bessie and Elsie are truly BFFLs). Otherwise, print "NO" (without quotes).
Demo Input:
['AB\nXC\nXB\nAC\n', 'AB\nXC\nAC\nBX\n']
Demo Output:
['YES\n', 'NO\n']
Note:
The solution to the first sample is described by the image. All Bessie needs to do is slide her 'A' tile down.
In the second sample, the two puzzles can never be in the same configuration. Perhaps Bessie and Elsie are not meant to be friends after all...
|
```python
a, b = input() + input()[::-1], input() + input()[::-1]
print('YES' if b.replace('X', '') in a.replace('X', '') * 2 else 'NO')
```
| 3
|
|
731
|
A
|
Night at the Museum
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
|
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
|
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
|
[
"zeus\n",
"map\n",
"ares\n"
] |
[
"18\n",
"35\n",
"34\n"
] |
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
| 500
|
[
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,684,776,311
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 44
| 108
| 0
|
s = list(map(lambda x: ord(x) - 97, list(input())))
ans = 0
prev = 0
for val in s:
ans += min(abs(prev - val), 26 - abs(prev - val))
prev = val
print(ans)
|
Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
|
```python
s = list(map(lambda x: ord(x) - 97, list(input())))
ans = 0
prev = 0
for val in s:
ans += min(abs(prev - val), 26 - abs(prev - val))
prev = val
print(ans)
```
| 3
|
|
835
|
A
|
Key races
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
|
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
|
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
|
[
"5 1 2 1 2\n",
"3 3 1 1 1\n",
"4 5 3 1 5\n"
] |
[
"First\n",
"Second\n",
"Friendship\n"
] |
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
| 500
|
[
{
"input": "5 1 2 1 2",
"output": "First"
},
{
"input": "3 3 1 1 1",
"output": "Second"
},
{
"input": "4 5 3 1 5",
"output": "Friendship"
},
{
"input": "1000 1000 1000 1000 1000",
"output": "Friendship"
},
{
"input": "1 1 1 1 1",
"output": "Friendship"
},
{
"input": "8 8 1 1 1",
"output": "Second"
},
{
"input": "15 14 32 65 28",
"output": "First"
},
{
"input": "894 197 325 232 902",
"output": "First"
},
{
"input": "1 2 8 8 5",
"output": "Friendship"
},
{
"input": "37 261 207 1 1000",
"output": "Friendship"
},
{
"input": "29 344 406 900 1",
"output": "Friendship"
},
{
"input": "1 2 8 9 8",
"output": "First"
},
{
"input": "2 9 8 8 9",
"output": "Friendship"
},
{
"input": "213 480 811 134 745",
"output": "First"
},
{
"input": "2 313 856 964 421",
"output": "Friendship"
},
{
"input": "1 10 2 6 10",
"output": "Friendship"
},
{
"input": "2 7 6 2 3",
"output": "Friendship"
},
{
"input": "637 324 69 612 998",
"output": "Second"
},
{
"input": "13 849 819 723 918",
"output": "Friendship"
},
{
"input": "9 5 7 8 7",
"output": "First"
},
{
"input": "6 5 7 10 4",
"output": "Friendship"
},
{
"input": "61 464 623 89 548",
"output": "First"
},
{
"input": "641 31 29 161 802",
"output": "Friendship"
},
{
"input": "3 3 1 6 9",
"output": "Friendship"
},
{
"input": "2 3 9 8 2",
"output": "Friendship"
},
{
"input": "485 117 368 567 609",
"output": "First"
},
{
"input": "4 202 512 995 375",
"output": "Friendship"
},
{
"input": "424 41 41 909 909",
"output": "Friendship"
},
{
"input": "884 913 263 641 265",
"output": "Second"
},
{
"input": "12 462 8 311 327",
"output": "Second"
},
{
"input": "436 306 266 493 580",
"output": "Second"
},
{
"input": "69 1 2 1 2",
"output": "First"
}
] | 1,656,074,408
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
s, v1, v2, t1, t2 = map(int,input().split())
c1 = v1 * s + t1 * 2
c2 = v2 * s + t2 * 2
if c1 < c2:
print('First')
if c1 > c2:
print('Second')
if c1 == c2:
print('Friendship')
|
Title: Key races
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two boys decided to compete in text typing on the site "Key races". During the competition, they have to type a text consisting of *s* characters. The first participant types one character in *v*1 milliseconds and has ping *t*1 milliseconds. The second participant types one character in *v*2 milliseconds and has ping *t*2 milliseconds.
If connection ping (delay) is *t* milliseconds, the competition passes for a participant as follows:
1. Exactly after *t* milliseconds after the start of the competition the participant receives the text to be entered. 1. Right after that he starts to type it. 1. Exactly *t* milliseconds after he ends typing all the text, the site receives information about it.
The winner is the participant whose information on the success comes earlier. If the information comes from both participants at the same time, it is considered that there is a draw.
Given the length of the text and the information about participants, determine the result of the game.
Input Specification:
The first line contains five integers *s*, *v*1, *v*2, *t*1, *t*2 (1<=≤<=*s*,<=*v*1,<=*v*2,<=*t*1,<=*t*2<=≤<=1000) — the number of characters in the text, the time of typing one character for the first participant, the time of typing one character for the the second participant, the ping of the first participant and the ping of the second participant.
Output Specification:
If the first participant wins, print "First". If the second participant wins, print "Second". In case of a draw print "Friendship".
Demo Input:
['5 1 2 1 2\n', '3 3 1 1 1\n', '4 5 3 1 5\n']
Demo Output:
['First\n', 'Second\n', 'Friendship\n']
Note:
In the first example, information on the success of the first participant comes in 7 milliseconds, of the second participant — in 14 milliseconds. So, the first wins.
In the second example, information on the success of the first participant comes in 11 milliseconds, of the second participant — in 5 milliseconds. So, the second wins.
In the third example, information on the success of the first participant comes in 22 milliseconds, of the second participant — in 22 milliseconds. So, it is be a draw.
|
```python
s, v1, v2, t1, t2 = map(int,input().split())
c1 = v1 * s + t1 * 2
c2 = v2 * s + t2 * 2
if c1 < c2:
print('First')
if c1 > c2:
print('Second')
if c1 == c2:
print('Friendship')
```
| 3
|
|
383
|
A
|
Milking cows
|
PROGRAMMING
| 1,600
|
[
"data structures",
"greedy"
] | null | null |
Iahub helps his grandfather at the farm. Today he must milk the cows. There are *n* cows sitting in a row, numbered from 1 to *n* from left to right. Each cow is either facing to the left or facing to the right. When Iahub milks a cow, all the cows that see the current cow get scared and lose one unit of the quantity of milk that they can give. A cow facing left sees all the cows with lower indices than her index, and a cow facing right sees all the cows with higher indices than her index. A cow that got scared once can get scared again (and lose one more unit of milk). A cow that has been milked once cannot get scared and lose any more milk. You can assume that a cow never loses all the milk she can give (a cow gives an infinitely amount of milk).
Iahub can decide the order in which he milks the cows. But he must milk each cow exactly once. Iahub wants to lose as little milk as possible. Print the minimum amount of milk that is lost.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=200000). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, where *a**i* is 0 if the cow number *i* is facing left, and 1 if it is facing right.
|
Print a single integer, the minimum amount of lost milk.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"4\n0 0 1 0\n",
"5\n1 0 1 0 1\n"
] |
[
"1",
"3"
] |
In the first sample Iahub milks the cows in the following order: cow 3, cow 4, cow 2, cow 1. When he milks cow 3, cow 4 loses 1 unit of milk. After that, no more milk is lost.
| 500
|
[
{
"input": "4\n0 0 1 0",
"output": "1"
},
{
"input": "5\n1 0 1 0 1",
"output": "3"
},
{
"input": "50\n1 1 0 1 1 1 1 1 1 0 0 1 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 0 0 0 0 0 1 1 0 1 0 0 1 0",
"output": "416"
},
{
"input": "100\n1 1 0 0 1 1 1 1 0 1 1 1 1 1 1 1 0 0 0 0 0 0 1 1 0 1 0 0 0 0 1 1 1 1 0 0 1 0 0 1 1 0 1 1 1 1 1 1 0 0 0 0 1 1 0 0 0 0 0 1 1 0 1 0 0 1 0 0 1 0 1 0 0 0 0 1 0 1 1 0 1 1 1 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 0",
"output": "1446"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "0"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "4\n1 1 1 1",
"output": "0"
}
] | 1,672,004,270
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 186
| 18,124,800
|
from math import inf
from sys import stdin
input = stdin.readline
n = int(input())
a = [int(x) for x in input().split()]
sm = [0]
for x in a: sm.append(sm[-1]+x)
ans1 = ans2 = 0
for i in range(1, n+1):
if a[i-1] == 0:
ans1 += sm[i-1]
for i in range(1, n+1):
if a[i-1] == 1:
ans2 += n-i-(sm[n]-sm[i])
print(min(ans1, ans2))
|
Title: Milking cows
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub helps his grandfather at the farm. Today he must milk the cows. There are *n* cows sitting in a row, numbered from 1 to *n* from left to right. Each cow is either facing to the left or facing to the right. When Iahub milks a cow, all the cows that see the current cow get scared and lose one unit of the quantity of milk that they can give. A cow facing left sees all the cows with lower indices than her index, and a cow facing right sees all the cows with higher indices than her index. A cow that got scared once can get scared again (and lose one more unit of milk). A cow that has been milked once cannot get scared and lose any more milk. You can assume that a cow never loses all the milk she can give (a cow gives an infinitely amount of milk).
Iahub can decide the order in which he milks the cows. But he must milk each cow exactly once. Iahub wants to lose as little milk as possible. Print the minimum amount of milk that is lost.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=200000). The second line contains *n* integers *a*1, *a*2, ..., *a**n*, where *a**i* is 0 if the cow number *i* is facing left, and 1 if it is facing right.
Output Specification:
Print a single integer, the minimum amount of lost milk.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4\n0 0 1 0\n', '5\n1 0 1 0 1\n']
Demo Output:
['1', '3']
Note:
In the first sample Iahub milks the cows in the following order: cow 3, cow 4, cow 2, cow 1. When he milks cow 3, cow 4 loses 1 unit of milk. After that, no more milk is lost.
|
```python
from math import inf
from sys import stdin
input = stdin.readline
n = int(input())
a = [int(x) for x in input().split()]
sm = [0]
for x in a: sm.append(sm[-1]+x)
ans1 = ans2 = 0
for i in range(1, n+1):
if a[i-1] == 0:
ans1 += sm[i-1]
for i in range(1, n+1):
if a[i-1] == 1:
ans2 += n-i-(sm[n]-sm[i])
print(min(ans1, ans2))
```
| 3
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,610,612,975
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 77
| 614,400
|
#!/usr/bin/env python3
import fileinput
with fileinput.input() as fp:
b1 = fp.readline().strip()
b2 = fp.readline().strip()
b = int(b1,2) ^ int(b2,2)
print(format(b, f'0{len(b1)}b'))
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
#!/usr/bin/env python3
import fileinput
with fileinput.input() as fp:
b1 = fp.readline().strip()
b2 = fp.readline().strip()
b = int(b1,2) ^ int(b2,2)
print(format(b, f'0{len(b1)}b'))
```
| 3.979606
|
929
|
A
|
Прокат велосипедов
|
PROGRAMMING
| 1,400
|
[
"*special",
"greedy",
"implementation"
] | null | null |
Как известно, в теплую погоду многие жители крупных городов пользуются сервисами городского велопроката. Вот и Аркадий сегодня будет добираться от школы до дома, используя городские велосипеды.
Школа и дом находятся на одной прямой улице, кроме того, на той же улице есть *n* точек, где можно взять велосипед в прокат или сдать его. Первый велопрокат находится в точке *x*1 километров вдоль улицы, второй — в точке *x*2 и так далее, *n*-й велопрокат находится в точке *x**n*. Школа Аркадия находится в точке *x*1 (то есть там же, где и первый велопрокат), а дом — в точке *x**n* (то есть там же, где и *n*-й велопрокат). Известно, что *x**i*<=<<=*x**i*<=+<=1 для всех 1<=≤<=*i*<=<<=*n*.
Согласно правилам пользования велопроката, Аркадий может брать велосипед в прокат только на ограниченное время, после этого он должен обязательно вернуть его в одной из точек велопроката, однако, он тут же может взять новый велосипед, и отсчет времени пойдет заново. Аркадий может брать не более одного велосипеда в прокат одновременно. Если Аркадий решает взять велосипед в какой-то точке проката, то он сдаёт тот велосипед, на котором он до него доехал, берёт ровно один новый велосипед и продолжает на нём своё движение.
За отведенное время, независимо от выбранного велосипеда, Аркадий успевает проехать не больше *k* километров вдоль улицы.
Определите, сможет ли Аркадий доехать на велосипедах от школы до дома, и если да, то какое минимальное число раз ему необходимо будет взять велосипед в прокат, включая первый велосипед? Учтите, что Аркадий не намерен сегодня ходить пешком.
|
В первой строке следуют два целых числа *n* и *k* (2<=≤<=*n*<=≤<=1<=000, 1<=≤<=*k*<=≤<=100<=000) — количество велопрокатов и максимальное расстояние, которое Аркадий может проехать на одном велосипеде.
В следующей строке следует последовательность целых чисел *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=100<=000) — координаты точек, в которых находятся велопрокаты. Гарантируется, что координаты велопрокатов заданы в порядке возрастания.
|
Если Аркадий не сможет добраться от школы до дома только на велосипедах, выведите -1. В противном случае, выведите минимальное количество велосипедов, которые Аркадию нужно взять в точках проката.
|
[
"4 4\n3 6 8 10\n",
"2 9\n10 20\n",
"12 3\n4 6 7 9 10 11 13 15 17 18 20 21\n"
] |
[
"2\n",
"-1\n",
"6\n"
] |
В первом примере Аркадий должен взять первый велосипед в первом велопрокате и доехать на нём до второго велопроката. Во втором велопрокате он должен взять новый велосипед, на котором он сможет добраться до четвертого велопроката, рядом с которым и находится его дом. Поэтому Аркадию нужно всего два велосипеда, чтобы добраться от школы до дома.
Во втором примере всего два велопроката, расстояние между которыми 10. Но максимальное расстояние, которое можно проехать на одном велосипеде, равно 9. Поэтому Аркадий не сможет добраться от школы до дома только на велосипедах.
| 500
|
[
{
"input": "4 4\n3 6 8 10",
"output": "2"
},
{
"input": "2 9\n10 20",
"output": "-1"
},
{
"input": "12 3\n4 6 7 9 10 11 13 15 17 18 20 21",
"output": "6"
},
{
"input": "2 1\n11164 11165",
"output": "1"
},
{
"input": "3 7\n45823 45825 45829",
"output": "1"
},
{
"input": "2 100000\n0 100000",
"output": "1"
},
{
"input": "50 15001\n1269 1580 5431 5916 6642 14145 15760 19922 20589 22062 24138 33454 33505 35916 37012 42577 43140 49457 54720 55188 56205 56639 56870 57997 58379 59088 59297 61805 61861 63005 64013 68848 71182 71497 72715 73008 75616 76042 76614 80690 83089 85033 86408 92392 92763 93833 95085 95815 97152 99379",
"output": "8"
},
{
"input": "5 7\n6219 6222 6229 6231 6236",
"output": "3"
},
{
"input": "10 448\n78449 78573 78599 78742 78748 78759 78853 79091 79298 79324",
"output": "3"
},
{
"input": "20 19191\n11272 12386 14108 24663 24932 26547 29656 44677 45436 45654 48562 62367 71049 71238 78182 84042 88736 92026 96836 99343",
"output": "6"
},
{
"input": "2 100000\n1 100000",
"output": "1"
},
{
"input": "2 99999\n0 100000",
"output": "-1"
},
{
"input": "2 2\n1 3",
"output": "1"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "2 2\n1 4",
"output": "-1"
},
{
"input": "10 1\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
}
] | 1,520,059,819
| 54,919
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 6
| 62
| 5,632,000
|
import math
n, k = [int(x) for x in input().split()] #Количество точек, максимальное расстояние, которое мальчик может проехать
x = [int(x) for x in input().split()] #Точки
deltas = [] # Здесь будут расстояния
i = 0
while i<len(x)-1: #Вычисляем расстояния между двумя ближайшими точками
deltas.append(x[i+1]-x[i])
i+=1
ability = not any(i>k for i in deltas) # Проверяем, нет ли расстояний больше, чем мальчик может проехать
if ability: # Если способен проехать все остановки
s = x[-1] - x[0] # расстояние
print(math.ceil(s/k))
else:
print(-1)
|
Title: Прокат велосипедов
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Как известно, в теплую погоду многие жители крупных городов пользуются сервисами городского велопроката. Вот и Аркадий сегодня будет добираться от школы до дома, используя городские велосипеды.
Школа и дом находятся на одной прямой улице, кроме того, на той же улице есть *n* точек, где можно взять велосипед в прокат или сдать его. Первый велопрокат находится в точке *x*1 километров вдоль улицы, второй — в точке *x*2 и так далее, *n*-й велопрокат находится в точке *x**n*. Школа Аркадия находится в точке *x*1 (то есть там же, где и первый велопрокат), а дом — в точке *x**n* (то есть там же, где и *n*-й велопрокат). Известно, что *x**i*<=<<=*x**i*<=+<=1 для всех 1<=≤<=*i*<=<<=*n*.
Согласно правилам пользования велопроката, Аркадий может брать велосипед в прокат только на ограниченное время, после этого он должен обязательно вернуть его в одной из точек велопроката, однако, он тут же может взять новый велосипед, и отсчет времени пойдет заново. Аркадий может брать не более одного велосипеда в прокат одновременно. Если Аркадий решает взять велосипед в какой-то точке проката, то он сдаёт тот велосипед, на котором он до него доехал, берёт ровно один новый велосипед и продолжает на нём своё движение.
За отведенное время, независимо от выбранного велосипеда, Аркадий успевает проехать не больше *k* километров вдоль улицы.
Определите, сможет ли Аркадий доехать на велосипедах от школы до дома, и если да, то какое минимальное число раз ему необходимо будет взять велосипед в прокат, включая первый велосипед? Учтите, что Аркадий не намерен сегодня ходить пешком.
Input Specification:
В первой строке следуют два целых числа *n* и *k* (2<=≤<=*n*<=≤<=1<=000, 1<=≤<=*k*<=≤<=100<=000) — количество велопрокатов и максимальное расстояние, которое Аркадий может проехать на одном велосипеде.
В следующей строке следует последовательность целых чисел *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x*1<=<<=*x*2<=<<=...<=<<=*x**n*<=≤<=100<=000) — координаты точек, в которых находятся велопрокаты. Гарантируется, что координаты велопрокатов заданы в порядке возрастания.
Output Specification:
Если Аркадий не сможет добраться от школы до дома только на велосипедах, выведите -1. В противном случае, выведите минимальное количество велосипедов, которые Аркадию нужно взять в точках проката.
Demo Input:
['4 4\n3 6 8 10\n', '2 9\n10 20\n', '12 3\n4 6 7 9 10 11 13 15 17 18 20 21\n']
Demo Output:
['2\n', '-1\n', '6\n']
Note:
В первом примере Аркадий должен взять первый велосипед в первом велопрокате и доехать на нём до второго велопроката. Во втором велопрокате он должен взять новый велосипед, на котором он сможет добраться до четвертого велопроката, рядом с которым и находится его дом. Поэтому Аркадию нужно всего два велосипеда, чтобы добраться от школы до дома.
Во втором примере всего два велопроката, расстояние между которыми 10. Но максимальное расстояние, которое можно проехать на одном велосипеде, равно 9. Поэтому Аркадий не сможет добраться от школы до дома только на велосипедах.
|
```python
import math
n, k = [int(x) for x in input().split()] #Количество точек, максимальное расстояние, которое мальчик может проехать
x = [int(x) for x in input().split()] #Точки
deltas = [] # Здесь будут расстояния
i = 0
while i<len(x)-1: #Вычисляем расстояния между двумя ближайшими точками
deltas.append(x[i+1]-x[i])
i+=1
ability = not any(i>k for i in deltas) # Проверяем, нет ли расстояний больше, чем мальчик может проехать
if ability: # Если способен проехать все остановки
s = x[-1] - x[0] # расстояние
print(math.ceil(s/k))
else:
print(-1)
```
| 0
|
|
593
|
A
|
2Char
|
PROGRAMMING
| 1,200
|
[
"brute force",
"implementation"
] | null | null |
Andrew often reads articles in his favorite magazine 2Char. The main feature of these articles is that each of them uses at most two distinct letters. Andrew decided to send an article to the magazine, but as he hasn't written any article, he just decided to take a random one from magazine 26Char. However, before sending it to the magazine 2Char, he needs to adapt the text to the format of the journal. To do so, he removes some words from the chosen article, in such a way that the remaining text can be written using no more than two distinct letters.
Since the payment depends from the number of non-space characters in the article, Andrew wants to keep the words with the maximum total length.
|
The first line of the input contains number *n* (1<=≤<=*n*<=≤<=100) — the number of words in the article chosen by Andrew. Following are *n* lines, each of them contains one word. All the words consist only of small English letters and their total length doesn't exceed 1000. The words are not guaranteed to be distinct, in this case you are allowed to use a word in the article as many times as it appears in the input.
|
Print a single integer — the maximum possible total length of words in Andrew's article.
|
[
"4\nabb\ncacc\naaa\nbbb\n",
"5\na\na\nbcbcb\ncdecdecdecdecdecde\naaaa\n"
] |
[
"9",
"6"
] |
In the first sample the optimal way to choose words is {'abb', 'aaa', 'bbb'}.
In the second sample the word 'cdecdecdecdecdecde' consists of three distinct letters, and thus cannot be used in the article. The optimal answer is {'a', 'a', 'aaaa'}.
| 250
|
[
{
"input": "4\nabb\ncacc\naaa\nbbb",
"output": "9"
},
{
"input": "5\na\na\nbcbcb\ncdecdecdecdecdecde\naaaa",
"output": "6"
},
{
"input": "1\na",
"output": "1"
},
{
"input": "2\nz\nz",
"output": "2"
},
{
"input": "5\nabcde\nfghij\nklmno\npqrst\nuvwxy",
"output": "0"
},
{
"input": "6\ngggggg\ngggggg\ngggggg\ngggggg\ngggggg\ngggggg",
"output": "36"
},
{
"input": "6\naaaaaa\naaaaaa\nbbbbbb\nbbbbbb\naaabbb\nababab",
"output": "36"
},
{
"input": "1\nabc",
"output": "0"
},
{
"input": "2\nabc\nbca",
"output": "0"
},
{
"input": "3\nab\nba\nzzz",
"output": "4"
},
{
"input": "3\nab\nba\nzzzzz",
"output": "5"
},
{
"input": "5\nzzz\nzzzz\nzz\nz\naaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "37"
},
{
"input": "26\nq\nw\ne\nr\nt\ny\nu\ni\no\np\na\ns\nd\nf\ng\nh\nj\nk\nl\nz\nx\nc\nv\nb\nn\nm",
"output": "2"
},
{
"input": "5\nzzz\nzzzz\nzz\nz\naaaaaaaaaaaaaaaaaaaaaaaaaaaf",
"output": "28"
},
{
"input": "7\npavel\nerika\nalexxxxxxx\ngracio\nzhenya\nsudarev\nchelyaba",
"output": "0"
},
{
"input": "31\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml\nfml",
"output": "0"
},
{
"input": "5\nzloyfreid\ngraciocode\nschooldiary\nkazakov\nevgesha",
"output": "0"
},
{
"input": "4\nurkop\nvisualac\ngnutl\nwtf",
"output": "0"
},
{
"input": "3\naa\nb\nccc",
"output": "5"
},
{
"input": "3\na\nbd\ncaaaaaaa",
"output": "9"
},
{
"input": "4\naa\nax\nay\nxxxx",
"output": "8"
},
{
"input": "5\nc\nbb\ne\ndd\nf",
"output": "4"
},
{
"input": "2\naaaaa\naaaaa",
"output": "10"
}
] | 1,446,655,936
| 436
|
Python 3
|
OK
|
TESTS
| 49
| 77
| 0
|
# import sys
# sys.stdin = open("cf593a.in")
alphabet = 'abcdefghijklmnopqrstuvwxyz'
n = int(input())
words = [input().strip() for _ in range(n)]
words = [(word, set(word)) for word in words]
words = [(word, s) for word, s in words if len(s) <= 2]
best = 0
for c1 in alphabet:
for c2 in alphabet:
shere = set([c1, c2])
best = max(best, sum(len(word) for word, s in words if not (s - shere)))
print(best)
|
Title: 2Char
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andrew often reads articles in his favorite magazine 2Char. The main feature of these articles is that each of them uses at most two distinct letters. Andrew decided to send an article to the magazine, but as he hasn't written any article, he just decided to take a random one from magazine 26Char. However, before sending it to the magazine 2Char, he needs to adapt the text to the format of the journal. To do so, he removes some words from the chosen article, in such a way that the remaining text can be written using no more than two distinct letters.
Since the payment depends from the number of non-space characters in the article, Andrew wants to keep the words with the maximum total length.
Input Specification:
The first line of the input contains number *n* (1<=≤<=*n*<=≤<=100) — the number of words in the article chosen by Andrew. Following are *n* lines, each of them contains one word. All the words consist only of small English letters and their total length doesn't exceed 1000. The words are not guaranteed to be distinct, in this case you are allowed to use a word in the article as many times as it appears in the input.
Output Specification:
Print a single integer — the maximum possible total length of words in Andrew's article.
Demo Input:
['4\nabb\ncacc\naaa\nbbb\n', '5\na\na\nbcbcb\ncdecdecdecdecdecde\naaaa\n']
Demo Output:
['9', '6']
Note:
In the first sample the optimal way to choose words is {'abb', 'aaa', 'bbb'}.
In the second sample the word 'cdecdecdecdecdecde' consists of three distinct letters, and thus cannot be used in the article. The optimal answer is {'a', 'a', 'aaaa'}.
|
```python
# import sys
# sys.stdin = open("cf593a.in")
alphabet = 'abcdefghijklmnopqrstuvwxyz'
n = int(input())
words = [input().strip() for _ in range(n)]
words = [(word, set(word)) for word in words]
words = [(word, s) for word, s in words if len(s) <= 2]
best = 0
for c1 in alphabet:
for c2 in alphabet:
shere = set([c1, c2])
best = max(best, sum(len(word) for word, s in words if not (s - shere)))
print(best)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,690,836,251
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 30
| 216
| 102,400
|
import bisect
import math
from collections import Counter
M = (10**9)+7
#t = int(input())
t = 1
for _ in range(t):
n = input()
#n, k = map(int, input().split())
#l = list(map(int, input().split()))
ans = 0
for i in range(len(n)):
if n[i]==n[i].lower():
ans+=1
if ans>=len(n)-ans:
print(n.lower())
else:
print(n.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
import bisect
import math
from collections import Counter
M = (10**9)+7
#t = int(input())
t = 1
for _ in range(t):
n = input()
#n, k = map(int, input().split())
#l = list(map(int, input().split()))
ans = 0
for i in range(len(n)):
if n[i]==n[i].lower():
ans+=1
if ans>=len(n)-ans:
print(n.lower())
else:
print(n.upper())
```
| 3.945809
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,594,045,832
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 154
| 6,656,000
|
a=input()
u,l=0,0
for i in a:
if i.isupper():
u=u+1
if i.islower():
l=l+1
if u>1:
print(a.upper())
elif l>u:
print(a.lower())
elif l==u:
print(a.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
a=input()
u,l=0,0
for i in a:
if i.isupper():
u=u+1
if i.islower():
l=l+1
if u>1:
print(a.upper())
elif l>u:
print(a.lower())
elif l==u:
print(a.lower())
```
| 0
|
551
|
A
|
GukiZ and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
|
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
|
[
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
] |
[
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
] |
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
| 500
|
[
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
] | 1,601,785,349
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 36
| 155
| 2,764,800
|
#https://codeforces.com/problemset/problem/551/A
n=int(input())
l=list(map(int,input().split()))
s=sorted(l,reverse=True)
for i in range(n):
l[i]=s.index(l[i])+1
print(*l)
|
Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
|
```python
#https://codeforces.com/problemset/problem/551/A
n=int(input())
l=list(map(int,input().split()))
s=sorted(l,reverse=True)
for i in range(n):
l[i]=s.index(l[i])+1
print(*l)
```
| 3
|
|
474
|
B
|
Worms
|
PROGRAMMING
| 1,200
|
[
"binary search",
"implementation"
] | null | null |
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
|
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
|
[
"5\n2 7 3 4 9\n3\n1 25 11\n"
] |
[
"1\n5\n3\n"
] |
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
| 1,000
|
[
{
"input": "5\n2 7 3 4 9\n3\n1 25 11",
"output": "1\n5\n3"
}
] | 1,689,994,004
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 30
| 204,800
|
c=int(input())
b=list(map(int,input().split()))
e=int(input())
a=list(map(int,input().split()))
for i in range(1,len(b)):
b[i]+=b[i-1]
for i in range(len(a)):
l=0
h=len(b)-1
while l<=h:
mid =(l+h)//2
if b[mid]>a[i]:
h = mid - 1
elif b[mid]<a[i]:
l = mid + 1
else:
break
print(l+1)
|
Title: Worms
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is lunch time for Mole. His friend, Marmot, prepared him a nice game for lunch.
Marmot brought Mole *n* ordered piles of worms such that *i*-th pile contains *a**i* worms. He labeled all these worms with consecutive integers: worms in first pile are labeled with numbers 1 to *a*1, worms in second pile are labeled with numbers *a*1<=+<=1 to *a*1<=+<=*a*2 and so on. See the example for a better understanding.
Mole can't eat all the worms (Marmot brought a lot) and, as we all know, Mole is blind, so Marmot tells him the labels of the best juicy worms. Marmot will only give Mole a worm if Mole says correctly in which pile this worm is contained.
Poor Mole asks for your help. For all juicy worms said by Marmot, tell Mole the correct answers.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), the number of piles.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=103, *a*1<=+<=*a*2<=+<=...<=+<=*a**n*<=≤<=106), where *a**i* is the number of worms in the *i*-th pile.
The third line contains single integer *m* (1<=≤<=*m*<=≤<=105), the number of juicy worms said by Marmot.
The fourth line contains *m* integers *q*1,<=*q*2,<=...,<=*q**m* (1<=≤<=*q**i*<=≤<=*a*1<=+<=*a*2<=+<=...<=+<=*a**n*), the labels of the juicy worms.
Output Specification:
Print *m* lines to the standard output. The *i*-th line should contain an integer, representing the number of the pile where the worm labeled with the number *q**i* is.
Demo Input:
['5\n2 7 3 4 9\n3\n1 25 11\n']
Demo Output:
['1\n5\n3\n']
Note:
For the sample input:
- The worms with labels from [1, 2] are in the first pile. - The worms with labels from [3, 9] are in the second pile. - The worms with labels from [10, 12] are in the third pile. - The worms with labels from [13, 16] are in the fourth pile. - The worms with labels from [17, 25] are in the fifth pile.
|
```python
c=int(input())
b=list(map(int,input().split()))
e=int(input())
a=list(map(int,input().split()))
for i in range(1,len(b)):
b[i]+=b[i-1]
for i in range(len(a)):
l=0
h=len(b)-1
while l<=h:
mid =(l+h)//2
if b[mid]>a[i]:
h = mid - 1
elif b[mid]<a[i]:
l = mid + 1
else:
break
print(l+1)
```
| 0
|
|
702
|
A
|
Maximum Increase
|
PROGRAMMING
| 800
|
[
"dp",
"greedy",
"implementation"
] | null | null |
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
|
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
|
Print the maximum length of an increasing subarray of the given array.
|
[
"5\n1 7 2 11 15\n",
"6\n100 100 100 100 100 100\n",
"3\n1 2 3\n"
] |
[
"3\n",
"1\n",
"3\n"
] |
none
| 0
|
[
{
"input": "5\n1 7 2 11 15",
"output": "3"
},
{
"input": "6\n100 100 100 100 100 100",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n1 2 3 3 4",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "2"
},
{
"input": "11\n1 2 3 1 2 3 2 1 2 3 4",
"output": "4"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "9"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n3 2 1",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "1\n1234394",
"output": "1"
}
] | 1,697,283,764
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 108
| 12,697,600
|
n = int(input())
array = [int(x) for x in input().split()]
dp = [1]*(n+1)
dp[0] = 0
for i in range(0,n-1):
if array[i+1] > array[i]:
dp[i+2] = dp[i+1] +1
print(max(dp))
|
Title: Maximum Increase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
Input Specification:
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the maximum length of an increasing subarray of the given array.
Demo Input:
['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n']
Demo Output:
['3\n', '1\n', '3\n']
Note:
none
|
```python
n = int(input())
array = [int(x) for x in input().split()]
dp = [1]*(n+1)
dp[0] = 0
for i in range(0,n-1):
if array[i+1] > array[i]:
dp[i+2] = dp[i+1] +1
print(max(dp))
```
| 3
|
|
92
|
A
|
Chips
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] |
A. Chips
|
2
|
256
|
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
|
Print the number of chips the presenter ended up with.
|
[
"4 11\n",
"17 107\n",
"3 8\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
| 500
|
[
{
"input": "4 11",
"output": "0"
},
{
"input": "17 107",
"output": "2"
},
{
"input": "3 8",
"output": "1"
},
{
"input": "46 7262",
"output": "35"
},
{
"input": "32 6864",
"output": "0"
},
{
"input": "36 6218",
"output": "14"
},
{
"input": "25 9712",
"output": "11"
},
{
"input": "9 7601",
"output": "5"
},
{
"input": "1 9058",
"output": "0"
},
{
"input": "29 7772",
"output": "26"
},
{
"input": "45 9465",
"output": "14"
},
{
"input": "46 866",
"output": "5"
},
{
"input": "29 1241",
"output": "20"
},
{
"input": "17 4248",
"output": "12"
},
{
"input": "20 8082",
"output": "11"
},
{
"input": "50 9555",
"output": "0"
},
{
"input": "4 7455",
"output": "2"
},
{
"input": "36 880",
"output": "4"
},
{
"input": "24 7440",
"output": "9"
},
{
"input": "44 7888",
"output": "12"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "50 10000",
"output": "40"
},
{
"input": "1 10000",
"output": "0"
},
{
"input": "50 1",
"output": "0"
},
{
"input": "50 50",
"output": "5"
}
] | 1,630,260,033
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 122
| 6,963,200
|
n,m=map(int,input().split())
sumi=0
if(m>(n*(n+1)/2)):
rem=m-(n*(n+1)//2)
for i in range(1,rem+1):
if(sumi+i<=rem):
sumi+=i
else:
break
print(rem-sumi)
else:
for i in range(1,m+1):
if(sumi+i<=m):
sumi+=i
else:
break
print(m-sumi)
|
Title: Chips
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There are *n* walruses sitting in a circle. All of them are numbered in the clockwise order: the walrus number 2 sits to the left of the walrus number 1, the walrus number 3 sits to the left of the walrus number 2, ..., the walrus number 1 sits to the left of the walrus number *n*.
The presenter has *m* chips. The presenter stands in the middle of the circle and starts giving the chips to the walruses starting from walrus number 1 and moving clockwise. The walrus number *i* gets *i* chips. If the presenter can't give the current walrus the required number of chips, then the presenter takes the remaining chips and the process ends. Determine by the given *n* and *m* how many chips the presenter will get in the end.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=50, 1<=≤<=*m*<=≤<=104) — the number of walruses and the number of chips correspondingly.
Output Specification:
Print the number of chips the presenter ended up with.
Demo Input:
['4 11\n', '17 107\n', '3 8\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the first sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, four chips to the walrus number 4, then again one chip to the walrus number 1. After that the presenter runs out of chips. He can't give anything to the walrus number 2 and the process finishes.
In the third sample the presenter gives one chip to the walrus number 1, two chips to the walrus number 2, three chips to the walrus number 3, then again one chip to the walrus number 1. The presenter has one chip left and he can't give two chips to the walrus number 2, that's why the presenter takes the last chip.
|
```python
n,m=map(int,input().split())
sumi=0
if(m>(n*(n+1)/2)):
rem=m-(n*(n+1)//2)
for i in range(1,rem+1):
if(sumi+i<=rem):
sumi+=i
else:
break
print(rem-sumi)
else:
for i in range(1,m+1):
if(sumi+i<=m):
sumi+=i
else:
break
print(m-sumi)
```
| 0
|
45
|
C
|
Dancing Lessons
|
PROGRAMMING
| 1,900
|
[
"data structures"
] |
C. Dancing Lessons
|
2
|
256
|
There are *n* people taking dancing lessons. Every person is characterized by his/her dancing skill *a**i*. At the beginning of the lesson they line up from left to right. While there is at least one couple of a boy and a girl in the line, the following process is repeated: the boy and girl who stand next to each other, having the minimal difference in dancing skills start to dance. If there are several such couples, the one first from the left starts to dance. After a couple leaves to dance, the line closes again, i.e. as a result the line is always continuous. The difference in dancing skills is understood as the absolute value of difference of *a**i* variable. Your task is to find out what pairs and in what order will start dancing.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of people. The next line contains *n* symbols B or G without spaces. B stands for a boy, G stands for a girl. The third line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=107) — the dancing skill. People are specified from left to right in the order in which they lined up.
|
Print the resulting number of couples *k*. Then print *k* lines containing two numerals each — the numbers of people forming the couple. The people are numbered with integers from 1 to *n* from left to right. When a couple leaves to dance you shouldn't renumber the people. The numbers in one couple should be sorted in the increasing order. Print the couples in the order in which they leave to dance.
|
[
"4\nBGBG\n4 2 4 3\n",
"4\nBBGG\n4 6 1 5\n",
"4\nBGBB\n1 1 2 3\n"
] |
[
"2\n3 4\n1 2\n",
"2\n2 3\n1 4\n",
"1\n1 2\n"
] |
none
| 0
|
[
{
"input": "4\nBGBG\n4 2 4 3",
"output": "2\n3 4\n1 2"
},
{
"input": "4\nBBGG\n4 6 1 5",
"output": "2\n2 3\n1 4"
},
{
"input": "4\nBGBB\n1 1 2 3",
"output": "1\n1 2"
},
{
"input": "1\nB\n490297",
"output": "0"
},
{
"input": "2\nBB\n2518190 6313112",
"output": "0"
},
{
"input": "3\nBBB\n3146681 8599398 1571560",
"output": "0"
},
{
"input": "10\nGBBBBGBBGG\n9448959 6234076 8008159 4440374 4736443 255932 6568554 4544108 54187 1105310",
"output": "4\n1 2\n5 6\n8 9\n7 10"
},
{
"input": "10\nBGGBBGBGBG\n9892816 3514007 5425956 5241945 9171176 3351177 2772494 2891569 1510552 8471969",
"output": "5\n7 8\n3 4\n6 9\n5 10\n1 2"
},
{
"input": "10\nGGGGBGGGBB\n2853026 3310290 2843753 8559868 1089557 6446421 8976433 3755381 2966918 3322276",
"output": "3\n8 9\n5 6\n7 10"
},
{
"input": "10\nGBBGBBBGBB\n9251505 1388373 4869655 8551146 5931052 358636 416134 8756343 8254852 661072",
"output": "3\n8 9\n4 5\n1 2"
}
] | 1,462,286,131
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 20
| 2,000
| 34,713,600
|
import queue
q = queue.PriorityQueue()
cnt = 0
n = int(input())
sex = input()
a = list(map(int, input().split()))
l = [i-1 for i in range(n)]
r = [i+1 for i in range(n)]
for i in range(n-1):
if sex[i] != sex[i+1]:
q.put((abs(a[i] - a[i+1]), i, i+1))
cnt += 1
ans = []
while True:
if cnt == 0: break
t, i, j = q.get()
cnt -= 1
if r[i] == -1 or r[j] == -1:
continue
ans.append('%d %d' % (i+1, j+1))
u, v = l[i], r[j]
r[i] = r[j] = -1
if u >= 0:
r[u] = v
if v < n:
l[v] = u
if u >= 0 and v < n and sex[u] != sex[v]:
q.put((abs(a[u] - a[v]), u, v))
cnt += 1
print(str(len(ans)) + '\n' + '\n'.join(ans))
|
Title: Dancing Lessons
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There are *n* people taking dancing lessons. Every person is characterized by his/her dancing skill *a**i*. At the beginning of the lesson they line up from left to right. While there is at least one couple of a boy and a girl in the line, the following process is repeated: the boy and girl who stand next to each other, having the minimal difference in dancing skills start to dance. If there are several such couples, the one first from the left starts to dance. After a couple leaves to dance, the line closes again, i.e. as a result the line is always continuous. The difference in dancing skills is understood as the absolute value of difference of *a**i* variable. Your task is to find out what pairs and in what order will start dancing.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of people. The next line contains *n* symbols B or G without spaces. B stands for a boy, G stands for a girl. The third line contains *n* space-separated integers *a**i* (1<=≤<=*a**i*<=≤<=107) — the dancing skill. People are specified from left to right in the order in which they lined up.
Output Specification:
Print the resulting number of couples *k*. Then print *k* lines containing two numerals each — the numbers of people forming the couple. The people are numbered with integers from 1 to *n* from left to right. When a couple leaves to dance you shouldn't renumber the people. The numbers in one couple should be sorted in the increasing order. Print the couples in the order in which they leave to dance.
Demo Input:
['4\nBGBG\n4 2 4 3\n', '4\nBBGG\n4 6 1 5\n', '4\nBGBB\n1 1 2 3\n']
Demo Output:
['2\n3 4\n1 2\n', '2\n2 3\n1 4\n', '1\n1 2\n']
Note:
none
|
```python
import queue
q = queue.PriorityQueue()
cnt = 0
n = int(input())
sex = input()
a = list(map(int, input().split()))
l = [i-1 for i in range(n)]
r = [i+1 for i in range(n)]
for i in range(n-1):
if sex[i] != sex[i+1]:
q.put((abs(a[i] - a[i+1]), i, i+1))
cnt += 1
ans = []
while True:
if cnt == 0: break
t, i, j = q.get()
cnt -= 1
if r[i] == -1 or r[j] == -1:
continue
ans.append('%d %d' % (i+1, j+1))
u, v = l[i], r[j]
r[i] = r[j] = -1
if u >= 0:
r[u] = v
if v < n:
l[v] = u
if u >= 0 and v < n and sex[u] != sex[v]:
q.put((abs(a[u] - a[v]), u, v))
cnt += 1
print(str(len(ans)) + '\n' + '\n'.join(ans))
```
| 0
|
281
|
A
|
Word Capitalization
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500
|
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,696,428,276
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
m=str(input())
staring=""
for i in range(len(m)):
if i==0:
staring+=m[i].upper()
else:
staring+=m[i]
print(staring)
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
m=str(input())
staring=""
for i in range(len(m)):
if i==0:
staring+=m[i].upper()
else:
staring+=m[i]
print(staring)
```
| 3
|
|
710
|
A
|
King Moves
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
|
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
|
Print the only integer *x* — the number of moves permitted for the king.
|
[
"e4\n"
] |
[
"8\n"
] |
none
| 0
|
[
{
"input": "e4",
"output": "8"
},
{
"input": "a1",
"output": "3"
},
{
"input": "h8",
"output": "3"
},
{
"input": "a4",
"output": "5"
},
{
"input": "g7",
"output": "8"
},
{
"input": "e1",
"output": "5"
},
{
"input": "b2",
"output": "8"
},
{
"input": "c7",
"output": "8"
},
{
"input": "h6",
"output": "5"
},
{
"input": "c8",
"output": "5"
},
{
"input": "h2",
"output": "5"
},
{
"input": "h5",
"output": "5"
},
{
"input": "a8",
"output": "3"
},
{
"input": "f8",
"output": "5"
},
{
"input": "h1",
"output": "3"
},
{
"input": "f2",
"output": "8"
},
{
"input": "e8",
"output": "5"
},
{
"input": "h3",
"output": "5"
},
{
"input": "b8",
"output": "5"
},
{
"input": "g8",
"output": "5"
},
{
"input": "d8",
"output": "5"
},
{
"input": "h4",
"output": "5"
},
{
"input": "b1",
"output": "5"
},
{
"input": "a2",
"output": "5"
}
] | 1,517,136,594
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 24
| 61
| 5,632,000
|
s = input()
c = s[0]
r = s[1]
total = 8
if c in 'ah' and r in '18':
total -= 5
elif c in 'ah':
total -=3
elif r in '18':
total -=3
print (total)
|
Title: King Moves
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
Input Specification:
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
Output Specification:
Print the only integer *x* — the number of moves permitted for the king.
Demo Input:
['e4\n']
Demo Output:
['8\n']
Note:
none
|
```python
s = input()
c = s[0]
r = s[1]
total = 8
if c in 'ah' and r in '18':
total -= 5
elif c in 'ah':
total -=3
elif r in '18':
total -=3
print (total)
```
| 3
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.