contestId int64 0 1.01k | index stringclasses 57 values | name stringlengths 2 58 | type stringclasses 2 values | rating int64 0 3.5k | tags listlengths 0 11 | title stringclasses 522 values | time-limit stringclasses 8 values | memory-limit stringclasses 8 values | problem-description stringlengths 0 7.15k | input-specification stringlengths 0 2.05k | output-specification stringlengths 0 1.5k | demo-input listlengths 0 7 | demo-output listlengths 0 7 | note stringlengths 0 5.24k | points float64 0 425k | test_cases listlengths 0 402 | creationTimeSeconds int64 1.37B 1.7B | relativeTimeSeconds int64 8 2.15B | programmingLanguage stringclasses 3 values | verdict stringclasses 14 values | testset stringclasses 12 values | passedTestCount int64 0 1k | timeConsumedMillis int64 0 15k | memoryConsumedBytes int64 0 805M | code stringlengths 3 65.5k | prompt stringlengths 262 8.2k | response stringlengths 17 65.5k | score float64 -1 3.99 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
] | A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] | [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] | none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,678,497,538 | 2,147,483,647 | Python 3 | OK | TESTS | 102 | 46 | 0 | n = input()
m = input()
x=''
for i in range(len(n)):
if n[i]!=m[i]:
x=x+'1'
else:
x=x+'0'
print(x) | Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
n = input()
m = input()
x=''
for i in range(len(n)):
if n[i]!=m[i]:
x=x+'1'
else:
x=x+'0'
print(x)
``` | 3.9885 |
834 | B | The Festive Evening | PROGRAMMING | 1,100 | [
"data structures",
"implementation"
] | null | null | It's the end of July – the time when a festive evening is held at Jelly Castle! Guests from all over the kingdom gather here to discuss new trends in the world of confectionery. Yet some of the things discussed here are not supposed to be disclosed to the general public: the information can cause discord in the kingdom of Sweetland in case it turns out to reach the wrong hands. So it's a necessity to not let any uninvited guests in.
There are 26 entrances in Jelly Castle, enumerated with uppercase English letters from A to Z. Because of security measures, each guest is known to be assigned an entrance he should enter the castle through. The door of each entrance is opened right before the first guest's arrival and closed right after the arrival of the last guest that should enter the castle through this entrance. No two guests can enter the castle simultaneously.
For an entrance to be protected from possible intrusion, a candy guard should be assigned to it. There are *k* such guards in the castle, so if there are more than *k* opened doors, one of them is going to be left unguarded! Notice that a guard can't leave his post until the door he is assigned to is closed.
Slastyona had a suspicion that there could be uninvited guests at the evening. She knows the order in which the invited guests entered the castle, and wants you to help her check whether there was a moment when more than *k* doors were opened. | Two integers are given in the first string: the number of guests *n* and the number of guards *k* (1<=≤<=*n*<=≤<=106, 1<=≤<=*k*<=≤<=26).
In the second string, *n* uppercase English letters *s*1*s*2... *s**n* are given, where *s**i* is the entrance used by the *i*-th guest. | Output «YES» if at least one door was unguarded during some time, and «NO» otherwise.
You can output each letter in arbitrary case (upper or lower). | [
"5 1\nAABBB\n",
"5 1\nABABB\n"
] | [
"NO\n",
"YES\n"
] | In the first sample case, the door A is opened right before the first guest's arrival and closed when the second guest enters the castle. The door B is opened right before the arrival of the third guest, and closed after the fifth one arrives. One guard can handle both doors, as the first one is closed before the second one is opened.
In the second sample case, the door B is opened before the second guest's arrival, but the only guard can't leave the door A unattended, as there is still one more guest that should enter the castle through this door. | 1,000 | [
{
"input": "5 1\nAABBB",
"output": "NO"
},
{
"input": "5 1\nABABB",
"output": "YES"
},
{
"input": "26 1\nABCDEFGHIJKLMNOPQRSTUVWXYZ",
"output": "NO"
},
{
"input": "27 1\nABCDEFGHIJKLMNOPQRSTUVWXYZA",
"output": "YES"
},
{
"input": "5 2\nABACA",
"output": "NO"
},
{
"input": "6 2\nABCABC",
"output": "YES"
},
{
"input": "8 3\nABCBCDCA",
"output": "NO"
},
{
"input": "73 2\nDEBECECBBADAADEAABEAEEEAEBEAEBCDDBABBAEBACCBEEBBAEADEECACEDEEDABACDCDBBBD",
"output": "YES"
},
{
"input": "44 15\nHGJIFCGGCDGIJDHBIBGAEABCIABIGBDEADBBBAGDFDHA",
"output": "NO"
},
{
"input": "41 19\nTMEYYIIELFDCMBDKWWKYNRNDUPRONYROXQCLVQALP",
"output": "NO"
},
{
"input": "377 3\nEADADBBBBDEAABBAEBABACDBDBBCACAADBEAEACDEAABACADEEDEACACDADABBBBDDEECBDABACACBAECBADAEBDEEBDBCDAEADBCDDACACDCCEEDBCCBBCEDBECBABCDDBBDEADEDAEACDECECBEBACBCCDCDBDAECDECADBCBEDBBDAAEBCAAECCDCCDBDDEBADEEBDCAEABBDEDBBDDEAECCBDDCDEACDAECCBDDABABEAEDCDEDBAECBDEACEBCECEACDCBABCBAAEAADACADBBBBABEADBCADEBCBECCABBDDDEEBCDEBADEBDAAABBEABADEDEAEABCEEBEEDEAEBEABCEDDBACBCCADEBAAAAAEABABBCE",
"output": "YES"
},
{
"input": "433 3\nFZDDHMJGBZCHFUXBBPIEBBEFDWOMXXEPOMDGSMPIUZOMRZQNSJAVNATGIWPDFISKFQXJNVFXPHOZDAEZFDAHDXXQKZMGNSGKQNWGNGJGJZVVITKNFLVCPMZSDMCHBTVAWYVZLIXXIADXNYILEYNIQHKMOGMVOCWGHCWIYMPEPADSJAAKEGTUSEDWAHMNYJDIHBKHVUHLYGNGZDBULRXLSAJHPCMNWCEAAPYMHDTYWPADOTJTXTXUKLCHWKUSZRHEKQEFPVJEJJHRWCKYOIWALRTIBUMNOCRXLSIKQCJVQXEPGOHRUDJDKMUUUDORURWXJNVRVMNOUNRFKSVMTMZGOIJLXEPAMVGESOADYIGZXRBJDIWKNOWTCSROAQTBECHTOZVSQUOOJRZIBAUHMKAXDCIMDZJFMABGRNTGPUJAUNFPFWCJG",
"output": "YES"
},
{
"input": "5 2\nABCAB",
"output": "YES"
},
{
"input": "5 1\nAZAZA",
"output": "YES"
},
{
"input": "7 2\nABCDBCD",
"output": "YES"
},
{
"input": "3 26\nAAB",
"output": "NO"
}
] | 1,501,428,656 | 3,356 | Python 3 | WRONG_ANSWER | PRETESTS | 2 | 62 | 4,608,000 | n,k=map(int,input().split())
s=input()
guard=1
exc=False
for i in range(1,n):
if guard > k :
exc=True
break
if s[i]==s[i-1]:
if s[i] not in s[i+1:]:
guard=guard-1
continue
else:
guard=guard+1
if guard > k :
exc=True
break
if s[i] not in s[i+1:]:
guard=guard-1
if exc:
print("YES")
else :
print("NO") | Title: The Festive Evening
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's the end of July – the time when a festive evening is held at Jelly Castle! Guests from all over the kingdom gather here to discuss new trends in the world of confectionery. Yet some of the things discussed here are not supposed to be disclosed to the general public: the information can cause discord in the kingdom of Sweetland in case it turns out to reach the wrong hands. So it's a necessity to not let any uninvited guests in.
There are 26 entrances in Jelly Castle, enumerated with uppercase English letters from A to Z. Because of security measures, each guest is known to be assigned an entrance he should enter the castle through. The door of each entrance is opened right before the first guest's arrival and closed right after the arrival of the last guest that should enter the castle through this entrance. No two guests can enter the castle simultaneously.
For an entrance to be protected from possible intrusion, a candy guard should be assigned to it. There are *k* such guards in the castle, so if there are more than *k* opened doors, one of them is going to be left unguarded! Notice that a guard can't leave his post until the door he is assigned to is closed.
Slastyona had a suspicion that there could be uninvited guests at the evening. She knows the order in which the invited guests entered the castle, and wants you to help her check whether there was a moment when more than *k* doors were opened.
Input Specification:
Two integers are given in the first string: the number of guests *n* and the number of guards *k* (1<=≤<=*n*<=≤<=106, 1<=≤<=*k*<=≤<=26).
In the second string, *n* uppercase English letters *s*1*s*2... *s**n* are given, where *s**i* is the entrance used by the *i*-th guest.
Output Specification:
Output «YES» if at least one door was unguarded during some time, and «NO» otherwise.
You can output each letter in arbitrary case (upper or lower).
Demo Input:
['5 1\nAABBB\n', '5 1\nABABB\n']
Demo Output:
['NO\n', 'YES\n']
Note:
In the first sample case, the door A is opened right before the first guest's arrival and closed when the second guest enters the castle. The door B is opened right before the arrival of the third guest, and closed after the fifth one arrives. One guard can handle both doors, as the first one is closed before the second one is opened.
In the second sample case, the door B is opened before the second guest's arrival, but the only guard can't leave the door A unattended, as there is still one more guest that should enter the castle through this door. | ```python
n,k=map(int,input().split())
s=input()
guard=1
exc=False
for i in range(1,n):
if guard > k :
exc=True
break
if s[i]==s[i-1]:
if s[i] not in s[i+1:]:
guard=guard-1
continue
else:
guard=guard+1
if guard > k :
exc=True
break
if s[i] not in s[i+1:]:
guard=guard-1
if exc:
print("YES")
else :
print("NO")
``` | 0 | |
912 | A | Tricky Alchemy | PROGRAMMING | 800 | [
"implementation"
] | null | null | During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls. | The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained. | Print a single integer — the minimum number of crystals that Grisha should acquire in addition. | [
"4 3\n2 1 1\n",
"3 9\n1 1 3\n",
"12345678 87654321\n43043751 1000000000 53798715\n"
] | [
"2\n",
"1\n",
"2147483648\n"
] | In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue. | 500 | [
{
"input": "4 3\n2 1 1",
"output": "2"
},
{
"input": "3 9\n1 1 3",
"output": "1"
},
{
"input": "12345678 87654321\n43043751 1000000000 53798715",
"output": "2147483648"
},
{
"input": "12 12\n3 5 2",
"output": "0"
},
{
"input": "770 1390\n170 442 311",
"output": "12"
},
{
"input": "3555165 6693472\n1499112 556941 3075290",
"output": "3089339"
},
{
"input": "0 0\n1000000000 1000000000 1000000000",
"output": "7000000000"
},
{
"input": "1 1\n0 1 0",
"output": "0"
},
{
"input": "117708228 562858833\n118004008 360437130 154015822",
"output": "738362681"
},
{
"input": "999998118 700178721\n822106746 82987112 547955384",
"output": "1753877029"
},
{
"input": "566568710 765371101\n60614022 80126928 809950465",
"output": "1744607222"
},
{
"input": "448858599 829062060\n764716760 97644201 203890025",
"output": "1178219122"
},
{
"input": "626115781 966381948\n395190569 820194184 229233367",
"output": "1525971878"
},
{
"input": "803372962 103701834\n394260597 837711458 623172928",
"output": "3426388098"
},
{
"input": "980630143 241021722\n24734406 928857659 312079781",
"output": "1624075280"
},
{
"input": "862920032 378341609\n360240924 241342224 337423122",
"output": "974174021"
},
{
"input": "40177212 515661496\n64343660 963892207 731362684",
"output": "3694721078"
},
{
"input": "217434393 579352456\n694817470 981409480 756706026",
"output": "4825785129"
},
{
"input": "394691574 716672343\n398920207 72555681 150645586",
"output": "475704521"
},
{
"input": "276981463 853992230\n29394015 90072954 839552440",
"output": "1754738044"
},
{
"input": "843552056 919184611\n341530221 423649259 101547519",
"output": "263157645"
},
{
"input": "20809236 56504497\n972004030 441166533 495487081",
"output": "4235488636"
},
{
"input": "198066417 825228166\n602477839 532312735 520830423",
"output": "2808777834"
},
{
"input": "80356306 962548053\n601547868 549830008 914769984",
"output": "4004161345"
},
{
"input": "257613487 394835231\n642087093 567347282 308709545",
"output": "2692548667"
},
{
"input": "139903376 532155119\n641157122 289897263 629020178",
"output": "3077110809"
},
{
"input": "612127849 669475006\n271630930 676010757 22959739",
"output": "682559736"
},
{
"input": "0 0\n0 0 0",
"output": "0"
},
{
"input": "1000000000 1000000000\n499999998 4 333333332",
"output": "0"
},
{
"input": "1000000000 1000000000\n1000000000 1000000000 1000000000",
"output": "5000000000"
},
{
"input": "4 3\n1 0 1",
"output": "0"
},
{
"input": "4 12\n1 2 3",
"output": "0"
},
{
"input": "4 20\n1 2 1",
"output": "0"
},
{
"input": "100 10\n2 3 4",
"output": "5"
},
{
"input": "6 0\n1 1 1",
"output": "4"
},
{
"input": "25 5\n3 3 3",
"output": "7"
},
{
"input": "48 27\n22 39 20",
"output": "107"
},
{
"input": "4 0\n1 1 1",
"output": "4"
}
] | 1,515,758,126 | 2,147,483,647 | Python 3 | OK | TESTS | 38 | 62 | 5,632,000 | a,b=map(int,input().split())
x,y,z=map(int,input().split())
a1=2*x+y
b1=3*z+y
if a<a1:
a2=a1-a
else:
a2=0
if b<b1:
b2=b1-b
else:
b2=0
print(a2+b2)
| Title: Tricky Alchemy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
During the winter holidays, the demand for Christmas balls is exceptionally high. Since it's already 2018, the advances in alchemy allow easy and efficient ball creation by utilizing magic crystals.
Grisha needs to obtain some yellow, green and blue balls. It's known that to produce a yellow ball one needs two yellow crystals, green — one yellow and one blue, and for a blue ball, three blue crystals are enough.
Right now there are *A* yellow and *B* blue crystals in Grisha's disposal. Find out how many additional crystals he should acquire in order to produce the required number of balls.
Input Specification:
The first line features two integers *A* and *B* (0<=≤<=*A*,<=*B*<=≤<=109), denoting the number of yellow and blue crystals respectively at Grisha's disposal.
The next line contains three integers *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=109) — the respective amounts of yellow, green and blue balls to be obtained.
Output Specification:
Print a single integer — the minimum number of crystals that Grisha should acquire in addition.
Demo Input:
['4 3\n2 1 1\n', '3 9\n1 1 3\n', '12345678 87654321\n43043751 1000000000 53798715\n']
Demo Output:
['2\n', '1\n', '2147483648\n']
Note:
In the first sample case, Grisha needs five yellow and four blue crystals to create two yellow balls, one green ball, and one blue ball. To do that, Grisha needs to obtain two additional crystals: one yellow and one blue. | ```python
a,b=map(int,input().split())
x,y,z=map(int,input().split())
a1=2*x+y
b1=3*z+y
if a<a1:
a2=a1-a
else:
a2=0
if b<b1:
b2=b1-b
else:
b2=0
print(a2+b2)
``` | 3 | |
868 | B | Race Against Time | PROGRAMMING | 1,400 | [
"implementation"
] | null | null | Have you ever tried to explain to the coordinator, why it is eight hours to the contest and not a single problem has been prepared yet? Misha had. And this time he has a really strong excuse: he faced a space-time paradox! Space and time replaced each other.
The entire universe turned into an enormous clock face with three hands — hour, minute, and second. Time froze, and clocks now show the time *h* hours, *m* minutes, *s* seconds.
Last time Misha talked with the coordinator at *t*1 o'clock, so now he stands on the number *t*1 on the clock face. The contest should be ready by *t*2 o'clock. In the terms of paradox it means that Misha has to go to number *t*2 somehow. Note that he doesn't have to move forward only: in these circumstances time has no direction.
Clock hands are very long, and Misha cannot get round them. He also cannot step over as it leads to the collapse of space-time. That is, if hour clock points 12 and Misha stands at 11 then he cannot move to 1 along the top arc. He has to follow all the way round the clock center (of course, if there are no other hands on his way).
Given the hands' positions, *t*1, and *t*2, find if Misha can prepare the contest on time (or should we say on space?). That is, find if he can move from *t*1 to *t*2 by the clock face. | Five integers *h*, *m*, *s*, *t*1, *t*2 (1<=≤<=*h*<=≤<=12, 0<=≤<=*m*,<=*s*<=≤<=59, 1<=≤<=*t*1,<=*t*2<=≤<=12, *t*1<=≠<=*t*2).
Misha's position and the target time do not coincide with the position of any hand. | Print "YES" (quotes for clarity), if Misha can prepare the contest on time, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES"). | [
"12 30 45 3 11\n",
"12 0 1 12 1\n",
"3 47 0 4 9\n"
] | [
"NO\n",
"YES\n",
"YES\n"
] | The three examples are shown on the pictures below from left to right. The starting position of Misha is shown with green, the ending position is shown with pink. Note that the positions of the hands on the pictures are not exact, but are close to the exact and the answer is the same. | 500 | [
{
"input": "12 30 45 3 11",
"output": "NO"
},
{
"input": "12 0 1 12 1",
"output": "YES"
},
{
"input": "3 47 0 4 9",
"output": "YES"
},
{
"input": "10 22 59 6 10",
"output": "YES"
},
{
"input": "3 1 13 12 3",
"output": "NO"
},
{
"input": "11 19 28 9 10",
"output": "YES"
},
{
"input": "9 38 22 6 1",
"output": "NO"
},
{
"input": "5 41 11 5 8",
"output": "NO"
},
{
"input": "11 2 53 10 4",
"output": "YES"
},
{
"input": "9 41 17 10 1",
"output": "YES"
},
{
"input": "6 54 48 12 6",
"output": "YES"
},
{
"input": "12 55 9 5 1",
"output": "NO"
},
{
"input": "8 55 35 9 3",
"output": "NO"
},
{
"input": "3 21 34 3 10",
"output": "YES"
},
{
"input": "2 52 1 12 3",
"output": "NO"
},
{
"input": "7 17 11 1 7",
"output": "NO"
},
{
"input": "11 6 37 6 4",
"output": "YES"
},
{
"input": "9 6 22 8 1",
"output": "NO"
},
{
"input": "3 10 5 5 9",
"output": "YES"
},
{
"input": "7 12 22 11 2",
"output": "YES"
},
{
"input": "7 19 4 7 3",
"output": "NO"
},
{
"input": "11 36 21 4 6",
"output": "NO"
},
{
"input": "10 32 49 1 3",
"output": "YES"
},
{
"input": "1 9 43 11 3",
"output": "NO"
},
{
"input": "1 8 33 4 8",
"output": "NO"
},
{
"input": "3 0 33 9 4",
"output": "NO"
},
{
"input": "7 15 9 10 3",
"output": "NO"
},
{
"input": "8 3 57 11 1",
"output": "NO"
},
{
"input": "1 33 49 5 9",
"output": "NO"
},
{
"input": "3 40 0 5 7",
"output": "YES"
},
{
"input": "5 50 9 2 7",
"output": "NO"
},
{
"input": "10 0 52 6 1",
"output": "YES"
},
{
"input": "3 10 4 1 11",
"output": "NO"
},
{
"input": "2 41 53 4 6",
"output": "YES"
},
{
"input": "10 29 30 4 7",
"output": "NO"
},
{
"input": "5 13 54 9 11",
"output": "NO"
},
{
"input": "1 0 23 3 9",
"output": "NO"
},
{
"input": "1 0 41 12 1",
"output": "NO"
},
{
"input": "6 30 30 3 9",
"output": "YES"
},
{
"input": "3 7 32 11 10",
"output": "YES"
},
{
"input": "1 0 25 12 4",
"output": "NO"
},
{
"input": "12 0 0 5 6",
"output": "YES"
},
{
"input": "1 5 4 3 2",
"output": "YES"
},
{
"input": "6 30 30 9 10",
"output": "YES"
},
{
"input": "6 0 0 2 8",
"output": "NO"
},
{
"input": "10 50 59 9 10",
"output": "YES"
},
{
"input": "12 59 59 12 6",
"output": "NO"
},
{
"input": "3 0 30 3 4",
"output": "NO"
},
{
"input": "2 10 10 1 11",
"output": "YES"
},
{
"input": "10 5 30 1 12",
"output": "YES"
},
{
"input": "5 29 31 5 10",
"output": "YES"
},
{
"input": "5 2 2 11 2",
"output": "NO"
},
{
"input": "5 15 46 3 10",
"output": "YES"
},
{
"input": "1 30 50 1 2",
"output": "NO"
},
{
"input": "5 26 14 1 12",
"output": "YES"
},
{
"input": "1 58 43 12 1",
"output": "YES"
},
{
"input": "12 0 12 11 1",
"output": "NO"
},
{
"input": "6 52 41 6 5",
"output": "YES"
},
{
"input": "5 8 2 1 3",
"output": "NO"
},
{
"input": "2 0 0 1 3",
"output": "NO"
},
{
"input": "1 5 6 2 1",
"output": "YES"
},
{
"input": "9 5 5 11 12",
"output": "YES"
},
{
"input": "12 5 19 3 4",
"output": "NO"
},
{
"input": "6 14 59 1 3",
"output": "NO"
},
{
"input": "10 38 34 4 12",
"output": "YES"
},
{
"input": "2 54 14 2 12",
"output": "YES"
},
{
"input": "5 31 0 6 7",
"output": "NO"
},
{
"input": "6 15 30 3 9",
"output": "YES"
},
{
"input": "3 54 41 8 10",
"output": "NO"
},
{
"input": "3 39 10 10 12",
"output": "YES"
},
{
"input": "1 11 50 1 2",
"output": "NO"
},
{
"input": "5 40 24 8 1",
"output": "NO"
},
{
"input": "9 5 59 1 3",
"output": "NO"
},
{
"input": "5 0 0 6 7",
"output": "YES"
},
{
"input": "4 40 59 6 8",
"output": "YES"
},
{
"input": "10 13 55 12 1",
"output": "YES"
},
{
"input": "6 50 0 5 6",
"output": "YES"
},
{
"input": "7 59 3 7 4",
"output": "YES"
},
{
"input": "6 0 1 6 7",
"output": "NO"
},
{
"input": "6 15 55 3 5",
"output": "NO"
},
{
"input": "12 9 55 10 2",
"output": "YES"
},
{
"input": "2 0 1 11 2",
"output": "NO"
},
{
"input": "8 45 17 12 9",
"output": "NO"
},
{
"input": "5 30 31 11 3",
"output": "YES"
},
{
"input": "6 43 0 10 6",
"output": "NO"
},
{
"input": "6 30 30 1 11",
"output": "YES"
},
{
"input": "11 59 59 11 12",
"output": "YES"
},
{
"input": "5 45 35 9 5",
"output": "NO"
},
{
"input": "2 43 4 9 7",
"output": "NO"
},
{
"input": "12 30 50 6 9",
"output": "NO"
},
{
"input": "1 10 1 2 3",
"output": "NO"
},
{
"input": "10 5 55 9 1",
"output": "NO"
},
{
"input": "1 59 59 2 3",
"output": "YES"
},
{
"input": "1 49 14 10 3",
"output": "NO"
},
{
"input": "3 15 15 2 4",
"output": "YES"
},
{
"input": "10 5 55 1 5",
"output": "NO"
},
{
"input": "6 33 45 12 6",
"output": "YES"
},
{
"input": "1 20 20 11 1",
"output": "YES"
},
{
"input": "2 30 45 1 11",
"output": "YES"
},
{
"input": "1 55 1 11 10",
"output": "YES"
},
{
"input": "3 0 1 11 1",
"output": "NO"
},
{
"input": "1 5 6 1 12",
"output": "YES"
},
{
"input": "12 10 5 11 4",
"output": "YES"
},
{
"input": "6 5 59 12 1",
"output": "YES"
},
{
"input": "12 0 20 11 12",
"output": "YES"
},
{
"input": "3 25 30 4 5",
"output": "YES"
},
{
"input": "2 15 18 11 1",
"output": "YES"
},
{
"input": "12 5 48 11 9",
"output": "NO"
},
{
"input": "6 30 30 10 2",
"output": "YES"
},
{
"input": "1 0 11 1 2",
"output": "NO"
},
{
"input": "10 0 1 10 11",
"output": "NO"
},
{
"input": "3 30 45 10 1",
"output": "YES"
},
{
"input": "11 21 56 3 12",
"output": "YES"
},
{
"input": "3 16 16 3 4",
"output": "YES"
},
{
"input": "11 55 55 1 12",
"output": "YES"
},
{
"input": "12 12 12 11 12",
"output": "YES"
},
{
"input": "3 5 1 1 2",
"output": "NO"
},
{
"input": "3 30 45 10 11",
"output": "YES"
},
{
"input": "10 0 1 9 10",
"output": "YES"
},
{
"input": "3 0 5 3 6",
"output": "NO"
},
{
"input": "1 1 49 1 10",
"output": "NO"
},
{
"input": "9 45 15 11 12",
"output": "YES"
},
{
"input": "12 15 59 3 8",
"output": "NO"
},
{
"input": "5 0 5 3 6",
"output": "NO"
},
{
"input": "3 30 45 1 2",
"output": "YES"
},
{
"input": "2 10 11 2 4",
"output": "YES"
},
{
"input": "2 10 10 4 3",
"output": "YES"
},
{
"input": "3 30 59 1 2",
"output": "YES"
},
{
"input": "11 59 59 12 11",
"output": "YES"
},
{
"input": "10 25 50 5 6",
"output": "NO"
},
{
"input": "6 30 30 9 3",
"output": "YES"
},
{
"input": "8 14 40 12 3",
"output": "NO"
},
{
"input": "2 10 10 1 6",
"output": "YES"
}
] | 1,588,967,300 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 139 | 20,172,800 | h,m,s,t1,t2=map(int,input().split())
m=m/5
s=s/5
co=0
if (t1<=h and h<=t2) :
co+=1
if (t1<=m and m<=t2):
co+=1
if(t1<=s and s<=t2):
co+=1
if co==0 or co==3:
print("YES")
else:
print("NO") | Title: Race Against Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Have you ever tried to explain to the coordinator, why it is eight hours to the contest and not a single problem has been prepared yet? Misha had. And this time he has a really strong excuse: he faced a space-time paradox! Space and time replaced each other.
The entire universe turned into an enormous clock face with three hands — hour, minute, and second. Time froze, and clocks now show the time *h* hours, *m* minutes, *s* seconds.
Last time Misha talked with the coordinator at *t*1 o'clock, so now he stands on the number *t*1 on the clock face. The contest should be ready by *t*2 o'clock. In the terms of paradox it means that Misha has to go to number *t*2 somehow. Note that he doesn't have to move forward only: in these circumstances time has no direction.
Clock hands are very long, and Misha cannot get round them. He also cannot step over as it leads to the collapse of space-time. That is, if hour clock points 12 and Misha stands at 11 then he cannot move to 1 along the top arc. He has to follow all the way round the clock center (of course, if there are no other hands on his way).
Given the hands' positions, *t*1, and *t*2, find if Misha can prepare the contest on time (or should we say on space?). That is, find if he can move from *t*1 to *t*2 by the clock face.
Input Specification:
Five integers *h*, *m*, *s*, *t*1, *t*2 (1<=≤<=*h*<=≤<=12, 0<=≤<=*m*,<=*s*<=≤<=59, 1<=≤<=*t*1,<=*t*2<=≤<=12, *t*1<=≠<=*t*2).
Misha's position and the target time do not coincide with the position of any hand.
Output Specification:
Print "YES" (quotes for clarity), if Misha can prepare the contest on time, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['12 30 45 3 11\n', '12 0 1 12 1\n', '3 47 0 4 9\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n']
Note:
The three examples are shown on the pictures below from left to right. The starting position of Misha is shown with green, the ending position is shown with pink. Note that the positions of the hands on the pictures are not exact, but are close to the exact and the answer is the same. | ```python
h,m,s,t1,t2=map(int,input().split())
m=m/5
s=s/5
co=0
if (t1<=h and h<=t2) :
co+=1
if (t1<=m and m<=t2):
co+=1
if(t1<=s and s<=t2):
co+=1
if co==0 or co==3:
print("YES")
else:
print("NO")
``` | 0 | |
595 | B | Pasha and Phone | PROGRAMMING | 1,600 | [
"binary search",
"math"
] | null | null | Pasha has recently bought a new phone jPager and started adding his friends' phone numbers there. Each phone number consists of exactly *n* digits.
Also Pasha has a number *k* and two sequences of length *n*<=/<=*k* (*n* is divisible by *k*) *a*1,<=*a*2,<=...,<=*a**n*<=/<=*k* and *b*1,<=*b*2,<=...,<=*b**n*<=/<=*k*. Let's split the phone number into blocks of length *k*. The first block will be formed by digits from the phone number that are on positions 1, 2,..., *k*, the second block will be formed by digits from the phone number that are on positions *k*<=+<=1, *k*<=+<=2, ..., 2·*k* and so on. Pasha considers a phone number good, if the *i*-th block doesn't start from the digit *b**i* and is divisible by *a**i* if represented as an integer.
To represent the block of length *k* as an integer, let's write it out as a sequence *c*1, *c*2,...,*c**k*. Then the integer is calculated as the result of the expression *c*1·10*k*<=-<=1<=+<=*c*2·10*k*<=-<=2<=+<=...<=+<=*c**k*.
Pasha asks you to calculate the number of good phone numbers of length *n*, for the given *k*, *a**i* and *b**i*. As this number can be too big, print it modulo 109<=+<=7. | The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*k*<=≤<=*min*(*n*,<=9)) — the length of all phone numbers and the length of each block, respectively. It is guaranteed that *n* is divisible by *k*.
The second line of the input contains *n*<=/<=*k* space-separated positive integers — sequence *a*1,<=*a*2,<=...,<=*a**n*<=/<=*k* (1<=≤<=*a**i*<=<<=10*k*).
The third line of the input contains *n*<=/<=*k* space-separated positive integers — sequence *b*1,<=*b*2,<=...,<=*b**n*<=/<=*k* (0<=≤<=*b**i*<=≤<=9). | Print a single integer — the number of good phone numbers of length *n* modulo 109<=+<=7. | [
"6 2\n38 56 49\n7 3 4\n",
"8 2\n1 22 3 44\n5 4 3 2\n"
] | [
"8\n",
"32400\n"
] | In the first test sample good phone numbers are: 000000, 000098, 005600, 005698, 380000, 380098, 385600, 385698. | 1,000 | [
{
"input": "6 2\n38 56 49\n7 3 4",
"output": "8"
},
{
"input": "8 2\n1 22 3 44\n5 4 3 2",
"output": "32400"
},
{
"input": "2 1\n9 9\n9 9",
"output": "1"
},
{
"input": "2 1\n9 9\n0 9",
"output": "1"
},
{
"input": "4 1\n4 3 2 1\n1 2 3 4",
"output": "540"
},
{
"input": "18 9\n2 3\n0 4",
"output": "505000007"
},
{
"input": "4 4\n1122\n2",
"output": "8"
},
{
"input": "10 5\n8378 11089\n7 5",
"output": "99"
},
{
"input": "10 5\n52057 11807\n0 1",
"output": "8"
},
{
"input": "10 1\n3 1 1 4 8 7 5 6 4 1\n0 0 0 5 5 6 8 8 4 0",
"output": "209952"
},
{
"input": "100 4\n388 2056 122 1525 2912 1465 3066 257 5708 3604 3039 6183 3035 626 1389 5393 3321 3175 2922 2024 3837 437 5836 2376 1599\n6 5 5 2 9 6 8 3 5 0 6 0 1 8 5 3 5 2 3 0 5 6 6 7 3",
"output": "652599557"
},
{
"input": "100 1\n5 3 1 5 6 2 4 8 3 3 1 1 2 8 2 3 8 2 5 2 6 2 3 5 2 1 2 1 2 8 4 3 3 5 1 4 2 2 2 5 8 2 2 6 2 9 2 4 1 8 1 5 5 6 6 1 2 7 3 3 4 2 4 1 2 6 6 4 9 4 3 2 3 8 2 3 1 4 1 4 1 3 5 3 5 5 2 3 4 1 1 8 1 5 6 9 4 2 5 1\n6 0 4 5 3 1 0 7 5 3 9 4 5 4 0 2 1 6 2 2 4 3 1 9 5 9 2 2 6 8 6 5 9 6 4 9 9 7 5 4 5 6 0 3 2 0 8 0 3 9 5 3 8 0 9 3 6 2 9 5 9 3 2 2 2 2 0 8 1 2 9 0 9 8 0 3 2 0 7 9 4 3 7 2 3 1 8 9 8 2 6 0 3 2 9 8 9 2 3 4",
"output": "27157528"
},
{
"input": "100 5\n5302 4362 11965 14930 11312 33797 17413 17850 79562 17981 28002 40852 173 23022 55762 13013 79597 29597 31944 32384\n9 8 7 0 6 6 7 7 5 9 1 3 4 8 7 1 1 6 4 4",
"output": "885507108"
},
{
"input": "1 1\n2\n0",
"output": "4"
}
] | 1,447,011,659 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include<bits/stdc++.h>
#define pb push_back
#define len(n) strlen(n)
#define mp make_pair
#define forp(i,a,b) for(long i=a;i<=b;i++)
#define rep(i,n) for(i=0;i<n;i++)
#define ren(i,n) for(i=n-1;i>=0;i--)
#define forn(i,a,b) for(long i=a;i>=b;i--)
#define fre freopen("0.in","r",stdin),freopen("0.out","w",stdout)
#define ff first
#define ss second
#define pll pair<long long int,long long int>
#define pii pair<int,int>
#define vll vector<long long int>
#define vii vector<int>
#define gi(n) scanf("%d",&n)
#define gll(n) scanf("%lld",&n)
#define gstr(n) scanf("%s",n)
#define gl(n) cin >> n
#define g2(m,n) cin >> m >> n
#define oi(n) printf("%d",n)
#define oll(n) printf("%lld",n)
#define onn printf("\n")
#define ostr(n) printf("%s",n)
#define ol(n) cout << n
#define os cout<<" "
#define on cout<<"\n"
#define o2(a,b) cout<<a<<" "<<b
#define all(n) n.begin(),n.end()
#define alll(n,i,j) n.begin()+i,n.begin()+j
#define present(s,x) (s.find(x) != s.end())
#define cpresent(s,x) (find(all(s),x) != s.end())
#define boost ios_base::sync_with_stdio(false)
#define tr(container, it) for(__typeof(container.begin()) it = container.begin(); it != container.end(); it++)
#define ret return 0
#define mem(n) memset(n,0,sizeof(n))
#define M 1000000007
#define N 10000004
using namespace std;
typedef unsigned long long int ull;
typedef long long int ll;
typedef long int lg;
typedef vector<vector<ll> > mat;
ll n,k,i,j,a[10000010][2],ans = 1;
int main()
{
boost;
g2(n,k);
ll f[10];
f[0] = 1;
forp(i,1,k) f[i] = f[i-1]*10;
rep(i,2) rep(j,n/k) gl(a[j][i]);
rep(i,n/k){
if(a[i][1] == 0) {
ll b = f[k]; int y;
if(b%a[i][0]) y = 1;
else y = 0;
ll res = (b/a[i][0] + y)%M;
ans = ((ans%M)*(res%M))%M;
}
else {
ll b = f[k-1]*a[i][1];
ll c = f[k-1]*(a[i][1]+1);
ll d = f[k];
//if(a[i][0] == 3)ol(b/a[i][0]),os,ol(c/a[i][0]),os;
int x,y,z;
if(b%a[i][0]) x = 0;
else x = 1;
if(c%a[i][0]) y = 0;
else y = 1;
if(d%a[i][0]) z = 1;
else z = 0;
d /= a[i][0];
d += z;
//if(a[i][0] == 3) ol(d),os;
ll res = d - c/a[i][0] + b/a[i][0] - x + y;
res %= M;
//ol(res),os;
ans = ((ans%M)*(res%M))%M;
}
}
ol(ans),on;
} | Title: Pasha and Phone
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has recently bought a new phone jPager and started adding his friends' phone numbers there. Each phone number consists of exactly *n* digits.
Also Pasha has a number *k* and two sequences of length *n*<=/<=*k* (*n* is divisible by *k*) *a*1,<=*a*2,<=...,<=*a**n*<=/<=*k* and *b*1,<=*b*2,<=...,<=*b**n*<=/<=*k*. Let's split the phone number into blocks of length *k*. The first block will be formed by digits from the phone number that are on positions 1, 2,..., *k*, the second block will be formed by digits from the phone number that are on positions *k*<=+<=1, *k*<=+<=2, ..., 2·*k* and so on. Pasha considers a phone number good, if the *i*-th block doesn't start from the digit *b**i* and is divisible by *a**i* if represented as an integer.
To represent the block of length *k* as an integer, let's write it out as a sequence *c*1, *c*2,...,*c**k*. Then the integer is calculated as the result of the expression *c*1·10*k*<=-<=1<=+<=*c*2·10*k*<=-<=2<=+<=...<=+<=*c**k*.
Pasha asks you to calculate the number of good phone numbers of length *n*, for the given *k*, *a**i* and *b**i*. As this number can be too big, print it modulo 109<=+<=7.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*k*<=≤<=*min*(*n*,<=9)) — the length of all phone numbers and the length of each block, respectively. It is guaranteed that *n* is divisible by *k*.
The second line of the input contains *n*<=/<=*k* space-separated positive integers — sequence *a*1,<=*a*2,<=...,<=*a**n*<=/<=*k* (1<=≤<=*a**i*<=<<=10*k*).
The third line of the input contains *n*<=/<=*k* space-separated positive integers — sequence *b*1,<=*b*2,<=...,<=*b**n*<=/<=*k* (0<=≤<=*b**i*<=≤<=9).
Output Specification:
Print a single integer — the number of good phone numbers of length *n* modulo 109<=+<=7.
Demo Input:
['6 2\n38 56 49\n7 3 4\n', '8 2\n1 22 3 44\n5 4 3 2\n']
Demo Output:
['8\n', '32400\n']
Note:
In the first test sample good phone numbers are: 000000, 000098, 005600, 005698, 380000, 380098, 385600, 385698. | ```python
#include<bits/stdc++.h>
#define pb push_back
#define len(n) strlen(n)
#define mp make_pair
#define forp(i,a,b) for(long i=a;i<=b;i++)
#define rep(i,n) for(i=0;i<n;i++)
#define ren(i,n) for(i=n-1;i>=0;i--)
#define forn(i,a,b) for(long i=a;i>=b;i--)
#define fre freopen("0.in","r",stdin),freopen("0.out","w",stdout)
#define ff first
#define ss second
#define pll pair<long long int,long long int>
#define pii pair<int,int>
#define vll vector<long long int>
#define vii vector<int>
#define gi(n) scanf("%d",&n)
#define gll(n) scanf("%lld",&n)
#define gstr(n) scanf("%s",n)
#define gl(n) cin >> n
#define g2(m,n) cin >> m >> n
#define oi(n) printf("%d",n)
#define oll(n) printf("%lld",n)
#define onn printf("\n")
#define ostr(n) printf("%s",n)
#define ol(n) cout << n
#define os cout<<" "
#define on cout<<"\n"
#define o2(a,b) cout<<a<<" "<<b
#define all(n) n.begin(),n.end()
#define alll(n,i,j) n.begin()+i,n.begin()+j
#define present(s,x) (s.find(x) != s.end())
#define cpresent(s,x) (find(all(s),x) != s.end())
#define boost ios_base::sync_with_stdio(false)
#define tr(container, it) for(__typeof(container.begin()) it = container.begin(); it != container.end(); it++)
#define ret return 0
#define mem(n) memset(n,0,sizeof(n))
#define M 1000000007
#define N 10000004
using namespace std;
typedef unsigned long long int ull;
typedef long long int ll;
typedef long int lg;
typedef vector<vector<ll> > mat;
ll n,k,i,j,a[10000010][2],ans = 1;
int main()
{
boost;
g2(n,k);
ll f[10];
f[0] = 1;
forp(i,1,k) f[i] = f[i-1]*10;
rep(i,2) rep(j,n/k) gl(a[j][i]);
rep(i,n/k){
if(a[i][1] == 0) {
ll b = f[k]; int y;
if(b%a[i][0]) y = 1;
else y = 0;
ll res = (b/a[i][0] + y)%M;
ans = ((ans%M)*(res%M))%M;
}
else {
ll b = f[k-1]*a[i][1];
ll c = f[k-1]*(a[i][1]+1);
ll d = f[k];
//if(a[i][0] == 3)ol(b/a[i][0]),os,ol(c/a[i][0]),os;
int x,y,z;
if(b%a[i][0]) x = 0;
else x = 1;
if(c%a[i][0]) y = 0;
else y = 1;
if(d%a[i][0]) z = 1;
else z = 0;
d /= a[i][0];
d += z;
//if(a[i][0] == 3) ol(d),os;
ll res = d - c/a[i][0] + b/a[i][0] - x + y;
res %= M;
//ol(res),os;
ans = ((ans%M)*(res%M))%M;
}
}
ol(ans),on;
}
``` | -1 | |
526 | A | King of Thieves | PROGRAMMING | 1,300 | [
"brute force",
"implementation"
] | null | null | In this problem you will meet the simplified model of game King of Thieves.
In a new ZeptoLab game called "King of Thieves" your aim is to reach a chest with gold by controlling your character, avoiding traps and obstacles on your way.
An interesting feature of the game is that you can design your own levels that will be available to other players. Let's consider the following simple design of a level.
A dungeon consists of *n* segments located at a same vertical level, each segment is either a platform that character can stand on, or a pit with a trap that makes player lose if he falls into it. All segments have the same length, platforms on the scheme of the level are represented as '*' and pits are represented as '.'.
One of things that affects speedrun characteristics of the level is a possibility to perform a series of consecutive jumps of the same length. More formally, when the character is on the platform number *i*1, he can make a sequence of jumps through the platforms *i*1<=<<=*i*2<=<<=...<=<<=*i**k*, if *i*2<=-<=*i*1<==<=*i*3<=-<=*i*2<==<=...<==<=*i**k*<=-<=*i**k*<=-<=1. Of course, all segments *i*1,<=*i*2,<=... *i**k* should be exactly the platforms, not pits.
Let's call a level to be good if you can perform a sequence of four jumps of the same length or in the other words there must be a sequence *i*1,<=*i*2,<=...,<=*i*5, consisting of five platforms so that the intervals between consecutive platforms are of the same length. Given the scheme of the level, check if it is good. | The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of segments on the level.
Next line contains the scheme of the level represented as a string of *n* characters '*' and '.'. | If the level is good, print the word "yes" (without the quotes), otherwise print the word "no" (without the quotes). | [
"16\n.**.*..*.***.**.\n",
"11\n.*.*...*.*.\n"
] | [
"yes",
"no"
] | In the first sample test you may perform a sequence of jumps through platforms 2, 5, 8, 11, 14. | 500 | [
{
"input": "16\n.**.*..*.***.**.",
"output": "yes"
},
{
"input": "11\n.*.*...*.*.",
"output": "no"
},
{
"input": "53\n*.*.****.*.*......**....**.***.*.*.**.*.*.***...*..*.",
"output": "yes"
},
{
"input": "71\n**.**..*****.*.*.*.********.....*****.****.*..***...*.*.*.**.****.**.**",
"output": "yes"
},
{
"input": "56\n**.*..*...***.*.**.**..**.*.*.*.**...*.**.**....*...**..",
"output": "yes"
},
{
"input": "64\n***.*...*...*.***.....*.....**.*****.*.*...*..*.*..***..*...***.",
"output": "yes"
},
{
"input": "99\n.*..**..*..*..**...***.****.*...*....*****.....**..****.*..*....****..**..*****..*....**.*.**..**..",
"output": "yes"
},
{
"input": "89\n..**..**..*.********....*.*****.**.****...*......*******..*.**.*****..*..****....*...**..",
"output": "yes"
},
{
"input": "99\n..*.*..**.*.*.******.*.*.**.**.**.*..**.*.*****..*.*.****.*....**....*****.....***..**....***.*.*.*",
"output": "yes"
},
{
"input": "5\n*****",
"output": "yes"
},
{
"input": "10\n.*.*.*.*.*",
"output": "yes"
},
{
"input": "51\n....****....*........*.*..**........*....****....*.",
"output": "no"
},
{
"input": "98\n.**..**.*****..***...*.**..*..*....*******..**....*.****.**.*.....*.**..***.**..***.*******..****.",
"output": "yes"
},
{
"input": "45\n.***..******....***..**..*.*.*.**..**..*.**..",
"output": "yes"
},
{
"input": "67\n..**.*...*.....****.***.**.*....***..***.*..***.....*******.....*.*",
"output": "yes"
},
{
"input": "97\n...*..*...*******.*.**..**..******.*.*..*****.*...***.*.**.**.**..**.******.****.*.***.**..*...**",
"output": "yes"
},
{
"input": "87\n*..*..***.**.*...****...*....***....***......*..*.*.*****.**..*.***...*.****..**.*..***",
"output": "yes"
},
{
"input": "99\n***....*.....****.*.**.*.*.**.*.*.*..*...*..*...***..*.*...*.*...***.*.*...**.**.*******....**....*",
"output": "yes"
},
{
"input": "90\n**....****.***..***.*.*****...*.*.***..***.******.**...***..*...*****..*.**.**...*..**...*",
"output": "yes"
},
{
"input": "58\n**.*.*.**..******.**.*..*.**.*.*******.**.*.**.*..*****.*.",
"output": "yes"
},
{
"input": "75\n..*.**..*.*****.......*....*.*.*..**.*.***.*.***....******.****.*.....****.",
"output": "yes"
},
{
"input": "72\n.***.**.*.*...*****.*.*.*.*.**....**.*.**..*.*...**..***.**.**..*.**..**",
"output": "yes"
},
{
"input": "69\n.***...*.***.**...*....*.***.*..*....**.*...**....*.*..**....**..*.**",
"output": "yes"
},
{
"input": "42\n..*...*.*..**..*.*.*..**...**.***.*.******",
"output": "yes"
},
{
"input": "54\n...***.*...****.*..****....*..**..**..***.*..**...**..",
"output": "yes"
},
{
"input": "55\n...*..*.*.**..*.*....*.****..****....*..***.*****..*..*",
"output": "yes"
},
{
"input": "57\n**...*....**.**.*.******.**..**.*.....**.***..***...**..*",
"output": "yes"
},
{
"input": "97\n****.***.***.*..**.**.*.*.***.*............*..*......*.***.**.*.***.*.***.*..*.**.*.***.**.*****.",
"output": "yes"
},
{
"input": "42\n***.*..*.*.***...**..*..**....**..*..*...*",
"output": "yes"
},
{
"input": "99\n**...*.*.*..*....**.***..*...***..***.**.*.....*.*....*...*.**.**.****..**..*.*..*.***....**...**.*",
"output": "yes"
},
{
"input": "1\n.",
"output": "no"
},
{
"input": "1\n*",
"output": "no"
},
{
"input": "99\n.*.......................*.......................*.......................*.......................*.",
"output": "yes"
},
{
"input": "99\n.*.......................*...............................................*.......................*.",
"output": "no"
},
{
"input": "100\n****************************************************************************************************",
"output": "yes"
},
{
"input": "99\n***************************************************************************************************",
"output": "yes"
},
{
"input": "5\n.****",
"output": "no"
},
{
"input": "5\n*.***",
"output": "no"
},
{
"input": "5\n**.**",
"output": "no"
},
{
"input": "5\n***.*",
"output": "no"
},
{
"input": "5\n****.",
"output": "no"
},
{
"input": "100\n*...............................................................................................****",
"output": "no"
},
{
"input": "11\n.**.*..*.**",
"output": "no"
},
{
"input": "21\n*.*...*.*...*.*...*.*",
"output": "no"
},
{
"input": "6\n***.**",
"output": "no"
},
{
"input": "13\n*..*..*..*..*",
"output": "yes"
},
{
"input": "4\n****",
"output": "no"
},
{
"input": "17\n.*..*..*.....*..*",
"output": "no"
},
{
"input": "7\n***.***",
"output": "no"
},
{
"input": "20\n.*..*...*....*.....*",
"output": "no"
},
{
"input": "11\n*...**..*.*",
"output": "no"
},
{
"input": "10\n*****....*",
"output": "yes"
},
{
"input": "16\n*.**.**.**.*..*.",
"output": "yes"
},
{
"input": "10\n.*.*.*.*..",
"output": "no"
},
{
"input": "17\n*...*...*...*...*",
"output": "yes"
},
{
"input": "15\n..........*****",
"output": "yes"
}
] | 1,511,361,104 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 15 | 62 | 0 | n=int(input())
l=[]
ch=input()
for i in range (n):
if (ch[i]=='*'):
l.append(i+1)
i=0
s=0
while((i<len(l)-1)and(s<4)):
s=1
j=i+2
d=l[i+1]-l[i]
while((j<len(l))and(l[j]-l[j-1]<=d)and(s<4)):
if (l[j]-l[j-1]==d):
s=s+1
else:
j=j+1
if(s<4):
i=i+1
if(s==4):
print("yes")
else:
print("no")
| Title: King of Thieves
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In this problem you will meet the simplified model of game King of Thieves.
In a new ZeptoLab game called "King of Thieves" your aim is to reach a chest with gold by controlling your character, avoiding traps and obstacles on your way.
An interesting feature of the game is that you can design your own levels that will be available to other players. Let's consider the following simple design of a level.
A dungeon consists of *n* segments located at a same vertical level, each segment is either a platform that character can stand on, or a pit with a trap that makes player lose if he falls into it. All segments have the same length, platforms on the scheme of the level are represented as '*' and pits are represented as '.'.
One of things that affects speedrun characteristics of the level is a possibility to perform a series of consecutive jumps of the same length. More formally, when the character is on the platform number *i*1, he can make a sequence of jumps through the platforms *i*1<=<<=*i*2<=<<=...<=<<=*i**k*, if *i*2<=-<=*i*1<==<=*i*3<=-<=*i*2<==<=...<==<=*i**k*<=-<=*i**k*<=-<=1. Of course, all segments *i*1,<=*i*2,<=... *i**k* should be exactly the platforms, not pits.
Let's call a level to be good if you can perform a sequence of four jumps of the same length or in the other words there must be a sequence *i*1,<=*i*2,<=...,<=*i*5, consisting of five platforms so that the intervals between consecutive platforms are of the same length. Given the scheme of the level, check if it is good.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of segments on the level.
Next line contains the scheme of the level represented as a string of *n* characters '*' and '.'.
Output Specification:
If the level is good, print the word "yes" (without the quotes), otherwise print the word "no" (without the quotes).
Demo Input:
['16\n.**.*..*.***.**.\n', '11\n.*.*...*.*.\n']
Demo Output:
['yes', 'no']
Note:
In the first sample test you may perform a sequence of jumps through platforms 2, 5, 8, 11, 14. | ```python
n=int(input())
l=[]
ch=input()
for i in range (n):
if (ch[i]=='*'):
l.append(i+1)
i=0
s=0
while((i<len(l)-1)and(s<4)):
s=1
j=i+2
d=l[i+1]-l[i]
while((j<len(l))and(l[j]-l[j-1]<=d)and(s<4)):
if (l[j]-l[j-1]==d):
s=s+1
else:
j=j+1
if(s<4):
i=i+1
if(s==4):
print("yes")
else:
print("no")
``` | 0 | |
11 | A | Increasing Sequence | PROGRAMMING | 900 | [
"constructive algorithms",
"implementation",
"math"
] | A. Increasing Sequence | 1 | 64 | A sequence *a*0,<=*a*1,<=...,<=*a**t*<=-<=1 is called increasing if *a**i*<=-<=1<=<<=*a**i* for each *i*:<=0<=<<=*i*<=<<=*t*.
You are given a sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 and a positive integer *d*. In each move you may choose one element of the given sequence and add *d* to it. What is the least number of moves required to make the given sequence increasing? | The first line of the input contains two integer numbers *n* and *d* (2<=≤<=*n*<=≤<=2000,<=1<=≤<=*d*<=≤<=106). The second line contains space separated sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 (1<=≤<=*b**i*<=≤<=106). | Output the minimal number of moves needed to make the sequence increasing. | [
"4 2\n1 3 3 2\n"
] | [
"3\n"
] | none | 0 | [
{
"input": "4 2\n1 3 3 2",
"output": "3"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "2 1\n2 5",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "2 7\n10 20",
"output": "0"
},
{
"input": "2 7\n1 1",
"output": "1"
},
{
"input": "3 3\n18 1 9",
"output": "10"
},
{
"input": "3 3\n15 17 9",
"output": "3"
},
{
"input": "3 3\n10 9 12",
"output": "2"
},
{
"input": "10 3\n2 1 17 10 5 16 8 4 15 17",
"output": "31"
},
{
"input": "10 3\n6 11 4 12 22 15 23 26 24 26",
"output": "13"
},
{
"input": "10 3\n10 24 13 15 18 14 15 26 33 35",
"output": "29"
},
{
"input": "100 3\n529 178 280 403 326 531 671 427 188 866 669 646 421 804 494 609 53 1012 211 243 887 833 900 543 226 42 859 718 454 372 971 692 846 770 511 395 499 479 641 756 115 269 206 45 1039 727 400 779 859 614 146 214 196 919 702 959 380 830 535 878 859 784 316 305 782 924 536 243 236 978 564 150 291 877 808 983 537 839 490 120 168 838 267 650 900 170 211 504 326 771 895 984 994 483 776 100 471 1078 317 580",
"output": "15717"
},
{
"input": "100 3\n329 226 331 909 962 112 837 1005 194 818 506 416 125 648 367 459 400 582 989 547 329 438 234 121 272 226 821 376 834 427 718 164 834 113 654 177 737 212 169 696 744 180 89 944 233 147 667 990 809 1072 1085 1093 814 265 1067 312 833 572 303 901 1032 504 185 817 389 158 613 723 239 269 911 352 769 404 225 822 897 606 947 323 913 804 923 1084 552 901 486 249 209 898 847 610 728 1122 986 669 1116 1076 367 327",
"output": "16133"
}
] | 1,427,823,511 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 122 | 0 | first = input().split(" ")
count = 0
n = int(first[0])
d = int(first[1])
line = input().split(" ")
line[0] = int(line[0])
for x in range(1, n):
line[x] = int(line[x])
if line[x-1] >= line[x]:
num = int((line[x-1]-line[x])/d + 0.5)
if num == 0:
num = 1
line[x] += d * num
count += num
print(count) | Title: Increasing Sequence
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
A sequence *a*0,<=*a*1,<=...,<=*a**t*<=-<=1 is called increasing if *a**i*<=-<=1<=<<=*a**i* for each *i*:<=0<=<<=*i*<=<<=*t*.
You are given a sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 and a positive integer *d*. In each move you may choose one element of the given sequence and add *d* to it. What is the least number of moves required to make the given sequence increasing?
Input Specification:
The first line of the input contains two integer numbers *n* and *d* (2<=≤<=*n*<=≤<=2000,<=1<=≤<=*d*<=≤<=106). The second line contains space separated sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 (1<=≤<=*b**i*<=≤<=106).
Output Specification:
Output the minimal number of moves needed to make the sequence increasing.
Demo Input:
['4 2\n1 3 3 2\n']
Demo Output:
['3\n']
Note:
none | ```python
first = input().split(" ")
count = 0
n = int(first[0])
d = int(first[1])
line = input().split(" ")
line[0] = int(line[0])
for x in range(1, n):
line[x] = int(line[x])
if line[x-1] >= line[x]:
num = int((line[x-1]-line[x])/d + 0.5)
if num == 0:
num = 1
line[x] += d * num
count += num
print(count)
``` | 0 |
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,641,720,972 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 92 | 0 | enter = input()
l1 = enter.split(" ")
for i in range(len(l1)):
l1[i] = int(l1[i])
c1 = l1[0] // 1
c2 = l1[1] // 2
c3 = c1 * c2
if l1[1] % 2 != 0:
v = l1[0] // 2
c3 += v
print(c3) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
enter = input()
l1 = enter.split(" ")
for i in range(len(l1)):
l1[i] = int(l1[i])
c1 = l1[0] // 1
c2 = l1[1] // 2
c3 = c1 * c2
if l1[1] % 2 != 0:
v = l1[0] // 2
c3 += v
print(c3)
``` | 3.977 |
743 | C | Vladik and fractions | PROGRAMMING | 1,500 | [
"brute force",
"constructive algorithms",
"math",
"number theory"
] | null | null | Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1. | The single line contains single integer *n* (1<=≤<=*n*<=≤<=104). | If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them. | [
"3\n",
"7\n"
] | [
"2 7 42\n",
"7 8 56\n"
] | none | 1,250 | [
{
"input": "3",
"output": "2 7 42"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "2",
"output": "2 3 6"
},
{
"input": "5",
"output": "5 6 30"
},
{
"input": "4",
"output": "4 5 20"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "82",
"output": "82 83 6806"
},
{
"input": "56",
"output": "56 57 3192"
},
{
"input": "30",
"output": "30 31 930"
},
{
"input": "79",
"output": "79 80 6320"
},
{
"input": "28",
"output": "28 29 812"
},
{
"input": "4116",
"output": "4116 4117 16945572"
},
{
"input": "1",
"output": "-1"
},
{
"input": "6491",
"output": "6491 6492 42139572"
},
{
"input": "8865",
"output": "8865 8866 78597090"
},
{
"input": "1239",
"output": "1239 1240 1536360"
},
{
"input": "3614",
"output": "3614 3615 13064610"
},
{
"input": "5988",
"output": "5988 5989 35862132"
},
{
"input": "8363",
"output": "8363 8364 69948132"
},
{
"input": "737",
"output": "737 738 543906"
},
{
"input": "3112",
"output": "3112 3113 9687656"
},
{
"input": "9562",
"output": "9562 9563 91441406"
},
{
"input": "1936",
"output": "1936 1937 3750032"
},
{
"input": "4311",
"output": "4311 4312 18589032"
},
{
"input": "6685",
"output": "6685 6686 44695910"
},
{
"input": "9060",
"output": "9060 9061 82092660"
},
{
"input": "1434",
"output": "1434 1435 2057790"
},
{
"input": "3809",
"output": "3809 3810 14512290"
},
{
"input": "6183",
"output": "6183 6184 38235672"
},
{
"input": "8558",
"output": "8558 8559 73247922"
},
{
"input": "932",
"output": "932 933 869556"
},
{
"input": "7274",
"output": "7274 7275 52918350"
},
{
"input": "9648",
"output": "9648 9649 93093552"
},
{
"input": "2023",
"output": "2023 2024 4094552"
},
{
"input": "4397",
"output": "4397 4398 19338006"
},
{
"input": "6772",
"output": "6772 6773 45866756"
},
{
"input": "9146",
"output": "9146 9147 83658462"
},
{
"input": "1521",
"output": "1521 1522 2314962"
},
{
"input": "4938",
"output": "4938 4939 24388782"
},
{
"input": "6143",
"output": "6143 6144 37742592"
},
{
"input": "6230",
"output": "6230 6231 38819130"
},
{
"input": "10000",
"output": "10000 10001 100010000"
},
{
"input": "1",
"output": "-1"
},
{
"input": "101",
"output": "101 102 10302"
},
{
"input": "9999",
"output": "9999 10000 99990000"
},
{
"input": "512",
"output": "512 513 262656"
},
{
"input": "511",
"output": "511 512 261632"
},
{
"input": "513",
"output": "513 514 263682"
},
{
"input": "9973",
"output": "9973 9974 99470702"
},
{
"input": "9972",
"output": "9972 9973 99450756"
},
{
"input": "9974",
"output": "9974 9975 99490650"
},
{
"input": "9409",
"output": "9409 9410 88538690"
},
{
"input": "9408",
"output": "9408 9409 88519872"
},
{
"input": "9410",
"output": "9410 9411 88557510"
},
{
"input": "719",
"output": "719 720 517680"
},
{
"input": "720",
"output": "720 721 519120"
},
{
"input": "721",
"output": "721 722 520562"
},
{
"input": "9796",
"output": "9796 9797 95971412"
},
{
"input": "9797",
"output": "9797 9798 95991006"
},
{
"input": "9798",
"output": "9798 9799 96010602"
},
{
"input": "4999",
"output": "4999 5000 24995000"
},
{
"input": "9998",
"output": "9998 9999 99970002"
}
] | 1,695,120,923 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 12 | 31 | 0 | # LUOGU_RID: 125213447
n = int(input())
if not n:
print(-1)
exit()
print(n, n+1, n*(n+1))
| Title: Vladik and fractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
Input Specification:
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
Output Specification:
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '7\n']
Demo Output:
['2 7 42\n', '7 8 56\n']
Note:
none | ```python
# LUOGU_RID: 125213447
n = int(input())
if not n:
print(-1)
exit()
print(n, n+1, n*(n+1))
``` | 0 | |
265 | A | Colorful Stones (Simplified Edition) | PROGRAMMING | 800 | [
"implementation"
] | null | null | There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence. | The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence. | Print the final 1-based position of Liss in a single line. | [
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] | [
"2\n",
"3\n",
"15\n"
] | none | 500 | [
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,673,358,209 | 2,147,483,647 | PyPy 3 | OK | TESTS | 19 | 186 | 0 | s = input()
t = input()
count = 0
for i in range(len(t)):
if s[count] == t[i]:
count = count+1
print(count+1)
| Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none | ```python
s = input()
t = input()
count = 0
for i in range(len(t)):
if s[count] == t[i]:
count = count+1
print(count+1)
``` | 3 | |
313 | B | Ilya and Queries | PROGRAMMING | 1,100 | [
"dp",
"implementation"
] | null | null | Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam.
You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=<<=*r**i*), that *s**i*<==<=*s**i*<=+<=1.
Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem. | The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#".
The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*). | Print *m* integers — the answers to the queries in the order in which they are given in the input. | [
"......\n4\n3 4\n2 3\n1 6\n2 6\n",
"#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n"
] | [
"1\n1\n5\n4\n",
"1\n1\n2\n2\n0\n"
] | none | 1,000 | [
{
"input": "......\n4\n3 4\n2 3\n1 6\n2 6",
"output": "1\n1\n5\n4"
},
{
"input": "#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4",
"output": "1\n1\n2\n2\n0"
},
{
"input": ".#...#..\n6\n1 5\n2 3\n6 7\n2 4\n2 5\n1 3",
"output": "2\n0\n0\n1\n2\n0"
},
{
"input": "#.#.#..\n5\n3 4\n4 5\n5 7\n5 7\n1 3",
"output": "0\n0\n1\n1\n0"
},
{
"input": "#.##.##.\n7\n1 8\n2 6\n2 6\n6 8\n3 5\n2 4\n2 5",
"output": "2\n1\n1\n1\n1\n1\n1"
},
{
"input": "#..#\n1\n1 4",
"output": "1"
},
{
"input": "#..##...#.\n7\n5 9\n6 10\n1 7\n5 8\n3 5\n2 10\n3 4",
"output": "2\n2\n3\n2\n1\n4\n0"
},
{
"input": "#.#.#\n7\n1 2\n3 4\n3 5\n2 3\n3 5\n1 5\n1 3",
"output": "0\n0\n0\n0\n0\n0\n0"
},
{
"input": "###..#...#\n2\n2 4\n1 2",
"output": "1\n1"
},
{
"input": "..\n1\n1 2",
"output": "1"
},
{
"input": "##\n1\n1 2",
"output": "1"
},
{
"input": ".#\n1\n1 2",
"output": "0"
},
{
"input": "#.\n1\n1 2",
"output": "0"
},
{
"input": "...\n2\n1 2\n1 2",
"output": "1\n1"
}
] | 1,693,903,884 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 37 | 1,996 | 9,728,000 | s = input()
n = len(s)
dp = [0] * n
for i in range(1, n):
dp[i] = dp[i - 1] + int(s[i] == s[i - 1])
m = int(input())
for _ in range(m):
l, r = map(int, input().split())
print(dp[r - 1] - dp[l - 1])
| Title: Ilya and Queries
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya the Lion wants to help all his friends with passing exams. They need to solve the following problem to pass the IT exam.
You've got string *s*<==<=*s*1*s*2... *s**n* (*n* is the length of the string), consisting only of characters "." and "#" and *m* queries. Each query is described by a pair of integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*). The answer to the query *l**i*,<=*r**i* is the number of such integers *i* (*l**i*<=≤<=*i*<=<<=*r**i*), that *s**i*<==<=*s**i*<=+<=1.
Ilya the Lion wants to help his friends but is there anyone to help him? Help Ilya, solve the problem.
Input Specification:
The first line contains string *s* of length *n* (2<=≤<=*n*<=≤<=105). It is guaranteed that the given string only consists of characters "." and "#".
The next line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. Each of the next *m* lines contains the description of the corresponding query. The *i*-th line contains integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*).
Output Specification:
Print *m* integers — the answers to the queries in the order in which they are given in the input.
Demo Input:
['......\n4\n3 4\n2 3\n1 6\n2 6\n', '#..###\n5\n1 3\n5 6\n1 5\n3 6\n3 4\n']
Demo Output:
['1\n1\n5\n4\n', '1\n1\n2\n2\n0\n']
Note:
none | ```python
s = input()
n = len(s)
dp = [0] * n
for i in range(1, n):
dp[i] = dp[i - 1] + int(s[i] == s[i - 1])
m = int(input())
for _ in range(m):
l, r = map(int, input().split())
print(dp[r - 1] - dp[l - 1])
``` | 3 | |
203 | C | Photographer | PROGRAMMING | 1,400 | [
"greedy",
"sortings"
] | null | null | Valera's lifelong ambition was to be a photographer, so he bought a new camera. Every day he got more and more clients asking for photos, and one day Valera needed a program that would determine the maximum number of people he can serve.
The camera's memory is *d* megabytes. Valera's camera can take photos of high and low quality. One low quality photo takes *a* megabytes of memory, one high quality photo take *b* megabytes of memory. For unknown reasons, each client asks him to make several low quality photos and several high quality photos. More formally, the *i*-th client asks to make *x**i* low quality photos and *y**i* high quality photos.
Valera wants to serve as many clients per day as possible, provided that they will be pleased with his work. To please the *i*-th client, Valera needs to give him everything he wants, that is, to make *x**i* low quality photos and *y**i* high quality photos. To make one low quality photo, the camera must have at least *a* megabytes of free memory space. Similarly, to make one high quality photo, the camera must have at least *b* megabytes of free memory space. Initially the camera's memory is empty. Valera also does not delete photos from the camera so that the camera's memory gradually fills up.
Calculate the maximum number of clients Valera can successfully serve and print the numbers of these clients. | The first line contains two integers *n* and *d* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*d*<=≤<=109) — the number of clients and the camera memory size, correspondingly. The second line contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=104) — the size of one low quality photo and of one high quality photo, correspondingly.
Next *n* lines describe the clients. The *i*-th line contains two integers *x**i* and *y**i* (0<=≤<=*x**i*,<=*y**i*<=≤<=105) — the number of low quality photos and high quality photos the *i*-th client wants, correspondingly.
All numbers on all lines are separated by single spaces. | On the first line print the answer to the problem — the maximum number of clients that Valera can successfully serve. Print on the second line the numbers of the client in any order. All numbers must be distinct. If there are multiple answers, print any of them. The clients are numbered starting with 1 in the order in which they are defined in the input data. | [
"3 10\n2 3\n1 4\n2 1\n1 0\n",
"3 6\n6 6\n1 1\n1 0\n1 0\n"
] | [
"2\n3 2 ",
"1\n2 "
] | none | 1,500 | [
{
"input": "3 10\n2 3\n1 4\n2 1\n1 0",
"output": "2\n3 2 "
},
{
"input": "3 6\n6 6\n1 1\n1 0\n1 0",
"output": "1\n2 "
},
{
"input": "4 5\n6 8\n1 2\n3 0\n10 2\n0 4",
"output": "0"
},
{
"input": "4 10\n6 6\n1 2\n2 2\n0 0\n0 0",
"output": "2\n3 4 "
},
{
"input": "10 10\n1 1\n0 3\n6 4\n3 3\n6 3\n5 2\n6 4\n1 3\n5 5\n2 6\n6 4",
"output": "2\n1 7 "
},
{
"input": "5 5\n1 1\n2 0\n3 2\n4 4\n10 0\n0 1",
"output": "2\n5 1 "
},
{
"input": "4 10\n1 2\n1 0\n0 0\n2 0\n1 3",
"output": "4\n2 1 3 4 "
},
{
"input": "1 22\n3 5\n1 3",
"output": "1\n1 "
},
{
"input": "10 20\n3 5\n3 0\n0 3\n1 2\n1 3\n1 1\n3 0\n0 3\n0 3\n3 1\n3 1",
"output": "2\n5 1 "
},
{
"input": "10 50\n1 1\n7 10\n6 6\n1 0\n2 5\n2 6\n9 7\n3 5\n7 6\n7 10\n7 7",
"output": "6\n3 4 5 7 2 8 "
},
{
"input": "15 30\n13 19\n10 20\n9 0\n11 15\n10 8\n18 3\n13 15\n2 14\n9 16\n8 4\n13 10\n19 2\n13 19\n6 17\n16 4\n15 6",
"output": "0"
},
{
"input": "30 50\n1 3\n2 2\n3 2\n3 3\n0 1\n0 2\n1 3\n1 3\n1 1\n0 1\n0 2\n1 3\n1 0\n1 0\n2 1\n0 1\n0 0\n0 3\n2 3\n2 2\n0 1\n2 3\n2 3\n0 3\n0 3\n3 3\n1 2\n2 1\n1 3\n3 1\n0 3",
"output": "13\n16 12 13 4 9 15 20 8 14 27 5 10 29 "
},
{
"input": "50 50\n6 10\n10 0\n1 9\n8 2\n4 9\n0 7\n2 0\n7 5\n4 8\n10 7\n2 4\n5 6\n6 8\n3 2\n4 6\n7 8\n6 9\n7 7\n7 3\n9 5\n3 10\n7 2\n4 3\n2 0\n6 5\n5 3\n1 7\n1 7\n9 1\n10 4\n10 5\n4 2\n10 10\n0 7\n1 2\n10 1\n1 7\n3 7\n8 7\n5 2\n6 1\n3 1\n4 7\n7 10\n1 5\n10 8\n5 5\n5 1\n3 3\n1 6\n2 1",
"output": "3\n6 23 50 "
},
{
"input": "1 100\n6 10\n14 19",
"output": "0"
},
{
"input": "2 160\n6 9\n11 9\n6 6",
"output": "1\n2 "
},
{
"input": "2 1000000000\n10000 10000\n50000 50000\n100000 100000",
"output": "1\n1 "
},
{
"input": "2 1000000000\n10000 10000\n100000 0\n100000 100000",
"output": "1\n1 "
},
{
"input": "1 1000000000\n1 1\n1 1",
"output": "1\n1 "
},
{
"input": "6 1000000000\n9999 10000\n10000 9998\n10000 10000\n10000 10000\n70000 70000\n10000 10000\n10000 10000",
"output": "5\n1 2 3 5 6 "
},
{
"input": "3 10\n1 10\n0 1\n3 0\n3 0",
"output": "2\n2 3 "
},
{
"input": "2 1000000000\n10000 10000\n0 100000\n100000 100000",
"output": "1\n1 "
},
{
"input": "3 3\n1 1\n3 0\n1 0\n1 0",
"output": "2\n2 3 "
},
{
"input": "2 1000000000\n10000 10000\n100000 100000\n50000 50000",
"output": "1\n2 "
},
{
"input": "2 1000000000\n10000 10000\n0 90000\n100000 100000",
"output": "1\n1 "
},
{
"input": "3 1000000000\n10000 10000\n100000 0\n100000 100000\n0 0",
"output": "2\n3 1 "
},
{
"input": "2 1000000000\n10000 10000\n10000 10000\n100000 100000",
"output": "1\n1 "
},
{
"input": "2 1000000000\n10000 10000\n100000 100000\n100000 0",
"output": "1\n2 "
},
{
"input": "3 1000000000\n10000 10000\n99999 0\n100000 100000\n100000 100000",
"output": "1\n1 "
}
] | 1,453,221,179 | 2,147,483,647 | Python 3 | OK | TESTS | 54 | 1,278 | 11,059,200 | n, d = map(int,input().split())
a, b = map(int,input().split())
l = []
for i in range(1,n+1):
a1, b1 = map(int,input().split())
l.append([a1*a + b1*b, i])
l.sort()
temp = d
ans = []
for i in l:
if i[0] <= temp:
ans.append(i[1])
temp -= i[0]
else:
break
print(len(ans))
print (*ans)
| Title: Photographer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera's lifelong ambition was to be a photographer, so he bought a new camera. Every day he got more and more clients asking for photos, and one day Valera needed a program that would determine the maximum number of people he can serve.
The camera's memory is *d* megabytes. Valera's camera can take photos of high and low quality. One low quality photo takes *a* megabytes of memory, one high quality photo take *b* megabytes of memory. For unknown reasons, each client asks him to make several low quality photos and several high quality photos. More formally, the *i*-th client asks to make *x**i* low quality photos and *y**i* high quality photos.
Valera wants to serve as many clients per day as possible, provided that they will be pleased with his work. To please the *i*-th client, Valera needs to give him everything he wants, that is, to make *x**i* low quality photos and *y**i* high quality photos. To make one low quality photo, the camera must have at least *a* megabytes of free memory space. Similarly, to make one high quality photo, the camera must have at least *b* megabytes of free memory space. Initially the camera's memory is empty. Valera also does not delete photos from the camera so that the camera's memory gradually fills up.
Calculate the maximum number of clients Valera can successfully serve and print the numbers of these clients.
Input Specification:
The first line contains two integers *n* and *d* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*d*<=≤<=109) — the number of clients and the camera memory size, correspondingly. The second line contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=104) — the size of one low quality photo and of one high quality photo, correspondingly.
Next *n* lines describe the clients. The *i*-th line contains two integers *x**i* and *y**i* (0<=≤<=*x**i*,<=*y**i*<=≤<=105) — the number of low quality photos and high quality photos the *i*-th client wants, correspondingly.
All numbers on all lines are separated by single spaces.
Output Specification:
On the first line print the answer to the problem — the maximum number of clients that Valera can successfully serve. Print on the second line the numbers of the client in any order. All numbers must be distinct. If there are multiple answers, print any of them. The clients are numbered starting with 1 in the order in which they are defined in the input data.
Demo Input:
['3 10\n2 3\n1 4\n2 1\n1 0\n', '3 6\n6 6\n1 1\n1 0\n1 0\n']
Demo Output:
['2\n3 2 ', '1\n2 ']
Note:
none | ```python
n, d = map(int,input().split())
a, b = map(int,input().split())
l = []
for i in range(1,n+1):
a1, b1 = map(int,input().split())
l.append([a1*a + b1*b, i])
l.sort()
temp = d
ans = []
for i in l:
if i[0] <= temp:
ans.append(i[1])
temp -= i[0]
else:
break
print(len(ans))
print (*ans)
``` | 3 | |
387 | A | George and Sleep | PROGRAMMING | 900 | [
"implementation"
] | null | null | George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample). | The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59. | In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input. | [
"05:50\n05:44\n",
"00:00\n01:00\n",
"00:01\n00:00\n"
] | [
"00:06\n",
"23:00\n",
"00:01\n"
] | In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all. | 500 | [
{
"input": "05:50\n05:44",
"output": "00:06"
},
{
"input": "00:00\n01:00",
"output": "23:00"
},
{
"input": "00:01\n00:00",
"output": "00:01"
},
{
"input": "23:59\n23:59",
"output": "00:00"
},
{
"input": "23:44\n23:55",
"output": "23:49"
},
{
"input": "00:00\n13:12",
"output": "10:48"
},
{
"input": "12:00\n23:59",
"output": "12:01"
},
{
"input": "12:44\n12:44",
"output": "00:00"
},
{
"input": "05:55\n07:12",
"output": "22:43"
},
{
"input": "07:12\n05:55",
"output": "01:17"
},
{
"input": "22:22\n22:22",
"output": "00:00"
},
{
"input": "22:22\n22:23",
"output": "23:59"
},
{
"input": "23:24\n23:23",
"output": "00:01"
},
{
"input": "00:00\n00:00",
"output": "00:00"
},
{
"input": "23:30\n00:00",
"output": "23:30"
},
{
"input": "01:00\n00:00",
"output": "01:00"
},
{
"input": "05:44\n06:00",
"output": "23:44"
},
{
"input": "00:00\n23:59",
"output": "00:01"
},
{
"input": "21:00\n01:00",
"output": "20:00"
},
{
"input": "21:21\n12:21",
"output": "09:00"
},
{
"input": "12:21\n21:12",
"output": "15:09"
},
{
"input": "12:33\n23:33",
"output": "13:00"
},
{
"input": "07:55\n05:53",
"output": "02:02"
},
{
"input": "19:30\n02:00",
"output": "17:30"
},
{
"input": "21:30\n02:00",
"output": "19:30"
},
{
"input": "19:30\n09:30",
"output": "10:00"
},
{
"input": "13:08\n00:42",
"output": "12:26"
},
{
"input": "13:04\n09:58",
"output": "03:06"
},
{
"input": "21:21\n23:06",
"output": "22:15"
},
{
"input": "20:53\n10:23",
"output": "10:30"
},
{
"input": "12:59\n00:45",
"output": "12:14"
},
{
"input": "12:39\n22:21",
"output": "14:18"
},
{
"input": "21:10\n13:50",
"output": "07:20"
},
{
"input": "03:38\n23:46",
"output": "03:52"
},
{
"input": "03:48\n00:41",
"output": "03:07"
},
{
"input": "07:43\n12:27",
"output": "19:16"
},
{
"input": "03:23\n08:52",
"output": "18:31"
},
{
"input": "16:04\n10:28",
"output": "05:36"
},
{
"input": "12:53\n08:37",
"output": "04:16"
},
{
"input": "13:43\n17:23",
"output": "20:20"
},
{
"input": "00:00\n00:01",
"output": "23:59"
},
{
"input": "10:10\n01:01",
"output": "09:09"
},
{
"input": "10:05\n00:00",
"output": "10:05"
},
{
"input": "09:09\n00:00",
"output": "09:09"
},
{
"input": "09:10\n00:01",
"output": "09:09"
},
{
"input": "23:24\n00:28",
"output": "22:56"
},
{
"input": "10:00\n01:00",
"output": "09:00"
}
] | 1,513,962,666 | 2,147,483,647 | Python 3 | OK | TESTS | 47 | 61 | 5,632,000 | s=input()
t=input()
hrs=int(s[:2])-int(t[:2])
mins=int(s[3:])-int(t[3:])
if mins<0:
mins+=60
hrs-=1
if hrs<0:
hrs+=24
hrs=str(hrs)
mins=str(mins)
if len(hrs)==1:
hrs='0'+hrs
if len(mins)==1:
mins='0'+mins
print(hrs+':'+mins) | Title: George and Sleep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
Input Specification:
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
Output Specification:
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
Demo Input:
['05:50\n05:44\n', '00:00\n01:00\n', '00:01\n00:00\n']
Demo Output:
['00:06\n', '23:00\n', '00:01\n']
Note:
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all. | ```python
s=input()
t=input()
hrs=int(s[:2])-int(t[:2])
mins=int(s[3:])-int(t[3:])
if mins<0:
mins+=60
hrs-=1
if hrs<0:
hrs+=24
hrs=str(hrs)
mins=str(mins)
if len(hrs)==1:
hrs='0'+hrs
if len(mins)==1:
mins='0'+mins
print(hrs+':'+mins)
``` | 3 | |
172 | D | Calendar Reform | PROGRAMMING | 1,500 | [
"*special",
"number theory"
] | null | null | Reforms have started in Berland again! At this time, the Parliament is discussing the reform of the calendar. To make the lives of citizens of Berland more varied, it was decided to change the calendar. As more and more people are complaining that "the years fly by...", it was decided that starting from the next year the number of days per year will begin to grow. So the coming year will have exactly *a* days, the next after coming year will have *a*<=+<=1 days, the next one will have *a*<=+<=2 days and so on. This schedule is planned for the coming *n* years (in the *n*-th year the length of the year will be equal *a*<=+<=*n*<=-<=1 day).
No one has yet decided what will become of months. An MP Palevny made the following proposal.
- The calendar for each month is comfortable to be printed on a square sheet of paper. We are proposed to make the number of days in each month be the square of some integer. The number of days per month should be the same for each month of any year, but may be different for different years. - The number of days in each year must be divisible by the number of days per month in this year. This rule ensures that the number of months in each year is an integer. - The number of days per month for each year must be chosen so as to save the maximum amount of paper to print the calendars. In other words, the number of days per month should be as much as possible.
These rules provide an unambiguous method for choosing the number of days in each month for any given year length. For example, according to Palevny's proposition, a year that consists of 108 days will have three months, 36 days each. The year that consists of 99 days will have 11 months, 9 days each, and a year of 365 days will have 365 months, one day each.
The proposal provoked heated discussion in the community, the famous mathematician Perelmanov quickly calculated that if the proposal is supported, then in a period of *n* years, beginning with the year that has *a* days, the country will spend *p* sheets of paper to print a set of calendars for these years. Perelmanov's calculations take into account the fact that the set will contain one calendar for each year and each month will be printed on a separate sheet.
Repeat Perelmanov's achievement and print the required number *p*. You are given positive integers *a* and *n*. Perelmanov warns you that your program should not work longer than four seconds at the maximum test. | The only input line contains a pair of integers *a*, *n* (1<=≤<=*a*,<=*n*<=≤<=107; *a*<=+<=*n*<=-<=1<=≤<=107). | Print the required number *p*.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use cin, cout streams or the %I64d specifier. | [
"25 3\n",
"50 5\n"
] | [
"30\n",
"125\n"
] | A note to the first sample test. A year of 25 days will consist of one month containing 25 days. A year of 26 days will consist of 26 months, one day each. A year of 27 days will have three months, 9 days each. | 1,500 | [
{
"input": "25 3",
"output": "30"
},
{
"input": "50 5",
"output": "125"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 2",
"output": "3"
},
{
"input": "1 10",
"output": "38"
},
{
"input": "1 5000000",
"output": "8224640917276"
},
{
"input": "5000000 5000000",
"output": "24674231279431"
},
{
"input": "4000000 5000000",
"output": "21384022194564"
},
{
"input": "3000000 5000000",
"output": "18094224526592"
},
{
"input": "1000000 5000000",
"output": "11514506860120"
},
{
"input": "1 10000000",
"output": "32898872196712"
}
] | 1,678,673,309 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 11 | 202 | 82,329,600 | import math
a,n=map(int,input().split())
arr=[0]*10000008
for i in range(1,math.ceil(math.sqrt(10000008))):
for j in range(1,10000008):
if j*i*i>=10000008:
break
arr[j*i*i]=j
count=0
for i in range(a,a+n):
count+=arr[i]
print(count)
| Title: Calendar Reform
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Reforms have started in Berland again! At this time, the Parliament is discussing the reform of the calendar. To make the lives of citizens of Berland more varied, it was decided to change the calendar. As more and more people are complaining that "the years fly by...", it was decided that starting from the next year the number of days per year will begin to grow. So the coming year will have exactly *a* days, the next after coming year will have *a*<=+<=1 days, the next one will have *a*<=+<=2 days and so on. This schedule is planned for the coming *n* years (in the *n*-th year the length of the year will be equal *a*<=+<=*n*<=-<=1 day).
No one has yet decided what will become of months. An MP Palevny made the following proposal.
- The calendar for each month is comfortable to be printed on a square sheet of paper. We are proposed to make the number of days in each month be the square of some integer. The number of days per month should be the same for each month of any year, but may be different for different years. - The number of days in each year must be divisible by the number of days per month in this year. This rule ensures that the number of months in each year is an integer. - The number of days per month for each year must be chosen so as to save the maximum amount of paper to print the calendars. In other words, the number of days per month should be as much as possible.
These rules provide an unambiguous method for choosing the number of days in each month for any given year length. For example, according to Palevny's proposition, a year that consists of 108 days will have three months, 36 days each. The year that consists of 99 days will have 11 months, 9 days each, and a year of 365 days will have 365 months, one day each.
The proposal provoked heated discussion in the community, the famous mathematician Perelmanov quickly calculated that if the proposal is supported, then in a period of *n* years, beginning with the year that has *a* days, the country will spend *p* sheets of paper to print a set of calendars for these years. Perelmanov's calculations take into account the fact that the set will contain one calendar for each year and each month will be printed on a separate sheet.
Repeat Perelmanov's achievement and print the required number *p*. You are given positive integers *a* and *n*. Perelmanov warns you that your program should not work longer than four seconds at the maximum test.
Input Specification:
The only input line contains a pair of integers *a*, *n* (1<=≤<=*a*,<=*n*<=≤<=107; *a*<=+<=*n*<=-<=1<=≤<=107).
Output Specification:
Print the required number *p*.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use cin, cout streams or the %I64d specifier.
Demo Input:
['25 3\n', '50 5\n']
Demo Output:
['30\n', '125\n']
Note:
A note to the first sample test. A year of 25 days will consist of one month containing 25 days. A year of 26 days will consist of 26 months, one day each. A year of 27 days will have three months, 9 days each. | ```python
import math
a,n=map(int,input().split())
arr=[0]*10000008
for i in range(1,math.ceil(math.sqrt(10000008))):
for j in range(1,10000008):
if j*i*i>=10000008:
break
arr[j*i*i]=j
count=0
for i in range(a,a+n):
count+=arr[i]
print(count)
``` | 3 | |
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,639,211,110 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 92 | 0 | a=list(map(int,input().split()))
c=a[0]*a[1]//2
print(c)
| Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
a=list(map(int,input().split()))
c=a[0]*a[1]//2
print(c)
``` | 3.977 |
501 | B | Misha and Changing Handles | PROGRAMMING | 1,100 | [
"data structures",
"dsu",
"strings"
] | null | null | Misha hacked the Codeforces site. Then he decided to let all the users change their handles. A user can now change his handle any number of times. But each new handle must not be equal to any handle that is already used or that was used at some point.
Misha has a list of handle change requests. After completing the requests he wants to understand the relation between the original and the new handles of the users. Help him to do that. | The first line contains integer *q* (1<=≤<=*q*<=≤<=1000), the number of handle change requests.
Next *q* lines contain the descriptions of the requests, one per line.
Each query consists of two non-empty strings *old* and *new*, separated by a space. The strings consist of lowercase and uppercase Latin letters and digits. Strings *old* and *new* are distinct. The lengths of the strings do not exceed 20.
The requests are given chronologically. In other words, by the moment of a query there is a single person with handle *old*, and handle *new* is not used and has not been used by anyone. | In the first line output the integer *n* — the number of users that changed their handles at least once.
In the next *n* lines print the mapping between the old and the new handles of the users. Each of them must contain two strings, *old* and *new*, separated by a space, meaning that before the user had handle *old*, and after all the requests are completed, his handle is *new*. You may output lines in any order.
Each user who changes the handle must occur exactly once in this description. | [
"5\nMisha ILoveCodeforces\nVasya Petrov\nPetrov VasyaPetrov123\nILoveCodeforces MikeMirzayanov\nPetya Ivanov\n"
] | [
"3\nPetya Ivanov\nMisha MikeMirzayanov\nVasya VasyaPetrov123\n"
] | none | 500 | [
{
"input": "5\nMisha ILoveCodeforces\nVasya Petrov\nPetrov VasyaPetrov123\nILoveCodeforces MikeMirzayanov\nPetya Ivanov",
"output": "3\nPetya Ivanov\nMisha MikeMirzayanov\nVasya VasyaPetrov123"
},
{
"input": "1\nMisha Vasya",
"output": "1\nMisha Vasya"
},
{
"input": "10\na b\nb c\nc d\nd e\ne f\nf g\ng h\nh i\ni j\nj k",
"output": "1\na k"
},
{
"input": "5\n123abc abc123\nabc123 a1b2c3\na1b2c3 1A2B3C\n1 2\n2 Misha",
"output": "2\n123abc 1A2B3C\n1 Misha"
},
{
"input": "8\nM F\nS D\n1 2\nF G\n2 R\nD Q\nQ W\nW e",
"output": "3\nM G\n1 R\nS e"
},
{
"input": "17\nn5WhQ VCczxtxKwFio5U\nVCczxtxKwFio5U 1WMVGA17cd1LRcp4r\n1WMVGA17cd1LRcp4r SJl\nSJl D8bPUoIft5v1\nNAvvUgunbPZNCL9ZY2 jnLkarKYsotz\nD8bPUoIft5v1 DnDkHi7\njnLkarKYsotz GfjX109HSQ81gFEBJc\nGfjX109HSQ81gFEBJc kBJ0zrH78mveJ\nkBJ0zrH78mveJ 9DrAypYW\nDnDkHi7 3Wkho2PglMDaFQw\n3Wkho2PglMDaFQw pOqW\n9DrAypYW G3y0cXXGsWAh\npOqW yr1Ec\nG3y0cXXGsWAh HrmWWg5u4Hsy\nyr1Ec GkFeivXjQ01\nGkFeivXjQ01 mSsWgbCCZcotV4goiA\nHrmWWg5u4Hsy zkCmEV",
"output": "2\nn5WhQ mSsWgbCCZcotV4goiA\nNAvvUgunbPZNCL9ZY2 zkCmEV"
},
{
"input": "10\nH1nauWCJOImtVqXk gWPMQ9DHv5CtkYp9lwm9\nSEj 2knOMLyzr\n0v69ijnAc S7d7zGTjmlku01Gv\n2knOMLyzr otGmEd\nacwr3TfMV7oCIp RUSVFa9TIWlLsd7SB\nS7d7zGTjmlku01Gv Gd6ZufVmQnBpi\nS1 WOJLpk\nWOJLpk Gu\nRUSVFa9TIWlLsd7SB RFawatGnbVB\notGmEd OTB1zKiOI",
"output": "5\n0v69ijnAc Gd6ZufVmQnBpi\nS1 Gu\nSEj OTB1zKiOI\nacwr3TfMV7oCIp RFawatGnbVB\nH1nauWCJOImtVqXk gWPMQ9DHv5CtkYp9lwm9"
},
{
"input": "14\nTPdoztSZROpjZe z6F8bYFvnER4V5SP0n\n8Aa3PQY3hzHZTPEUz fhrZZPJ3iUS\nm9p888KaZAoQaO KNmdRSAlUVn8zXOM0\nAO s1VGWTCbHzM\ni 4F\nfhrZZPJ3iUS j0OVZQF6MvNcKN9xDZFJ\nDnlkXtaKNlYEI2ApBuwu DMA9i8ScKRxwhe72a3\nj0OVZQF6MvNcKN9xDZFJ DzjmeNqN0H4Teq0Awr\n4F wJcdxt1kwqfDeJ\nqxXlsa5t RHCL1K6aUyns\nr6WYbDaXt hEHw\nJ0Usg DKdKMFJ6tK8XA\nz6F8bYFvnER4V5SP0n 0alJ\nMijh2O6 qic8kXWuR6",
"output": "10\nTPdoztSZROpjZe 0alJ\nJ0Usg DKdKMFJ6tK8XA\nDnlkXtaKNlYEI2ApBuwu DMA9i8ScKRxwhe72a3\n8Aa3PQY3hzHZTPEUz DzjmeNqN0H4Teq0Awr\nm9p888KaZAoQaO KNmdRSAlUVn8zXOM0\nqxXlsa5t RHCL1K6aUyns\nr6WYbDaXt hEHw\nMijh2O6 qic8kXWuR6\nAO s1VGWTCbHzM\ni wJcdxt1kwqfDeJ"
},
{
"input": "14\nHAXRxayyf1Dj1F0mT hjR4A8IQMb0nyBtqG\nWNuMJa5Jg05qkqZOrL noNkWXrSidHGwxgbQ\nmOitVy6W52s0FENMz6 oLUkLNfojssvLvb1t\nhjR4A8IQMb0nyBtqG oA7uBFu4Oo\noA7uBFu4Oo M450\nM450 LXEzO4\noLUkLNfojssvLvb1t YG5\nnoNkWXrSidHGwxgbQ L\nL YBWzu4W\nYBWzu4W ML\nML scVZE9m8JnH\nLXEzO4 Ne0oBPY0Iy\nscVZE9m8JnH GXhznv\nYG5 UY08abilYF1LaXj49hQ",
"output": "3\nWNuMJa5Jg05qkqZOrL GXhznv\nHAXRxayyf1Dj1F0mT Ne0oBPY0Iy\nmOitVy6W52s0FENMz6 UY08abilYF1LaXj49hQ"
}
] | 1,535,312,499 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 108 | 0 | n = int(input())
d={}
for i in range(n):
s,t = input().split(" ")
d[s] = t
if s in d.values():
del d[s]
for i in d:
if d[i]==s:
d[i]=t
break
for i in d:
print (i,end = " ")
print (d[i])
| Title: Misha and Changing Handles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Misha hacked the Codeforces site. Then he decided to let all the users change their handles. A user can now change his handle any number of times. But each new handle must not be equal to any handle that is already used or that was used at some point.
Misha has a list of handle change requests. After completing the requests he wants to understand the relation between the original and the new handles of the users. Help him to do that.
Input Specification:
The first line contains integer *q* (1<=≤<=*q*<=≤<=1000), the number of handle change requests.
Next *q* lines contain the descriptions of the requests, one per line.
Each query consists of two non-empty strings *old* and *new*, separated by a space. The strings consist of lowercase and uppercase Latin letters and digits. Strings *old* and *new* are distinct. The lengths of the strings do not exceed 20.
The requests are given chronologically. In other words, by the moment of a query there is a single person with handle *old*, and handle *new* is not used and has not been used by anyone.
Output Specification:
In the first line output the integer *n* — the number of users that changed their handles at least once.
In the next *n* lines print the mapping between the old and the new handles of the users. Each of them must contain two strings, *old* and *new*, separated by a space, meaning that before the user had handle *old*, and after all the requests are completed, his handle is *new*. You may output lines in any order.
Each user who changes the handle must occur exactly once in this description.
Demo Input:
['5\nMisha ILoveCodeforces\nVasya Petrov\nPetrov VasyaPetrov123\nILoveCodeforces MikeMirzayanov\nPetya Ivanov\n']
Demo Output:
['3\nPetya Ivanov\nMisha MikeMirzayanov\nVasya VasyaPetrov123\n']
Note:
none | ```python
n = int(input())
d={}
for i in range(n):
s,t = input().split(" ")
d[s] = t
if s in d.values():
del d[s]
for i in d:
if d[i]==s:
d[i]=t
break
for i in d:
print (i,end = " ")
print (d[i])
``` | 0 | |
29 | D | Ant on the Tree | PROGRAMMING | 2,000 | [
"constructive algorithms",
"dfs and similar",
"trees"
] | D. Ant on the Tree | 2 | 256 | Connected undirected graph without cycles is called a tree. Trees is a class of graphs which is interesting not only for people, but for ants too.
An ant stands at the root of some tree. He sees that there are *n* vertexes in the tree, and they are connected by *n*<=-<=1 edges so that there is a path between any pair of vertexes. A leaf is a distinct from root vertex, which is connected with exactly one other vertex.
The ant wants to visit every vertex in the tree and return to the root, passing every edge twice. In addition, he wants to visit the leaves in a specific order. You are to find some possible route of the ant. | The first line contains integer *n* (3<=≤<=*n*<=≤<=300) — amount of vertexes in the tree. Next *n*<=-<=1 lines describe edges. Each edge is described with two integers — indexes of vertexes which it connects. Each edge can be passed in any direction. Vertexes are numbered starting from 1. The root of the tree has number 1. The last line contains *k* integers, where *k* is amount of leaves in the tree. These numbers describe the order in which the leaves should be visited. It is guaranteed that each leaf appears in this order exactly once. | If the required route doesn't exist, output -1. Otherwise, output 2*n*<=-<=1 numbers, describing the route. Every time the ant comes to a vertex, output it's index. | [
"3\n1 2\n2 3\n3\n",
"6\n1 2\n1 3\n2 4\n4 5\n4 6\n5 6 3\n",
"6\n1 2\n1 3\n2 4\n4 5\n4 6\n5 3 6\n"
] | [
"1 2 3 2 1 ",
"1 2 4 5 4 6 4 2 1 3 1 ",
"-1\n"
] | none | 2,000 | [
{
"input": "3\n1 2\n2 3\n3",
"output": "1 2 3 2 1 "
},
{
"input": "6\n1 2\n1 3\n2 4\n4 5\n4 6\n5 6 3",
"output": "1 2 4 5 4 6 4 2 1 3 1 "
},
{
"input": "6\n1 2\n1 3\n2 4\n4 5\n4 6\n5 3 6",
"output": "-1"
},
{
"input": "10\n8 10\n2 1\n7 5\n5 4\n6 10\n2 3\n3 10\n2 9\n7 2\n6 9 4 8",
"output": "-1"
},
{
"input": "8\n4 3\n6 7\n8 6\n6 1\n4 6\n6 5\n6 2\n3 2 7 8 5",
"output": "1 6 4 3 4 6 2 6 7 6 8 6 5 6 1 "
},
{
"input": "8\n4 3\n1 4\n8 5\n7 6\n3 5\n7 3\n4 2\n2 6 8",
"output": "1 4 2 4 3 7 6 7 3 5 8 5 3 4 1 "
},
{
"input": "20\n4 13\n17 7\n19 10\n18 1\n5 15\n2 6\n11 7\n3 6\n5 1\n20 16\n12 5\n10 17\n14 18\n8 13\n13 15\n19 1\n9 19\n6 13\n17 20\n14 12 4 2 3 9 8 11 16",
"output": "-1"
},
{
"input": "37\n27 3\n27 35\n6 8\n12 21\n4 7\n32 27\n27 17\n24 14\n1 10\n3 23\n20 8\n12 4\n16 33\n2 34\n15 36\n5 31\n31 14\n5 9\n8 28\n29 12\n33 35\n24 10\n18 25\n33 18\n2 37\n17 5\n36 29\n12 26\n20 26\n22 11\n23 8\n15 30\n34 6\n13 7\n22 4\n23 19\n37 11 9 32 28 16 21 30 25 19 13",
"output": "-1"
},
{
"input": "51\n28 3\n42 40\n40 51\n48 20\n13 28\n18 40\n44 40\n22 5\n22 27\n45 34\n40 9\n34 46\n40 34\n22 1\n22 11\n40 7\n28 40\n40 22\n14 40\n34 30\n40 20\n47 40\n12 34\n28 23\n40 24\n40 43\n41 40\n28 15\n49 32\n40 8\n32 10\n40 50\n40 36\n40 21\n16 33\n40 38\n34 2\n28 16\n34 4\n17 34\n19 40\n32 35\n40 29\n6 40\n40 39\n22 26\n37 40\n32 40\n31 20\n34 25\n35 15 7 9 12 31 36 50 19 17 29 46 5 42 8 13 10 24 44 25 41 2 38 23 43 30 18 3 26 47 37 11 39 33 49 14 4 45 6 51 48 21 27",
"output": "-1"
},
{
"input": "3\n1 2\n1 3\n2 3",
"output": "1 2 1 3 1 "
},
{
"input": "3\n1 2\n1 3\n3 2",
"output": "1 3 1 2 1 "
},
{
"input": "4\n1 2\n1 3\n1 4\n4 3 2",
"output": "1 4 1 3 1 2 1 "
},
{
"input": "5\n1 2\n4 3\n1 4\n4 5\n5 2 3",
"output": "-1"
}
] | 1,689,319,172 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 35 | 154 | 102,400 | import sys
readline = sys.stdin.readline
N = int(readline())
tree = [[] for _ in range(N + 1)]
weights = [[N + 1 + i, -1] for i in range(N + 1)]
def clear_tree(node: int, parent: int):
tree[node] = list(set(tree[node]) - {parent})
if len(tree[node]) == 0:
return
for child in tree[node]:
clear_tree(child, node)
weights[node][0] = min(weights[node][0], weights[child][0])
weights[node][1] = max(weights[node][1], weights[child][1])
# buf = list(tree[node])
tree[node].sort(key=lambda x: weights[x][0])
for i in range(len(tree[node]) - 1):
if N > weights[tree[node][i]][1] > weights[tree[node][i + 1]][0]:
print(-1)
exit(0)
def travel_tree(node: int) -> list:
result = [node]
for child in tree[node]:
result.extend(travel_tree(child))
result.append(node)
return result
for _ in range(N - 1):
a, b = [int(w) for w in readline().split()]
tree[a].append(b)
tree[b].append(a)
order = [int(w) for w in readline().split()]
for idx, node in enumerate(order):
if len(tree[node]) != 1 or node == 1:
print(-1)
exit(1)
weights[node] = [idx, idx]
clear_tree(1, -1)
print(*travel_tree(1)) | Title: Ant on the Tree
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Connected undirected graph without cycles is called a tree. Trees is a class of graphs which is interesting not only for people, but for ants too.
An ant stands at the root of some tree. He sees that there are *n* vertexes in the tree, and they are connected by *n*<=-<=1 edges so that there is a path between any pair of vertexes. A leaf is a distinct from root vertex, which is connected with exactly one other vertex.
The ant wants to visit every vertex in the tree and return to the root, passing every edge twice. In addition, he wants to visit the leaves in a specific order. You are to find some possible route of the ant.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=300) — amount of vertexes in the tree. Next *n*<=-<=1 lines describe edges. Each edge is described with two integers — indexes of vertexes which it connects. Each edge can be passed in any direction. Vertexes are numbered starting from 1. The root of the tree has number 1. The last line contains *k* integers, where *k* is amount of leaves in the tree. These numbers describe the order in which the leaves should be visited. It is guaranteed that each leaf appears in this order exactly once.
Output Specification:
If the required route doesn't exist, output -1. Otherwise, output 2*n*<=-<=1 numbers, describing the route. Every time the ant comes to a vertex, output it's index.
Demo Input:
['3\n1 2\n2 3\n3\n', '6\n1 2\n1 3\n2 4\n4 5\n4 6\n5 6 3\n', '6\n1 2\n1 3\n2 4\n4 5\n4 6\n5 3 6\n']
Demo Output:
['1 2 3 2 1 ', '1 2 4 5 4 6 4 2 1 3 1 ', '-1\n']
Note:
none | ```python
import sys
readline = sys.stdin.readline
N = int(readline())
tree = [[] for _ in range(N + 1)]
weights = [[N + 1 + i, -1] for i in range(N + 1)]
def clear_tree(node: int, parent: int):
tree[node] = list(set(tree[node]) - {parent})
if len(tree[node]) == 0:
return
for child in tree[node]:
clear_tree(child, node)
weights[node][0] = min(weights[node][0], weights[child][0])
weights[node][1] = max(weights[node][1], weights[child][1])
# buf = list(tree[node])
tree[node].sort(key=lambda x: weights[x][0])
for i in range(len(tree[node]) - 1):
if N > weights[tree[node][i]][1] > weights[tree[node][i + 1]][0]:
print(-1)
exit(0)
def travel_tree(node: int) -> list:
result = [node]
for child in tree[node]:
result.extend(travel_tree(child))
result.append(node)
return result
for _ in range(N - 1):
a, b = [int(w) for w in readline().split()]
tree[a].append(b)
tree[b].append(a)
order = [int(w) for w in readline().split()]
for idx, node in enumerate(order):
if len(tree[node]) != 1 or node == 1:
print(-1)
exit(1)
weights[node] = [idx, idx]
clear_tree(1, -1)
print(*travel_tree(1))
``` | 3.961309 |
373 | A | Collecting Beats is Fun | PROGRAMMING | 900 | [
"implementation"
] | null | null | Cucumber boy is fan of Kyubeat, a famous music game.
Kyubeat has 16 panels for playing arranged in 4<=×<=4 table. When a panel lights up, he has to press that panel.
Each panel has a timing to press (the preffered time when a player should press it), and Cucumber boy is able to press at most *k* panels in a time with his one hand. Cucumber boy is trying to press all panels in perfect timing, that is he wants to press each panel exactly in its preffered time. If he cannot press the panels with his two hands in perfect timing, his challenge to press all the panels in perfect timing will fail.
You are given one scene of Kyubeat's panel from the music Cucumber boy is trying. Tell him is he able to press all the panels in perfect timing. | The first line contains a single integer *k* (1<=≤<=*k*<=≤<=5) — the number of panels Cucumber boy can press with his one hand.
Next 4 lines contain 4 characters each (digits from 1 to 9, or period) — table of panels. If a digit *i* was written on the panel, it means the boy has to press that panel in time *i*. If period was written on the panel, he doesn't have to press that panel. | Output "YES" (without quotes), if he is able to press all the panels in perfect timing. If not, output "NO" (without quotes). | [
"1\n.135\n1247\n3468\n5789\n",
"5\n..1.\n1111\n..1.\n..1.\n",
"1\n....\n12.1\n.2..\n.2..\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | In the third sample boy cannot press all panels in perfect timing. He can press all the panels in timing in time 1, but he cannot press the panels in time 2 in timing with his two hands. | 500 | [
{
"input": "1\n.135\n1247\n3468\n5789",
"output": "YES"
},
{
"input": "5\n..1.\n1111\n..1.\n..1.",
"output": "YES"
},
{
"input": "1\n....\n12.1\n.2..\n.2..",
"output": "NO"
},
{
"input": "1\n6981\n.527\n4163\n2345",
"output": "YES"
},
{
"input": "5\n9999\n9999\n9999\n9999",
"output": "NO"
},
{
"input": "2\n4444\n3333\n2222\n1111",
"output": "YES"
},
{
"input": "3\n2123\n1232\n2321\n3213",
"output": "NO"
},
{
"input": "2\n1...\n.1..\n..1.\n...1",
"output": "YES"
},
{
"input": "2\n1.1.\n.1.1\n2.2.\n.222",
"output": "NO"
},
{
"input": "1\n1..2\n.3.4\n567.\n.89.",
"output": "YES"
},
{
"input": "1\n1122\n3344\n5588\n6699",
"output": "YES"
},
{
"input": "4\n1111\n1221\n1221\n1111",
"output": "NO"
},
{
"input": "5\n3141\n5926\n5358\n9793",
"output": "YES"
},
{
"input": "5\n5454\n4343\n3232\n2121",
"output": "YES"
},
{
"input": "5\n1222\n2221\n2221\n1122",
"output": "NO"
},
{
"input": "1\n....\n5..5\n6..6\n7..7",
"output": "YES"
},
{
"input": "1\n9875\n8643\n7421\n531.",
"output": "YES"
},
{
"input": "1\n..1.\n..1.\n..1.\n..1.",
"output": "NO"
},
{
"input": "4\n4.4.\n4.4.\n4444\n..4.",
"output": "NO"
},
{
"input": "5\n4.4.\n4.4.\n4444\n..4.",
"output": "YES"
},
{
"input": "3\n1.1.\n.1.1\n1.1.\n.1.1",
"output": "NO"
},
{
"input": "2\n1131\n4412\n2569\n3478",
"output": "YES"
},
{
"input": "2\n8888\n8888\n8888\n8888",
"output": "NO"
}
] | 1,692,868,789 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 30 | 0 | k = int(input())
s = 0
jj = 0
v = []
for i in range(4):
row = list(input())
v.append(row)
if k > 1:
print("Yes")
elif k == 1:
for i in range(4):
maxCount = 0
for j in range(4):
count = v[i].count(v[i][j])
if count > maxCount:
maxCount = count
if maxCount > 1 and s <= 1:
jj += 1
if jj != 0:
print("NO")
else:
print("YES")
| Title: Collecting Beats is Fun
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Cucumber boy is fan of Kyubeat, a famous music game.
Kyubeat has 16 panels for playing arranged in 4<=×<=4 table. When a panel lights up, he has to press that panel.
Each panel has a timing to press (the preffered time when a player should press it), and Cucumber boy is able to press at most *k* panels in a time with his one hand. Cucumber boy is trying to press all panels in perfect timing, that is he wants to press each panel exactly in its preffered time. If he cannot press the panels with his two hands in perfect timing, his challenge to press all the panels in perfect timing will fail.
You are given one scene of Kyubeat's panel from the music Cucumber boy is trying. Tell him is he able to press all the panels in perfect timing.
Input Specification:
The first line contains a single integer *k* (1<=≤<=*k*<=≤<=5) — the number of panels Cucumber boy can press with his one hand.
Next 4 lines contain 4 characters each (digits from 1 to 9, or period) — table of panels. If a digit *i* was written on the panel, it means the boy has to press that panel in time *i*. If period was written on the panel, he doesn't have to press that panel.
Output Specification:
Output "YES" (without quotes), if he is able to press all the panels in perfect timing. If not, output "NO" (without quotes).
Demo Input:
['1\n.135\n1247\n3468\n5789\n', '5\n..1.\n1111\n..1.\n..1.\n', '1\n....\n12.1\n.2..\n.2..\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the third sample boy cannot press all panels in perfect timing. He can press all the panels in timing in time 1, but he cannot press the panels in time 2 in timing with his two hands. | ```python
k = int(input())
s = 0
jj = 0
v = []
for i in range(4):
row = list(input())
v.append(row)
if k > 1:
print("Yes")
elif k == 1:
for i in range(4):
maxCount = 0
for j in range(4):
count = v[i].count(v[i][j])
if count > maxCount:
maxCount = count
if maxCount > 1 and s <= 1:
jj += 1
if jj != 0:
print("NO")
else:
print("YES")
``` | 0 | |
2 | A | Winner | PROGRAMMING | 1,500 | [
"hashing",
"implementation"
] | A. Winner | 1 | 64 | The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points. | The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive. | Print the name of the winner. | [
"3\nmike 3\nandrew 5\nmike 2\n",
"3\nandrew 3\nandrew 2\nmike 5\n"
] | [
"andrew\n",
"andrew\n"
] | none | 0 | [
{
"input": "3\nmike 3\nandrew 5\nmike 2",
"output": "andrew"
},
{
"input": "3\nandrew 3\nandrew 2\nmike 5",
"output": "andrew"
},
{
"input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303",
"output": "kaxqybeultn"
},
{
"input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734",
"output": "ksjuuerbnlklcfdjeyq"
},
{
"input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879",
"output": "fcgslzkicjrpbqaifgweyzreajjfdo"
},
{
"input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735",
"output": "aawtvezfntstrcpgbzjbf"
},
{
"input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158",
"output": "ivhgbxiv"
}
] | 1,520,624,844 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 92 | 5,632,000 | n = int(input())
res = {}
inp = []
names = set()
max_score = -1E16
for k in range(n):
a = input().split(' ')
name, score = a[0], int(a[1])
inp.append(list((name, score)))
res[name] = res.get(name, 0) + score
for i, j in res.items():
max_score = max(max_score, j)
for i, j in res.items():
if j == max_score:
names.add(i)
max_name = ""
res = {}
for k in range(n):
name, score = inp[k][0], inp[k][1]
res[name] = res.get(name, 0) + score
if res[name] == max_score and name in names:
max_name = name
break
print(max_name)
| Title: Winner
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
Input Specification:
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Output Specification:
Print the name of the winner.
Demo Input:
['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n']
Demo Output:
['andrew\n', 'andrew\n']
Note:
none | ```python
n = int(input())
res = {}
inp = []
names = set()
max_score = -1E16
for k in range(n):
a = input().split(' ')
name, score = a[0], int(a[1])
inp.append(list((name, score)))
res[name] = res.get(name, 0) + score
for i, j in res.items():
max_score = max(max_score, j)
for i, j in res.items():
if j == max_score:
names.add(i)
max_name = ""
res = {}
for k in range(n):
name, score = inp[k][0], inp[k][1]
res[name] = res.get(name, 0) + score
if res[name] == max_score and name in names:
max_name = name
break
print(max_name)
``` | 0 |
41 | A | Translation | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Translation | 2 | 256 | The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. | The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. | If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. | [
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,637,478,575 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 92 | 0 | word=input()
word1=input()
reversed_word=''
inde=-1
for i in word:
reversed_word+=word[inde]
inde-=1
if reversed_word==word1:
print('YES')
else:
print('NO') | Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
word=input()
word1=input()
reversed_word=''
inde=-1
for i in word:
reversed_word+=word[inde]
inde-=1
if reversed_word==word1:
print('YES')
else:
print('NO')
``` | 3.977 |
421 | A | Pasha and Hamsters | PROGRAMMING | 800 | [
"constructive algorithms",
"implementation"
] | null | null | Pasha has two hamsters: Arthur and Alexander. Pasha put *n* apples in front of them. Pasha knows which apples Arthur likes. Similarly, Pasha knows which apples Alexander likes. Pasha doesn't want any conflict between the hamsters (as they may like the same apple), so he decided to distribute the apples between the hamsters on his own. He is going to give some apples to Arthur and some apples to Alexander. It doesn't matter how many apples each hamster gets but it is important that each hamster gets only the apples he likes. It is possible that somebody doesn't get any apples.
Help Pasha distribute all the apples between the hamsters. Note that Pasha wants to distribute all the apples, not just some of them. | The first line contains integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=100; 1<=≤<=*a*,<=*b*<=≤<=*n*) — the number of apples Pasha has, the number of apples Arthur likes and the number of apples Alexander likes, correspondingly.
The next line contains *a* distinct integers — the numbers of the apples Arthur likes. The next line contains *b* distinct integers — the numbers of the apples Alexander likes.
Assume that the apples are numbered from 1 to *n*. The input is such that the answer exists. | Print *n* characters, each of them equals either 1 or 2. If the *i*-h character equals 1, then the *i*-th apple should be given to Arthur, otherwise it should be given to Alexander. If there are multiple correct answers, you are allowed to print any of them. | [
"4 2 3\n1 2\n2 3 4\n",
"5 5 2\n3 4 1 2 5\n2 3\n"
] | [
"1 1 2 2\n",
"1 1 1 1 1\n"
] | none | 500 | [
{
"input": "4 2 3\n1 2\n2 3 4",
"output": "1 1 2 2"
},
{
"input": "5 5 2\n3 4 1 2 5\n2 3",
"output": "1 1 1 1 1"
},
{
"input": "100 69 31\n1 3 4 5 6 7 8 9 10 11 12 14 15 16 17 18 19 20 21 24 26 27 29 31 37 38 39 40 44 46 48 49 50 51 53 55 56 57 58 59 60 61 63 64 65 66 67 68 69 70 71 72 74 76 77 78 79 80 81 82 83 89 92 94 95 97 98 99 100\n2 13 22 23 25 28 30 32 33 34 35 36 41 42 43 45 47 52 54 62 73 75 84 85 86 87 88 90 91 93 96",
"output": "1 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 1 1 2 1 2 1 2 2 2 2 2 1 1 1 1 2 2 2 1 2 1 2 1 1 1 1 2 1 2 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 2 2 2 2 2 1 2 2 1 2 1 1 2 1 1 1 1"
},
{
"input": "100 56 44\n1 2 5 8 14 15 17 18 20 21 23 24 25 27 30 33 34 35 36 38 41 42 44 45 46 47 48 49 50 53 56 58 59 60 62 63 64 65 68 69 71 75 76 80 81 84 87 88 90 91 92 94 95 96 98 100\n3 4 6 7 9 10 11 12 13 16 19 22 26 28 29 31 32 37 39 40 43 51 52 54 55 57 61 66 67 70 72 73 74 77 78 79 82 83 85 86 89 93 97 99",
"output": "1 1 2 2 1 2 2 1 2 2 2 2 2 1 1 2 1 1 2 1 1 2 1 1 1 2 1 2 2 1 2 2 1 1 1 1 2 1 2 2 1 1 2 1 1 1 1 1 1 1 2 2 1 2 2 1 2 1 1 1 2 1 1 1 1 2 2 1 1 2 1 2 2 2 1 1 2 2 2 1 1 2 2 1 2 2 1 1 2 1 1 1 2 1 1 1 2 1 2 1"
},
{
"input": "100 82 18\n1 2 3 4 5 6 7 8 9 10 11 13 14 15 16 17 18 19 20 22 23 25 27 29 30 31 32 33 34 35 36 37 38 42 43 44 45 46 47 48 49 50 51 53 54 55 57 58 59 60 61 62 63 64 65 66 67 68 69 71 72 73 74 75 77 78 79 80 82 83 86 88 90 91 92 93 94 96 97 98 99 100\n12 21 24 26 28 39 40 41 52 56 70 76 81 84 85 87 89 95",
"output": "1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 2 2 2 1 1 1 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 2 1 1 1 1 1 2 1 1 1 1 1"
},
{
"input": "99 72 27\n1 2 3 4 5 6 7 8 10 11 12 13 14 15 16 17 20 23 25 26 28 29 30 32 33 34 35 36 39 41 42 43 44 45 46 47 50 51 52 54 55 56 58 59 60 61 62 67 70 71 72 74 75 76 77 80 81 82 84 85 86 88 90 91 92 93 94 95 96 97 98 99\n9 18 19 21 22 24 27 31 37 38 40 48 49 53 57 63 64 65 66 68 69 73 78 79 83 87 89",
"output": "1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 1 1 1 1 1 1 2 2 1 1 1 2 1 1 1 2 1 1 1 1 1 2 2 2 2 1 2 2 1 1 1 2 1 1 1 1 2 2 1 1 1 2 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "99 38 61\n1 3 10 15 16 22 23 28 31 34 35 36 37 38 39 43 44 49 50 53 56 60 63 68 69 70 72 74 75 77 80 81 83 85 96 97 98 99\n2 4 5 6 7 8 9 11 12 13 14 17 18 19 20 21 24 25 26 27 29 30 32 33 40 41 42 45 46 47 48 51 52 54 55 57 58 59 61 62 64 65 66 67 71 73 76 78 79 82 84 86 87 88 89 90 91 92 93 94 95",
"output": "1 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 2 2 2 2 2 1 1 2 2 2 2 1 2 2 1 2 2 1 1 1 1 1 1 2 2 2 1 1 2 2 2 2 1 1 2 2 1 2 2 1 2 2 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 1 1 2 1 2 2 1 1 2 1 2 1 2 2 2 2 2 2 2 2 2 2 1 1 1 1"
},
{
"input": "99 84 15\n1 2 3 5 6 7 8 9 10 11 12 13 14 15 16 17 19 20 21 22 23 24 25 26 27 28 29 30 31 32 34 35 36 37 38 39 40 41 42 43 44 47 48 50 51 52 53 55 56 58 59 60 61 62 63 64 65 68 69 70 71 72 73 74 75 77 79 80 81 82 83 84 85 86 87 89 90 91 92 93 94 97 98 99\n4 18 33 45 46 49 54 57 66 67 76 78 88 95 96",
"output": "1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 1 1 2 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 2 1 2 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 2 2 1 1 1"
},
{
"input": "4 3 1\n1 3 4\n2",
"output": "1 2 1 1"
},
{
"input": "4 3 1\n1 2 4\n3",
"output": "1 1 2 1"
},
{
"input": "4 2 2\n2 3\n1 4",
"output": "2 1 1 2"
},
{
"input": "4 3 1\n2 3 4\n1",
"output": "2 1 1 1"
},
{
"input": "1 1 1\n1\n1",
"output": "1"
},
{
"input": "2 1 1\n2\n1",
"output": "2 1"
},
{
"input": "2 1 1\n1\n2",
"output": "1 2"
},
{
"input": "3 3 1\n1 2 3\n1",
"output": "1 1 1"
},
{
"input": "3 3 1\n1 2 3\n3",
"output": "1 1 1"
},
{
"input": "3 2 1\n1 3\n2",
"output": "1 2 1"
},
{
"input": "100 1 100\n84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "100 100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n17",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "98 51 47\n1 2 3 4 6 7 8 10 13 15 16 18 19 21 22 23 25 26 27 29 31 32 36 37 39 40 41 43 44 48 49 50 51 52 54 56 58 59 65 66 68 79 80 84 86 88 89 90 94 95 97\n5 9 11 12 14 17 20 24 28 30 33 34 35 38 42 45 46 47 53 55 57 60 61 62 63 64 67 69 70 71 72 73 74 75 76 77 78 81 82 83 85 87 91 92 93 96 98",
"output": "1 1 1 1 2 1 1 1 2 1 2 2 1 2 1 1 2 1 1 2 1 1 1 2 1 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 1 1 2 2 2 1 1 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 1 2 1 2 2 2 2 2 2 2 2 2 2 1 1 2 2 2 1 2 1 2 1 1 1 2 2 2 1 1 2 1 2"
},
{
"input": "98 28 70\n1 13 15 16 19 27 28 40 42 43 46 53 54 57 61 63 67 68 69 71 75 76 78 80 88 93 97 98\n2 3 4 5 6 7 8 9 10 11 12 14 17 18 20 21 22 23 24 25 26 29 30 31 32 33 34 35 36 37 38 39 41 44 45 47 48 49 50 51 52 55 56 58 59 60 62 64 65 66 70 72 73 74 77 79 81 82 83 84 85 86 87 89 90 91 92 94 95 96",
"output": "1 2 2 2 2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 2 2 2 1 1 2 2 1 2 2 2 1 2 1 2 2 2 1 1 1 2 1 2 2 2 1 1 2 1 2 1 2 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 1 1"
},
{
"input": "97 21 76\n7 10 16 17 26 30 34 39 40 42 44 46 53 54 56 64 67 72 78 79 94\n1 2 3 4 5 6 8 9 11 12 13 14 15 18 19 20 21 22 23 24 25 27 28 29 31 32 33 35 36 37 38 41 43 45 47 48 49 50 51 52 55 57 58 59 60 61 62 63 65 66 68 69 70 71 73 74 75 76 77 80 81 82 83 84 85 86 87 88 89 90 91 92 93 95 96 97",
"output": "2 2 2 2 2 2 1 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 1 2 2 2 1 2 2 2 1 2 2 2 2 1 1 2 1 2 1 2 1 2 2 2 2 2 2 1 1 2 1 2 2 2 2 2 2 2 1 2 2 1 2 2 2 2 1 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2"
},
{
"input": "97 21 76\n1 10 12 13 17 18 22 25 31 48 50 54 61 64 67 74 78 81 86 88 94\n2 3 4 5 6 7 8 9 11 14 15 16 19 20 21 23 24 26 27 28 29 30 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 49 51 52 53 55 56 57 58 59 60 62 63 65 66 68 69 70 71 72 73 75 76 77 79 80 82 83 84 85 87 89 90 91 92 93 95 96 97",
"output": "1 2 2 2 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 2 1 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 1 2 2 2 2 2 2 1 2 2 1 2 2 1 2 2 2 2 2 2 1 2 2 2 1 2 2 1 2 2 2 2 1 2 1 2 2 2 2 2 1 2 2 2"
},
{
"input": "96 10 86\n2 5 31 37 68 69 80 82 90 91\n1 3 4 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 32 33 34 35 36 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 70 71 72 73 74 75 76 77 78 79 81 83 84 85 86 87 88 89 92 93 94 95 96",
"output": "2 1 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 2 2 2 2 2 2 2 2 2 2 1 2 1 2 2 2 2 2 2 2 1 1 2 2 2 2 2"
},
{
"input": "95 4 91\n58 65 70 93\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 59 60 61 62 63 64 66 67 68 69 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 94 95",
"output": "2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2"
},
{
"input": "98 88 10\n1 2 4 5 6 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 33 34 35 36 38 39 40 41 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 62 63 64 65 66 67 68 69 71 72 73 74 75 76 77 79 80 81 83 84 85 86 87 88 89 90 92 93 94 95 96 97 98\n3 7 32 37 42 61 70 78 82 91",
"output": "1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 2 1 1 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1 2 1 1 1 2 1 1 1 1 1 1 1 1 2 1 1 1 1 1 1 1"
},
{
"input": "98 96 2\n1 2 3 4 5 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98\n6 7",
"output": "1 1 1 1 1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "97 97 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97\n94",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "97 97 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97\n20",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "96 96 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96\n48",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "95 95 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95\n55",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1"
}
] | 1,626,342,102 | 2,147,483,647 | PyPy 3 | OK | TESTS | 32 | 109 | 20,172,800 | n, a, b = map(int, input().split())
x = list(map(int, input().split()[:a]))
y = list(map(int, input().split()[:b]))
for i in range(1, n + 1):
if i in x:
print(1, end = " ")
else :
print(2, end = " ") | Title: Pasha and Hamsters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has two hamsters: Arthur and Alexander. Pasha put *n* apples in front of them. Pasha knows which apples Arthur likes. Similarly, Pasha knows which apples Alexander likes. Pasha doesn't want any conflict between the hamsters (as they may like the same apple), so he decided to distribute the apples between the hamsters on his own. He is going to give some apples to Arthur and some apples to Alexander. It doesn't matter how many apples each hamster gets but it is important that each hamster gets only the apples he likes. It is possible that somebody doesn't get any apples.
Help Pasha distribute all the apples between the hamsters. Note that Pasha wants to distribute all the apples, not just some of them.
Input Specification:
The first line contains integers *n*, *a*, *b* (1<=≤<=*n*<=≤<=100; 1<=≤<=*a*,<=*b*<=≤<=*n*) — the number of apples Pasha has, the number of apples Arthur likes and the number of apples Alexander likes, correspondingly.
The next line contains *a* distinct integers — the numbers of the apples Arthur likes. The next line contains *b* distinct integers — the numbers of the apples Alexander likes.
Assume that the apples are numbered from 1 to *n*. The input is such that the answer exists.
Output Specification:
Print *n* characters, each of them equals either 1 or 2. If the *i*-h character equals 1, then the *i*-th apple should be given to Arthur, otherwise it should be given to Alexander. If there are multiple correct answers, you are allowed to print any of them.
Demo Input:
['4 2 3\n1 2\n2 3 4\n', '5 5 2\n3 4 1 2 5\n2 3\n']
Demo Output:
['1 1 2 2\n', '1 1 1 1 1\n']
Note:
none | ```python
n, a, b = map(int, input().split())
x = list(map(int, input().split()[:a]))
y = list(map(int, input().split()[:b]))
for i in range(1, n + 1):
if i in x:
print(1, end = " ")
else :
print(2, end = " ")
``` | 3 | |
633 | A | Ebony and Ivory | PROGRAMMING | 1,100 | [
"brute force",
"math",
"number theory"
] | null | null | Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots.
For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible. | The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively. | Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise. | [
"4 6 15\n",
"3 2 7\n",
"6 11 6\n"
] | [
"No\n",
"Yes\n",
"Yes\n"
] | In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage. | 250 | [
{
"input": "4 6 15",
"output": "No"
},
{
"input": "3 2 7",
"output": "Yes"
},
{
"input": "6 11 6",
"output": "Yes"
},
{
"input": "3 12 15",
"output": "Yes"
},
{
"input": "5 5 10",
"output": "Yes"
},
{
"input": "6 6 7",
"output": "No"
},
{
"input": "1 1 20",
"output": "Yes"
},
{
"input": "12 14 19",
"output": "No"
},
{
"input": "15 12 26",
"output": "No"
},
{
"input": "2 4 8",
"output": "Yes"
},
{
"input": "4 5 30",
"output": "Yes"
},
{
"input": "4 5 48",
"output": "Yes"
},
{
"input": "2 17 105",
"output": "Yes"
},
{
"input": "10 25 282",
"output": "No"
},
{
"input": "6 34 323",
"output": "No"
},
{
"input": "2 47 464",
"output": "Yes"
},
{
"input": "4 53 113",
"output": "Yes"
},
{
"input": "6 64 546",
"output": "Yes"
},
{
"input": "1 78 725",
"output": "Yes"
},
{
"input": "1 84 811",
"output": "Yes"
},
{
"input": "3 100 441",
"output": "Yes"
},
{
"input": "20 5 57",
"output": "No"
},
{
"input": "14 19 143",
"output": "No"
},
{
"input": "17 23 248",
"output": "No"
},
{
"input": "11 34 383",
"output": "Yes"
},
{
"input": "20 47 568",
"output": "Yes"
},
{
"input": "16 58 410",
"output": "Yes"
},
{
"input": "11 70 1199",
"output": "Yes"
},
{
"input": "16 78 712",
"output": "Yes"
},
{
"input": "20 84 562",
"output": "No"
},
{
"input": "19 100 836",
"output": "Yes"
},
{
"input": "23 10 58",
"output": "No"
},
{
"input": "25 17 448",
"output": "Yes"
},
{
"input": "22 24 866",
"output": "Yes"
},
{
"input": "24 35 67",
"output": "No"
},
{
"input": "29 47 264",
"output": "Yes"
},
{
"input": "23 56 45",
"output": "No"
},
{
"input": "25 66 1183",
"output": "Yes"
},
{
"input": "21 71 657",
"output": "Yes"
},
{
"input": "29 81 629",
"output": "No"
},
{
"input": "23 95 2226",
"output": "Yes"
},
{
"input": "32 4 62",
"output": "No"
},
{
"input": "37 15 789",
"output": "Yes"
},
{
"input": "39 24 999",
"output": "Yes"
},
{
"input": "38 32 865",
"output": "No"
},
{
"input": "32 50 205",
"output": "No"
},
{
"input": "31 57 1362",
"output": "Yes"
},
{
"input": "38 68 1870",
"output": "Yes"
},
{
"input": "36 76 549",
"output": "No"
},
{
"input": "35 84 1257",
"output": "No"
},
{
"input": "39 92 2753",
"output": "Yes"
},
{
"input": "44 1 287",
"output": "Yes"
},
{
"input": "42 12 830",
"output": "No"
},
{
"input": "42 27 9",
"output": "No"
},
{
"input": "49 40 1422",
"output": "No"
},
{
"input": "44 42 2005",
"output": "No"
},
{
"input": "50 55 2479",
"output": "No"
},
{
"input": "48 65 917",
"output": "No"
},
{
"input": "45 78 152",
"output": "No"
},
{
"input": "43 90 4096",
"output": "Yes"
},
{
"input": "43 94 4316",
"output": "Yes"
},
{
"input": "60 7 526",
"output": "Yes"
},
{
"input": "53 11 735",
"output": "Yes"
},
{
"input": "52 27 609",
"output": "Yes"
},
{
"input": "57 32 992",
"output": "Yes"
},
{
"input": "52 49 421",
"output": "No"
},
{
"input": "57 52 2634",
"output": "Yes"
},
{
"input": "54 67 3181",
"output": "Yes"
},
{
"input": "52 73 638",
"output": "No"
},
{
"input": "57 84 3470",
"output": "No"
},
{
"input": "52 100 5582",
"output": "No"
},
{
"input": "62 1 501",
"output": "Yes"
},
{
"input": "63 17 858",
"output": "Yes"
},
{
"input": "70 24 1784",
"output": "Yes"
},
{
"input": "65 32 1391",
"output": "Yes"
},
{
"input": "62 50 2775",
"output": "No"
},
{
"input": "62 58 88",
"output": "No"
},
{
"input": "66 68 3112",
"output": "Yes"
},
{
"input": "61 71 1643",
"output": "No"
},
{
"input": "69 81 3880",
"output": "No"
},
{
"input": "63 100 1960",
"output": "Yes"
},
{
"input": "73 6 431",
"output": "Yes"
},
{
"input": "75 19 736",
"output": "Yes"
},
{
"input": "78 25 247",
"output": "No"
},
{
"input": "79 36 2854",
"output": "Yes"
},
{
"input": "80 43 1864",
"output": "Yes"
},
{
"input": "76 55 2196",
"output": "Yes"
},
{
"input": "76 69 4122",
"output": "Yes"
},
{
"input": "76 76 4905",
"output": "No"
},
{
"input": "75 89 3056",
"output": "Yes"
},
{
"input": "73 100 3111",
"output": "Yes"
},
{
"input": "84 9 530",
"output": "No"
},
{
"input": "82 18 633",
"output": "No"
},
{
"input": "85 29 2533",
"output": "Yes"
},
{
"input": "89 38 2879",
"output": "Yes"
},
{
"input": "89 49 2200",
"output": "Yes"
},
{
"input": "88 60 4140",
"output": "Yes"
},
{
"input": "82 68 1299",
"output": "No"
},
{
"input": "90 76 2207",
"output": "No"
},
{
"input": "83 84 4923",
"output": "Yes"
},
{
"input": "89 99 7969",
"output": "Yes"
},
{
"input": "94 9 168",
"output": "No"
},
{
"input": "91 20 1009",
"output": "No"
},
{
"input": "93 23 2872",
"output": "Yes"
},
{
"input": "97 31 3761",
"output": "Yes"
},
{
"input": "99 46 1341",
"output": "Yes"
},
{
"input": "98 51 2845",
"output": "No"
},
{
"input": "93 66 3412",
"output": "No"
},
{
"input": "95 76 3724",
"output": "Yes"
},
{
"input": "91 87 6237",
"output": "Yes"
},
{
"input": "98 97 7886",
"output": "Yes"
},
{
"input": "12 17 15",
"output": "No"
},
{
"input": "93 94 95",
"output": "No"
},
{
"input": "27 43 27",
"output": "Yes"
},
{
"input": "17 43 68",
"output": "Yes"
},
{
"input": "44 12 12",
"output": "Yes"
},
{
"input": "44 50 150",
"output": "Yes"
},
{
"input": "1 1 10000",
"output": "Yes"
},
{
"input": "2 3 10000",
"output": "Yes"
},
{
"input": "100 1 10",
"output": "Yes"
},
{
"input": "3 2 1",
"output": "No"
},
{
"input": "1 1 1",
"output": "Yes"
},
{
"input": "9 9 10000",
"output": "No"
},
{
"input": "2 3 9995",
"output": "Yes"
},
{
"input": "3 5 4",
"output": "No"
},
{
"input": "99 98 100",
"output": "No"
},
{
"input": "6 10 2",
"output": "No"
},
{
"input": "1 6 5",
"output": "Yes"
},
{
"input": "1 4 3",
"output": "Yes"
},
{
"input": "3 2 3",
"output": "Yes"
},
{
"input": "1 7 6",
"output": "Yes"
},
{
"input": "2 3 9871",
"output": "Yes"
},
{
"input": "10 5 5",
"output": "Yes"
},
{
"input": "10 8 2",
"output": "No"
}
] | 1,500,102,277 | 2,147,483,647 | Python 3 | OK | TESTS | 134 | 62 | 5,529,600 | string = input()
a, b, n = map(int, string.split())
for x in range(n // a + 1):
if (n - a * x) % b == 0:
print("Yes")
break
else:
print("No") | Title: Ebony and Ivory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots.
For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible.
Input Specification:
The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively.
Output Specification:
Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise.
Demo Input:
['4 6 15\n', '3 2 7\n', '6 11 6\n']
Demo Output:
['No\n', 'Yes\n', 'Yes\n']
Note:
In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage. | ```python
string = input()
a, b, n = map(int, string.split())
for x in range(n // a + 1):
if (n - a * x) % b == 0:
print("Yes")
break
else:
print("No")
``` | 3 | |
251 | A | Points on Line | PROGRAMMING | 1,300 | [
"binary search",
"combinatorics",
"two pointers"
] | null | null | Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter. | The first line contains two integers: *n* and *d* (1<=≤<=*n*<=≤<=105; 1<=≤<=*d*<=≤<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 — the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase. | Print a single integer — the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"4 3\n1 2 3 4\n",
"4 2\n-3 -2 -1 0\n",
"5 19\n1 10 20 30 50\n"
] | [
"4\n",
"2\n",
"1\n"
] | In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}. | 500 | [
{
"input": "4 3\n1 2 3 4",
"output": "4"
},
{
"input": "4 2\n-3 -2 -1 0",
"output": "2"
},
{
"input": "5 19\n1 10 20 30 50",
"output": "1"
},
{
"input": "10 5\n31 36 43 47 48 50 56 69 71 86",
"output": "2"
},
{
"input": "10 50\n1 4 20 27 65 79 82 83 99 100",
"output": "25"
},
{
"input": "10 90\n24 27 40 41 61 69 73 87 95 97",
"output": "120"
},
{
"input": "100 100\n-98 -97 -96 -93 -92 -91 -90 -87 -86 -84 -81 -80 -79 -78 -76 -75 -73 -71 -69 -67 -65 -64 -63 -62 -61 -54 -51 -50 -49 -48 -46 -45 -44 -37 -36 -33 -30 -28 -27 -16 -15 -13 -12 -10 -9 -7 -6 -5 -4 2 3 5 8 9 10 11 13 14 15 16 17 19 22 24 25 26 27 28 30 31 32 36 40 43 45 46 47 50 51 52 53 58 60 63 69 70 73 78 80 81 82 85 88 89 90 91 95 96 97 99",
"output": "79351"
},
{
"input": "1 14751211\n847188590",
"output": "0"
},
{
"input": "2 1000000000\n-907894512 -289906312",
"output": "0"
},
{
"input": "2 1000000000\n-14348867 1760823",
"output": "0"
},
{
"input": "3 1000000000\n-5 -1 1",
"output": "1"
}
] | 1,689,425,115 | 2,147,483,647 | PyPy 3 | OK | TESTS | 39 | 404 | 11,059,200 |
from collections import defaultdict
import math
import sys
from bisect import bisect_right
def clc():
n,d = map(int,input().split())
arr = list(map(int,input().split()))
arr = sorted(arr)
ans= 0
for i in range(0,len(arr)):
curr = arr[i]
back = curr-d-1
ind = bisect_right(arr,back)
contri = ((i-ind)*(i-ind-1))//2
ans+=contri
print(ans)
return True
cc = clc()
if not cc :
print(-1)
| Title: Points on Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter.
Input Specification:
The first line contains two integers: *n* and *d* (1<=≤<=*n*<=≤<=105; 1<=≤<=*d*<=≤<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 — the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase.
Output Specification:
Print a single integer — the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n1 2 3 4\n', '4 2\n-3 -2 -1 0\n', '5 19\n1 10 20 30 50\n']
Demo Output:
['4\n', '2\n', '1\n']
Note:
In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}. | ```python
from collections import defaultdict
import math
import sys
from bisect import bisect_right
def clc():
n,d = map(int,input().split())
arr = list(map(int,input().split()))
arr = sorted(arr)
ans= 0
for i in range(0,len(arr)):
curr = arr[i]
back = curr-d-1
ind = bisect_right(arr,back)
contri = ((i-ind)*(i-ind-1))//2
ans+=contri
print(ans)
return True
cc = clc()
if not cc :
print(-1)
``` | 3 | |
412 | B | Network Configuration | PROGRAMMING | 900 | [
"greedy",
"sortings"
] | null | null | The R1 company wants to hold a web search championship. There were *n* computers given for the competition, each of them is connected to the Internet. The organizers believe that the data transfer speed directly affects the result. The higher the speed of the Internet is, the faster the participant will find the necessary information. Therefore, before the competition started, each computer had its maximum possible data transfer speed measured. On the *i*-th computer it was *a**i* kilobits per second.
There will be *k* participants competing in the championship, each should get a separate computer. The organizing company does not want any of the participants to have an advantage over the others, so they want to provide the same data transfer speed to each participant's computer. Also, the organizers want to create the most comfortable conditions for the participants, so the data transfer speed on the participants' computers should be as large as possible.
The network settings of the R1 company has a special option that lets you to cut the initial maximum data transfer speed of any computer to any lower speed. How should the R1 company configure the network using the described option so that at least *k* of *n* computers had the same data transfer speed and the data transfer speed on these computers was as large as possible? | The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of computers and the number of participants, respectively. In the second line you have a space-separated sequence consisting of *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (16<=≤<=*a**i*<=≤<=32768); number *a**i* denotes the maximum data transfer speed on the *i*-th computer. | Print a single integer — the maximum Internet speed value. It is guaranteed that the answer to the problem is always an integer. | [
"3 2\n40 20 30\n",
"6 4\n100 20 40 20 50 50\n"
] | [
"30\n",
"40\n"
] | In the first test case the organizers can cut the first computer's speed to 30 kilobits. Then two computers (the first and the third one) will have the same speed of 30 kilobits. They should be used as the participants' computers. This answer is optimal. | 1,000 | [
{
"input": "3 2\n40 20 30",
"output": "30"
},
{
"input": "6 4\n100 20 40 20 50 50",
"output": "40"
},
{
"input": "1 1\n16",
"output": "16"
},
{
"input": "2 1\n10000 17",
"output": "10000"
},
{
"input": "2 2\n200 300",
"output": "200"
},
{
"input": "3 1\n21 25 16",
"output": "25"
},
{
"input": "3 2\n23 20 26",
"output": "23"
},
{
"input": "3 3\n19 29 28",
"output": "19"
},
{
"input": "100 2\n82 37 88 28 98 30 38 76 90 68 79 29 67 93 19 71 122 103 110 79 20 75 68 101 16 120 114 68 73 71 103 114 99 70 73 18 36 31 32 87 32 79 44 72 58 25 44 72 106 38 47 17 83 41 75 23 49 30 73 67 117 52 22 117 109 89 66 88 75 62 17 35 83 69 63 60 23 120 93 18 112 93 39 72 116 109 106 72 27 123 117 119 87 72 33 73 70 110 43 43",
"output": "122"
},
{
"input": "30 13\n36 82 93 91 48 62 59 96 72 40 45 68 97 70 26 22 35 98 92 83 72 49 70 39 53 94 97 65 37 28",
"output": "70"
},
{
"input": "50 49\n20 77 31 40 18 87 44 64 70 48 29 59 98 33 95 17 69 84 81 17 24 66 37 54 97 55 77 79 42 21 23 42 36 55 81 83 94 45 25 84 20 97 37 95 46 92 73 39 90 71",
"output": "17"
},
{
"input": "40 40\n110 674 669 146 882 590 650 844 427 187 380 711 122 94 38 216 414 874 380 31 895 390 414 557 913 68 665 964 895 708 594 17 24 621 780 509 837 550 630 568",
"output": "17"
},
{
"input": "40 1\n851 110 1523 1572 945 4966 4560 756 2373 4760 144 2579 4022 220 1924 1042 160 2792 2425 4483 2154 4120 319 4617 4686 2502 4797 4941 4590 4478 4705 4355 695 684 1560 684 2780 1090 4995 3113",
"output": "4995"
},
{
"input": "70 12\n6321 2502 557 2734 16524 10133 13931 5045 3897 18993 5745 8687 12344 1724 12071 2345 3852 9312 14432 8615 7461 2439 4751 19872 12266 12997 8276 8155 9502 3047 7226 12754 9447 17349 1888 14564 18257 18099 8924 14199 738 13693 10917 15554 15773 17859 13391 13176 10567 19658 16494 3968 13977 14694 10537 4044 16402 9714 4425 13599 19660 2426 19687 2455 2382 3413 5754 113 7542 8353",
"output": "16402"
},
{
"input": "80 60\n6159 26457 23753 27073 9877 4492 11957 10989 27151 6552 1646 7773 23924 27554 10517 8788 31160 455 12625 22009 22133 15657 14968 31871 15344 16550 27414 876 31213 10895 21508 17516 12747 59 11786 10497 30143 25548 22003 2809 11694 30395 8122 31248 23075 19013 31614 9133 27942 27346 15969 19415 10367 8424 29355 18903 3396 6327 4201 24124 24266 22586 724 1595 3972 17526 2843 20982 23655 12714 18050 15225 2658 7236 27555 13023 729 9022 17386 2585",
"output": "8122"
},
{
"input": "100 1\n199 348 489 76 638 579 982 125 28 401 228 117 195 337 80 914 752 98 679 417 47 225 357 413 849 622 477 620 487 223 321 240 439 393 733 660 652 500 877 40 788 246 376 723 952 601 912 316 598 809 476 932 384 147 982 271 202 695 129 303 304 712 49 306 598 141 833 730 946 708 724 788 202 465 951 118 279 706 214 655 152 976 998 231 487 311 342 317 243 554 977 232 365 643 336 501 761 400 600 528",
"output": "998"
},
{
"input": "80 50\n15160 6853 20254 11358 19535 27691 2983 31650 9219 11833 32053 31695 21511 4320 4384 24843 1454 31543 18796 13815 1546 27926 16276 14315 12542 25370 24890 29647 3584 17867 12446 15072 19852 30207 16361 7964 5343 398 10837 31114 9252 12767 15098 22562 32637 31823 8160 12658 6422 19142 12448 6765 7373 868 31712 24856 23251 29200 8159 16144 27165 4308 13652 12502 4183 7961 3032 26855 8687 12263 24319 7722 19460 30700 29806 1280 21141 25965 25550 26881",
"output": "12448"
},
{
"input": "50 16\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 1\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 2\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 100\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
},
{
"input": "100 99\n16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16 16",
"output": "16"
}
] | 1,404,678,062 | 722 | Python 3 | OK | TESTS | 34 | 62 | 0 | n, k = list(map(int, input().split()))
s = list(map(int, input().split()))
s.sort()
print(s[- k]) | Title: Network Configuration
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The R1 company wants to hold a web search championship. There were *n* computers given for the competition, each of them is connected to the Internet. The organizers believe that the data transfer speed directly affects the result. The higher the speed of the Internet is, the faster the participant will find the necessary information. Therefore, before the competition started, each computer had its maximum possible data transfer speed measured. On the *i*-th computer it was *a**i* kilobits per second.
There will be *k* participants competing in the championship, each should get a separate computer. The organizing company does not want any of the participants to have an advantage over the others, so they want to provide the same data transfer speed to each participant's computer. Also, the organizers want to create the most comfortable conditions for the participants, so the data transfer speed on the participants' computers should be as large as possible.
The network settings of the R1 company has a special option that lets you to cut the initial maximum data transfer speed of any computer to any lower speed. How should the R1 company configure the network using the described option so that at least *k* of *n* computers had the same data transfer speed and the data transfer speed on these computers was as large as possible?
Input Specification:
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100) — the number of computers and the number of participants, respectively. In the second line you have a space-separated sequence consisting of *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (16<=≤<=*a**i*<=≤<=32768); number *a**i* denotes the maximum data transfer speed on the *i*-th computer.
Output Specification:
Print a single integer — the maximum Internet speed value. It is guaranteed that the answer to the problem is always an integer.
Demo Input:
['3 2\n40 20 30\n', '6 4\n100 20 40 20 50 50\n']
Demo Output:
['30\n', '40\n']
Note:
In the first test case the organizers can cut the first computer's speed to 30 kilobits. Then two computers (the first and the third one) will have the same speed of 30 kilobits. They should be used as the participants' computers. This answer is optimal. | ```python
n, k = list(map(int, input().split()))
s = list(map(int, input().split()))
s.sort()
print(s[- k])
``` | 3 | |
714 | B | Filya and Homework | PROGRAMMING | 1,200 | [
"implementation",
"sortings"
] | null | null | Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help.
Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal.
Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal. | The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array. | If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes). | [
"5\n1 3 3 2 1\n",
"5\n1 2 3 4 5\n"
] | [
"YES\n",
"NO\n"
] | In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements. | 1,000 | [
{
"input": "5\n1 3 3 2 1",
"output": "YES"
},
{
"input": "5\n1 2 3 4 5",
"output": "NO"
},
{
"input": "2\n1 2",
"output": "YES"
},
{
"input": "3\n1 2 3",
"output": "YES"
},
{
"input": "3\n1 1 1",
"output": "YES"
},
{
"input": "2\n1 1000000000",
"output": "YES"
},
{
"input": "4\n1 2 3 4",
"output": "NO"
},
{
"input": "10\n1 1 1 1 1 2 2 2 2 2",
"output": "YES"
},
{
"input": "2\n4 2",
"output": "YES"
},
{
"input": "4\n1 1 4 7",
"output": "YES"
},
{
"input": "3\n99999999 1 50000000",
"output": "YES"
},
{
"input": "1\n0",
"output": "YES"
},
{
"input": "5\n0 0 0 0 0",
"output": "YES"
},
{
"input": "4\n4 2 2 1",
"output": "NO"
},
{
"input": "3\n1 4 2",
"output": "NO"
},
{
"input": "3\n1 4 100",
"output": "NO"
},
{
"input": "3\n2 5 11",
"output": "NO"
},
{
"input": "3\n1 4 6",
"output": "NO"
},
{
"input": "3\n1 2 4",
"output": "NO"
},
{
"input": "3\n1 2 7",
"output": "NO"
},
{
"input": "5\n1 1 1 4 5",
"output": "NO"
},
{
"input": "2\n100000001 100000003",
"output": "YES"
},
{
"input": "3\n7 4 5",
"output": "NO"
},
{
"input": "3\n2 3 5",
"output": "NO"
},
{
"input": "3\n1 2 5",
"output": "NO"
},
{
"input": "2\n2 3",
"output": "YES"
},
{
"input": "3\n2 100 29",
"output": "NO"
},
{
"input": "3\n0 1 5",
"output": "NO"
},
{
"input": "3\n1 3 6",
"output": "NO"
},
{
"input": "3\n2 1 3",
"output": "YES"
},
{
"input": "3\n1 5 100",
"output": "NO"
},
{
"input": "3\n1 4 8",
"output": "NO"
},
{
"input": "3\n1 7 10",
"output": "NO"
},
{
"input": "3\n5 4 1",
"output": "NO"
},
{
"input": "3\n1 6 10",
"output": "NO"
},
{
"input": "4\n1 3 4 5",
"output": "NO"
},
{
"input": "3\n1 5 4",
"output": "NO"
},
{
"input": "5\n1 2 3 3 5",
"output": "NO"
},
{
"input": "3\n2 3 1",
"output": "YES"
},
{
"input": "3\n2 3 8",
"output": "NO"
},
{
"input": "3\n0 3 5",
"output": "NO"
},
{
"input": "3\n1 5 10",
"output": "NO"
},
{
"input": "3\n1 7 2",
"output": "NO"
},
{
"input": "3\n1 3 9",
"output": "NO"
},
{
"input": "3\n1 1 2",
"output": "YES"
},
{
"input": "7\n1 1 1 1 1 2 4",
"output": "NO"
},
{
"input": "5\n1 4 4 4 6",
"output": "NO"
},
{
"input": "5\n1 2 2 4 4",
"output": "NO"
},
{
"input": "3\n1 9 10",
"output": "NO"
},
{
"input": "8\n1 1 1 1 1 1 2 3",
"output": "YES"
},
{
"input": "3\n1 2 100",
"output": "NO"
},
{
"input": "3\n1 3 4",
"output": "NO"
},
{
"input": "3\n1 15 14",
"output": "NO"
},
{
"input": "3\n1 3 8",
"output": "NO"
},
{
"input": "3\n1 2 10",
"output": "NO"
},
{
"input": "4\n2 2 4 5",
"output": "NO"
},
{
"input": "3\n1 3 5",
"output": "YES"
},
{
"input": "5\n3 6 7 8 9",
"output": "NO"
},
{
"input": "3\n7 6 8",
"output": "YES"
},
{
"input": "3\n3 2 1",
"output": "YES"
},
{
"input": "5\n1 2 2 2 3",
"output": "YES"
},
{
"input": "3\n4 6 7",
"output": "NO"
},
{
"input": "3\n2 0 4",
"output": "YES"
},
{
"input": "4\n10 20 21 30",
"output": "NO"
},
{
"input": "4\n0 2 3 4",
"output": "NO"
},
{
"input": "3\n3 6 12",
"output": "NO"
},
{
"input": "5\n0 0 1 3 5",
"output": "NO"
},
{
"input": "3\n3 5 8",
"output": "NO"
},
{
"input": "3\n1 4 4",
"output": "YES"
},
{
"input": "4\n2 4 5 6",
"output": "NO"
}
] | 1,672,171,103 | 2,147,483,647 | Python 3 | OK | TESTS | 79 | 62 | 8,192,000 | # for i in range(5005):
# count[i]=0
# for i in range(n):
# count[arr[i]]=count.get(arr[i], 0) + 1
n=int(input())
set1=set()
[set1.add(x) for x in input().split()]
# print(set1)
if len(set1)==1 or len(set1)==2:
print("YES")
exit()
arr=[]
if len(set1)==3:
for i in set1:
arr.append(int(i))
arr.sort()
# print(arr)
# x=arr[2]+arr[0]-(2*arr[1])
if arr[1]-arr[0]==arr[2]-arr[1]:
print("YES")
exit()
print("NO")
# print(arr) | Title: Filya and Homework
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today, hedgehog Filya went to school for the very first time! Teacher gave him a homework which Filya was unable to complete without your help.
Filya is given an array of non-negative integers *a*1,<=*a*2,<=...,<=*a**n*. First, he pick an integer *x* and then he adds *x* to some elements of the array (no more than once), subtract *x* from some other elements (also, no more than once) and do no change other elements. He wants all elements of the array to be equal.
Now he wonders if it's possible to pick such integer *x* and change some elements of the array using this *x* in order to make all elements equal.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of integers in the Filya's array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — elements of the array.
Output Specification:
If it's impossible to make all elements of the array equal using the process given in the problem statement, then print "NO" (without quotes) in the only line of the output. Otherwise print "YES" (without quotes).
Demo Input:
['5\n1 3 3 2 1\n', '5\n1 2 3 4 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample Filya should select *x* = 1, then add it to the first and the last elements of the array and subtract from the second and the third elements. | ```python
# for i in range(5005):
# count[i]=0
# for i in range(n):
# count[arr[i]]=count.get(arr[i], 0) + 1
n=int(input())
set1=set()
[set1.add(x) for x in input().split()]
# print(set1)
if len(set1)==1 or len(set1)==2:
print("YES")
exit()
arr=[]
if len(set1)==3:
for i in set1:
arr.append(int(i))
arr.sort()
# print(arr)
# x=arr[2]+arr[0]-(2*arr[1])
if arr[1]-arr[0]==arr[2]-arr[1]:
print("YES")
exit()
print("NO")
# print(arr)
``` | 3 | |
420 | A | Start Up | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it?
The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper.
There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not. | The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font: | Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes). | [
"AHA\n",
"Z\n",
"XO\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "AHA",
"output": "YES"
},
{
"input": "Z",
"output": "NO"
},
{
"input": "XO",
"output": "NO"
},
{
"input": "AAA",
"output": "YES"
},
{
"input": "AHHA",
"output": "YES"
},
{
"input": "BAB",
"output": "NO"
},
{
"input": "OMMMAAMMMO",
"output": "YES"
},
{
"input": "YYHUIUGYI",
"output": "NO"
},
{
"input": "TT",
"output": "YES"
},
{
"input": "UUU",
"output": "YES"
},
{
"input": "WYYW",
"output": "YES"
},
{
"input": "MITIM",
"output": "YES"
},
{
"input": "VO",
"output": "NO"
},
{
"input": "WWS",
"output": "NO"
},
{
"input": "VIYMAXXAVM",
"output": "NO"
},
{
"input": "OVWIHIWVYXMVAAAATOXWOIUUHYXHIHHVUIOOXWHOXTUUMUUVHVWWYUTIAUAITAOMHXWMTTOIVMIVOTHOVOIOHYHAOXWAUVWAVIVM",
"output": "NO"
},
{
"input": "CC",
"output": "NO"
},
{
"input": "QOQ",
"output": "NO"
},
{
"input": "AEEA",
"output": "NO"
},
{
"input": "OQQQO",
"output": "NO"
},
{
"input": "HNCMEEMCNH",
"output": "NO"
},
{
"input": "QDPINBMCRFWXPDBFGOZVVOCEMJRUCTOADEWEGTVBVBFWWRPGYEEYGPRWWFBVBVTGEWEDAOTCURJMECOVVZOGFBDPXWFRCMBNIPDQ",
"output": "NO"
},
{
"input": "A",
"output": "YES"
},
{
"input": "B",
"output": "NO"
},
{
"input": "C",
"output": "NO"
},
{
"input": "D",
"output": "NO"
},
{
"input": "E",
"output": "NO"
},
{
"input": "F",
"output": "NO"
},
{
"input": "G",
"output": "NO"
},
{
"input": "H",
"output": "YES"
},
{
"input": "I",
"output": "YES"
},
{
"input": "J",
"output": "NO"
},
{
"input": "K",
"output": "NO"
},
{
"input": "L",
"output": "NO"
},
{
"input": "M",
"output": "YES"
},
{
"input": "N",
"output": "NO"
},
{
"input": "O",
"output": "YES"
},
{
"input": "P",
"output": "NO"
},
{
"input": "Q",
"output": "NO"
},
{
"input": "R",
"output": "NO"
},
{
"input": "S",
"output": "NO"
},
{
"input": "T",
"output": "YES"
},
{
"input": "U",
"output": "YES"
},
{
"input": "V",
"output": "YES"
},
{
"input": "W",
"output": "YES"
},
{
"input": "X",
"output": "YES"
},
{
"input": "Y",
"output": "YES"
},
{
"input": "JL",
"output": "NO"
},
{
"input": "AAAKTAAA",
"output": "NO"
},
{
"input": "AKA",
"output": "NO"
},
{
"input": "AAJAA",
"output": "NO"
},
{
"input": "ABA",
"output": "NO"
},
{
"input": "AAAAAABAAAAAA",
"output": "NO"
},
{
"input": "ZZ",
"output": "NO"
},
{
"input": "ADA",
"output": "NO"
},
{
"input": "N",
"output": "NO"
},
{
"input": "P",
"output": "NO"
},
{
"input": "LAL",
"output": "NO"
},
{
"input": "AABAA",
"output": "NO"
},
{
"input": "AZA",
"output": "NO"
},
{
"input": "V",
"output": "YES"
},
{
"input": "SSS",
"output": "NO"
},
{
"input": "NNN",
"output": "NO"
},
{
"input": "S",
"output": "NO"
},
{
"input": "I",
"output": "YES"
},
{
"input": "SS",
"output": "NO"
},
{
"input": "E",
"output": "NO"
}
] | 1,687,324,334 | 2,147,483,647 | PyPy 3 | OK | TESTS | 80 | 92 | 1,945,600 | l = ["A", "H", "I", "M", "O", "T", "U", "V", "W", "X", "Y"]
s = input()
x = "YES"
for i in s:
if i not in l:
x = "NO"
break
if s != s[::-1]:
x = "NO"
print(x) | Title: Start Up
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it?
The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper.
There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not.
Input Specification:
The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font:
Output Specification:
Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes).
Demo Input:
['AHA\n', 'Z\n', 'XO\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
l = ["A", "H", "I", "M", "O", "T", "U", "V", "W", "X", "Y"]
s = input()
x = "YES"
for i in s:
if i not in l:
x = "NO"
break
if s != s[::-1]:
x = "NO"
print(x)
``` | 3 | |
0 | none | none | none | 0 | [
"none"
] | null | null | Dwarfs have planted a very interesting plant, which is a triangle directed "upwards". This plant has an amusing feature. After one year a triangle plant directed "upwards" divides into four triangle plants: three of them will point "upwards" and one will point "downwards". After another year, each triangle plant divides into four triangle plants: three of them will be directed in the same direction as the parent plant, and one of them will be directed in the opposite direction. Then each year the process repeats. The figure below illustrates this process.
Help the dwarfs find out how many triangle plants that point "upwards" will be in *n* years. | The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1018) — the number of full years when the plant grew.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier. | Print a single integer — the remainder of dividing the number of plants that will point "upwards" in *n* years by 1000000007 (109<=+<=7). | [
"1\n",
"2\n"
] | [
"3\n",
"10\n"
] | The first test sample corresponds to the second triangle on the figure in the statement. The second test sample corresponds to the third one. | 0 | [
{
"input": "1",
"output": "3"
},
{
"input": "2",
"output": "10"
},
{
"input": "385599124",
"output": "493875375"
},
{
"input": "989464295",
"output": "31966163"
},
{
"input": "376367012",
"output": "523204186"
},
{
"input": "529357306",
"output": "142578489"
},
{
"input": "782916801",
"output": "51174574"
},
{
"input": "74859961358140080",
"output": "478768275"
},
{
"input": "0",
"output": "1"
},
{
"input": "252509053898415171",
"output": "886314547"
},
{
"input": "760713016078377938",
"output": "79611270"
},
{
"input": "919845424847912644",
"output": "388845650"
},
{
"input": "585335721566249104",
"output": "301383716"
},
{
"input": "522842183413115087",
"output": "556012763"
},
{
"input": "148049062285906746",
"output": "913927498"
},
{
"input": "84324827171274022",
"output": "462535280"
},
{
"input": "354979172034763159",
"output": "239287993"
},
{
"input": "1312148742261680",
"output": "799725655"
},
{
"input": "269587448053313253",
"output": "536645997"
},
{
"input": "645762257531682045",
"output": "543988614"
},
{
"input": "615812227854199662",
"output": "357939938"
},
{
"input": "819875140559301751",
"output": "968653685"
},
{
"input": "349993003033420740",
"output": "709392758"
},
{
"input": "891351282398722856",
"output": "70758467"
},
{
"input": "563324730406715801",
"output": "353494903"
},
{
"input": "520974001002628386",
"output": "164118419"
},
{
"input": "666729339260489789",
"output": "784700006"
},
{
"input": "856674609788912527",
"output": "720540265"
},
{
"input": "791809296233191092",
"output": "369199735"
},
{
"input": "711066335916901717",
"output": "15590358"
},
{
"input": "931356501703211379",
"output": "239824013"
},
{
"input": "234122431978145893",
"output": "905163056"
},
{
"input": "1000000000000000000",
"output": "899770636"
},
{
"input": "3",
"output": "36"
},
{
"input": "4",
"output": "136"
},
{
"input": "5",
"output": "528"
},
{
"input": "6",
"output": "2080"
},
{
"input": "7",
"output": "8256"
},
{
"input": "8",
"output": "32896"
},
{
"input": "9",
"output": "131328"
},
{
"input": "10",
"output": "524800"
},
{
"input": "11",
"output": "2098176"
},
{
"input": "12",
"output": "8390656"
},
{
"input": "13",
"output": "33558528"
},
{
"input": "14",
"output": "134225920"
},
{
"input": "15",
"output": "536887296"
},
{
"input": "16",
"output": "147516402"
},
{
"input": "0",
"output": "1"
},
{
"input": "6265",
"output": "980996097"
}
] | 1,687,713,051 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 92 | 0 | import sys
input = sys.stdin.readline
mod = 10**9+7
def calculate(p):
result1 = 1
result2 = 1
x = 4
y = 2
while p>0:
if p%2:
result1 = ((result1*x)%mod)
result2 = ((result2*y)%mod)
x = (x*x)%mod
y = (y*y)%mod
p = p//2
return (((result1 + result2))/2)%mod
n = int(input())
print(int(calculate(n))) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dwarfs have planted a very interesting plant, which is a triangle directed "upwards". This plant has an amusing feature. After one year a triangle plant directed "upwards" divides into four triangle plants: three of them will point "upwards" and one will point "downwards". After another year, each triangle plant divides into four triangle plants: three of them will be directed in the same direction as the parent plant, and one of them will be directed in the opposite direction. Then each year the process repeats. The figure below illustrates this process.
Help the dwarfs find out how many triangle plants that point "upwards" will be in *n* years.
Input Specification:
The first line contains a single integer *n* (0<=≤<=*n*<=≤<=1018) — the number of full years when the plant grew.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Output Specification:
Print a single integer — the remainder of dividing the number of plants that will point "upwards" in *n* years by 1000000007 (109<=+<=7).
Demo Input:
['1\n', '2\n']
Demo Output:
['3\n', '10\n']
Note:
The first test sample corresponds to the second triangle on the figure in the statement. The second test sample corresponds to the third one. | ```python
import sys
input = sys.stdin.readline
mod = 10**9+7
def calculate(p):
result1 = 1
result2 = 1
x = 4
y = 2
while p>0:
if p%2:
result1 = ((result1*x)%mod)
result2 = ((result2*y)%mod)
x = (x*x)%mod
y = (y*y)%mod
p = p//2
return (((result1 + result2))/2)%mod
n = int(input())
print(int(calculate(n)))
``` | 0 | |
999 | A | Mishka and Contest | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve? | The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list. | Print one integer — the maximum number of problems Mishka can solve. | [
"8 4\n4 2 3 1 5 1 6 4\n",
"5 2\n3 1 2 1 3\n",
"5 100\n12 34 55 43 21\n"
] | [
"5\n",
"0\n",
"5\n"
] | In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems. | 0 | [
{
"input": "8 4\n4 2 3 1 5 1 6 4",
"output": "5"
},
{
"input": "5 2\n3 1 2 1 3",
"output": "0"
},
{
"input": "5 100\n12 34 55 43 21",
"output": "5"
},
{
"input": "100 100\n44 47 36 83 76 94 86 69 31 2 22 77 37 51 10 19 25 78 53 25 1 29 48 95 35 53 22 72 49 86 60 38 13 91 89 18 54 19 71 2 25 33 65 49 53 5 95 90 100 68 25 5 87 48 45 72 34 14 100 44 94 75 80 26 25 7 57 82 49 73 55 43 42 60 34 8 51 11 71 41 81 23 20 89 12 72 68 26 96 92 32 63 13 47 19 9 35 56 79 62",
"output": "100"
},
{
"input": "100 99\n84 82 43 4 71 3 30 92 15 47 76 43 2 17 76 4 1 33 24 96 44 98 75 99 59 11 73 27 67 17 8 88 69 41 44 22 91 48 4 46 42 21 21 67 85 51 57 84 11 100 100 59 39 72 89 82 74 19 98 14 37 97 20 78 38 52 44 83 19 83 69 32 56 6 93 13 98 80 80 2 33 71 11 15 55 51 98 58 16 91 39 32 83 58 77 79 88 81 17 98",
"output": "98"
},
{
"input": "100 69\n80 31 12 89 16 35 8 28 39 12 32 51 42 67 64 53 17 88 63 97 29 41 57 28 51 33 82 75 93 79 57 86 32 100 83 82 99 33 1 27 86 22 65 15 60 100 42 37 38 85 26 43 90 62 91 13 1 92 16 20 100 19 28 30 23 6 5 69 24 22 9 1 10 14 28 14 25 9 32 8 67 4 39 7 10 57 15 7 8 35 62 6 53 59 62 13 24 7 53 2",
"output": "39"
},
{
"input": "100 2\n2 2 2 2 1 1 1 2 1 2 2 2 1 2 2 2 2 1 2 1 2 1 1 1 2 1 2 1 2 1 1 2 2 2 2 2 1 2 1 2 1 1 2 1 2 1 1 2 1 2 1 2 2 1 2 1 2 1 1 2 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 2 1 1 1 2 2 2 1 2 1 2 1 1 1 1 1 1 1 1 1 1 1 2 2 16",
"output": "99"
},
{
"input": "100 3\n86 53 82 40 2 20 59 2 46 63 75 49 24 81 70 22 9 9 93 72 47 23 29 77 78 51 17 59 19 71 35 3 20 60 70 9 11 96 71 94 91 19 88 93 50 49 72 19 53 30 38 67 62 71 81 86 5 26 5 32 63 98 1 97 22 32 87 65 96 55 43 85 56 37 56 67 12 100 98 58 77 54 18 20 33 53 21 66 24 64 42 71 59 32 51 69 49 79 10 1",
"output": "1"
},
{
"input": "13 7\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "1 5\n4",
"output": "1"
},
{
"input": "3 2\n1 4 1",
"output": "2"
},
{
"input": "1 2\n100",
"output": "0"
},
{
"input": "7 4\n4 2 3 4 4 2 3",
"output": "7"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "1 2\n15",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "2"
},
{
"input": "5 3\n3 4 3 2 1",
"output": "4"
},
{
"input": "1 1\n2",
"output": "0"
},
{
"input": "1 5\n1",
"output": "1"
},
{
"input": "6 6\n7 1 1 1 1 1",
"output": "5"
},
{
"input": "5 5\n6 5 5 5 5",
"output": "4"
},
{
"input": "1 4\n2",
"output": "1"
},
{
"input": "9 4\n1 2 1 2 4 2 1 2 1",
"output": "9"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n5",
"output": "1"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "5"
},
{
"input": "100 10\n2 5 1 10 10 2 7 7 9 4 1 8 1 1 8 4 7 9 10 5 7 9 5 6 7 2 7 5 3 2 1 82 4 80 9 8 6 1 10 7 5 7 1 5 6 7 19 4 2 4 6 2 1 8 31 6 2 2 57 42 3 2 7 1 9 5 10 8 5 4 10 8 3 5 8 7 2 7 6 5 3 3 4 10 6 7 10 8 7 10 7 2 4 6 8 10 10 2 6 4",
"output": "71"
},
{
"input": "100 90\n17 16 5 51 17 62 24 45 49 41 90 30 19 78 67 66 59 34 28 47 42 8 33 77 90 41 61 16 86 33 43 71 90 95 23 9 56 41 24 90 31 12 77 36 90 67 47 15 92 50 79 88 42 19 21 79 86 60 41 26 47 4 70 62 44 90 82 89 84 91 54 16 90 53 29 69 21 44 18 28 88 74 56 43 12 76 10 22 34 24 27 52 28 76 90 75 5 29 50 90",
"output": "63"
},
{
"input": "100 10\n6 4 8 4 1 9 4 8 5 2 2 5 2 6 10 2 2 5 3 5 2 3 10 5 2 9 1 1 6 1 5 9 16 42 33 49 26 31 81 27 53 63 81 90 55 97 70 51 87 21 79 62 60 91 54 95 26 26 30 61 87 79 47 11 59 34 40 82 37 40 81 2 7 1 8 4 10 7 1 10 8 7 3 5 2 8 3 3 9 2 1 1 5 7 8 7 1 10 9 8",
"output": "61"
},
{
"input": "100 90\n45 57 52 69 17 81 85 60 59 39 55 14 87 90 90 31 41 57 35 89 74 20 53 4 33 49 71 11 46 90 71 41 71 90 63 74 51 13 99 92 99 91 100 97 93 40 93 96 100 99 100 92 98 96 78 91 91 91 91 100 94 97 95 97 96 95 17 13 45 35 54 26 2 74 6 51 20 3 73 90 90 42 66 43 86 28 84 70 37 27 90 30 55 80 6 58 57 51 10 22",
"output": "72"
},
{
"input": "100 10\n10 2 10 10 10 10 10 10 10 7 10 10 10 10 10 10 9 10 10 10 10 10 10 10 10 7 9 10 10 10 37 10 4 10 10 10 59 5 95 10 10 10 10 39 10 10 10 10 10 10 10 5 10 10 10 10 10 10 10 10 10 10 10 10 66 10 10 10 10 10 5 10 10 10 10 10 10 44 10 10 10 10 10 10 10 10 10 10 10 7 10 10 10 10 10 10 10 10 10 2",
"output": "52"
},
{
"input": "100 90\n57 90 90 90 90 90 90 90 81 90 3 90 39 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 92 90 90 90 90 90 90 90 90 98 90 90 90 90 90 90 90 90 90 90 90 90 90 54 90 90 90 90 90 62 90 90 91 90 90 90 90 90 90 91 90 90 90 90 90 90 90 3 90 90 90 90 90 90 90 2 90 90 90 90 90 90 90 90 90 2 90 90 90 90 90",
"output": "60"
},
{
"input": "100 10\n10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 78 90 61 40 87 39 91 50 64 30 10 24 10 55 28 11 28 35 26 26 10 57 45 67 14 99 96 51 67 79 59 11 21 55 70 33 10 16 92 70 38 50 66 52 5 10 10 10 2 4 10 10 10 10 10 10 10 10 10 6 10 10 10 10 10 10 10 10 10 10 8 10 10 10 10 10",
"output": "56"
},
{
"input": "100 90\n90 90 90 90 90 90 55 21 90 90 90 90 90 90 90 90 90 90 69 83 90 90 90 90 90 90 90 90 93 95 92 98 92 97 91 92 92 91 91 95 94 95 100 100 96 97 94 93 90 90 95 95 97 99 90 95 98 91 94 96 99 99 94 95 95 97 99 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 90 12 90 3 90 90 90 90 90 90 90",
"output": "61"
},
{
"input": "100 49\n71 25 14 36 36 48 36 49 28 40 49 49 49 38 40 49 33 22 49 49 14 46 8 44 49 11 37 49 40 49 2 49 3 49 37 49 49 11 25 49 49 32 49 11 49 30 16 21 49 49 23 24 30 49 49 49 49 49 49 27 49 42 49 49 20 32 30 29 35 49 30 49 9 49 27 25 5 49 49 42 49 20 49 35 49 22 15 49 49 49 19 49 29 28 13 49 22 7 6 24",
"output": "99"
},
{
"input": "100 50\n38 68 9 6 50 18 19 50 50 20 33 34 43 50 24 50 50 2 50 50 50 50 50 21 30 50 41 40 50 50 50 50 50 7 50 21 19 23 1 50 24 50 50 50 25 50 50 50 50 50 50 50 7 24 28 18 50 5 43 50 20 50 13 50 50 16 50 3 2 24 50 50 18 5 50 4 50 50 38 50 33 49 12 33 11 14 50 50 50 33 50 50 50 50 50 50 7 4 50 50",
"output": "99"
},
{
"input": "100 48\n8 6 23 47 29 48 48 48 48 48 48 26 24 48 48 48 3 48 27 28 41 45 9 29 48 48 48 48 48 48 48 48 48 48 47 23 48 48 48 5 48 22 40 48 48 48 20 48 48 57 48 32 19 48 33 2 4 19 48 48 39 48 16 48 48 44 48 48 48 48 29 14 25 43 46 7 48 19 30 48 18 8 39 48 30 47 35 18 48 45 48 48 30 13 48 48 48 17 9 48",
"output": "99"
},
{
"input": "100 57\n57 9 57 4 43 57 57 57 57 26 57 18 57 57 57 57 57 57 57 47 33 57 57 43 57 57 55 57 14 57 57 4 1 57 57 57 57 57 46 26 57 57 57 57 57 57 57 39 57 57 57 5 57 12 11 57 57 57 25 37 34 57 54 18 29 57 39 57 5 57 56 34 57 24 7 57 57 57 2 57 57 57 57 1 55 39 19 57 57 57 57 21 3 40 13 3 57 57 62 57",
"output": "99"
},
{
"input": "100 51\n51 51 38 51 51 45 51 51 51 18 51 36 51 19 51 26 37 51 11 51 45 34 51 21 51 51 33 51 6 51 51 51 21 47 51 13 51 51 30 29 50 51 51 51 51 51 51 45 14 51 2 51 51 23 9 51 50 23 51 29 34 51 40 32 1 36 31 51 11 51 51 47 51 51 51 51 51 51 51 50 39 51 14 4 4 12 3 11 51 51 51 51 41 51 51 51 49 37 5 93",
"output": "99"
},
{
"input": "100 50\n87 91 95 73 50 50 16 97 39 24 58 50 33 89 42 37 50 50 12 71 3 55 50 50 80 10 76 50 52 36 88 44 66 69 86 71 77 50 72 50 21 55 50 50 78 61 75 89 65 2 50 69 62 47 11 92 97 77 41 31 55 29 35 51 36 48 50 91 92 86 50 36 50 94 51 74 4 27 55 63 50 36 87 50 67 7 65 75 20 96 88 50 41 73 35 51 66 21 29 33",
"output": "3"
},
{
"input": "100 50\n50 37 28 92 7 76 50 50 50 76 100 57 50 50 50 32 76 50 8 72 14 8 50 91 67 50 55 82 50 50 24 97 88 50 59 61 68 86 44 15 61 67 88 50 40 50 36 99 1 23 63 50 88 59 76 82 99 76 68 50 50 30 31 68 57 98 71 12 15 60 35 79 90 6 67 50 50 50 50 68 13 6 50 50 16 87 84 50 67 67 50 64 50 58 50 50 77 51 50 51",
"output": "3"
},
{
"input": "100 50\n43 50 50 91 97 67 6 50 86 50 76 60 50 59 4 56 11 38 49 50 37 50 50 20 60 47 33 54 95 58 22 50 77 77 72 9 57 40 81 57 95 50 81 63 62 76 13 87 50 39 74 69 50 99 63 1 11 62 84 31 97 99 56 73 70 36 45 100 28 91 93 9 19 52 73 50 83 58 84 52 86 12 50 44 64 52 97 50 12 71 97 52 87 66 83 66 86 50 9 49",
"output": "6"
},
{
"input": "88 10\n10 8 1 10 10 1 3 7 10 5 8 8 10 2 7 10 10 10 10 10 1 10 10 10 10 1 2 9 10 9 10 10 10 64 100 25 10 12 9 52 13 8 10 56 10 4 10 7 10 3 10 79 74 8 73 10 10 10 9 10 3 5 10 10 10 5 1 10 10 4 3 10 10 10 4 10 6 4 10 10 10 10 3 3 8 5 6 8",
"output": "66"
},
{
"input": "100 50\n80 39 33 69 75 50 23 88 50 50 67 90 87 50 29 15 55 32 60 50 50 50 38 95 62 50 50 88 8 97 45 50 42 12 22 93 49 50 24 50 50 71 60 4 50 72 57 57 50 50 50 83 69 17 1 31 72 55 50 11 50 80 93 41 91 94 20 60 50 50 51 48 53 56 76 73 50 72 19 98 50 50 50 50 50 28 48 45 62 11 16 67 93 88 63 50 50 66 48 95",
"output": "0"
},
{
"input": "100 50\n70 50 38 50 38 50 32 30 50 31 26 42 50 33 34 50 50 50 28 21 50 44 50 47 50 50 9 40 50 50 50 50 50 42 50 50 16 50 50 3 24 50 50 50 4 26 50 2 50 50 33 1 27 50 50 50 8 29 50 23 33 50 6 29 50 50 15 50 50 50 32 50 43 50 50 50 31 50 4 50 50 31 50 50 31 16 50 17 50 17 31 13 25 16 50 10 50 47 50 66",
"output": "0"
},
{
"input": "2 8\n8 8",
"output": "2"
},
{
"input": "1 6\n3",
"output": "1"
},
{
"input": "1 5\n5",
"output": "1"
}
] | 1,608,750,153 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 93 | 0 | s, k = [int(x) for x in input().split()]
n = [int(x) for x in input().split()]
lr = 0
rl = 0
for i in range(0, len(n)):
if i <= k:
lr += 1
else:
break
if lr == n:
for i in range(len(n)-1, -1, -1):
if i <= k:
rl += 1
else:
break
print(lr+rl) | Title: Mishka and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka started participating in a programming contest. There are $n$ problems in the contest. Mishka's problem-solving skill is equal to $k$.
Mishka arranges all problems from the contest into a list. Because of his weird principles, Mishka only solves problems from one of the ends of the list. Every time, he chooses which end (left or right) he will solve the next problem from. Thus, each problem Mishka solves is either the leftmost or the rightmost problem in the list.
Mishka cannot solve a problem with difficulty greater than $k$. When Mishka solves the problem, it disappears from the list, so the length of the list decreases by $1$. Mishka stops when he is unable to solve any problem from any end of the list.
How many problems can Mishka solve?
Input Specification:
The first line of input contains two integers $n$ and $k$ ($1 \le n, k \le 100$) — the number of problems in the contest and Mishka's problem-solving skill.
The second line of input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the difficulty of the $i$-th problem. The problems are given in order from the leftmost to the rightmost in the list.
Output Specification:
Print one integer — the maximum number of problems Mishka can solve.
Demo Input:
['8 4\n4 2 3 1 5 1 6 4\n', '5 2\n3 1 2 1 3\n', '5 100\n12 34 55 43 21\n']
Demo Output:
['5\n', '0\n', '5\n']
Note:
In the first example, Mishka can solve problems in the following order: $[4, 2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6, 4] \rightarrow [2, 3, 1, 5, 1, 6] \rightarrow [3, 1, 5, 1, 6] \rightarrow [1, 5, 1, 6] \rightarrow [5, 1, 6]$, so the number of solved problems will be equal to $5$.
In the second example, Mishka can't solve any problem because the difficulties of problems from both ends are greater than $k$.
In the third example, Mishka's solving skill is so amazing that he can solve all the problems. | ```python
s, k = [int(x) for x in input().split()]
n = [int(x) for x in input().split()]
lr = 0
rl = 0
for i in range(0, len(n)):
if i <= k:
lr += 1
else:
break
if lr == n:
for i in range(len(n)-1, -1, -1):
if i <= k:
rl += 1
else:
break
print(lr+rl)
``` | 0 | |
492 | A | Vanya and Cubes | PROGRAMMING | 800 | [
"implementation"
] | null | null | Vanya got *n* cubes. He decided to build a pyramid from them. Vanya wants to build the pyramid as follows: the top level of the pyramid must consist of 1 cube, the second level must consist of 1<=+<=2<==<=3 cubes, the third level must have 1<=+<=2<=+<=3<==<=6 cubes, and so on. Thus, the *i*-th level of the pyramid must have 1<=+<=2<=+<=...<=+<=(*i*<=-<=1)<=+<=*i* cubes.
Vanya wants to know what is the maximum height of the pyramid that he can make using the given cubes. | The first line contains integer *n* (1<=≤<=*n*<=≤<=104) — the number of cubes given to Vanya. | Print the maximum possible height of the pyramid in the single line. | [
"1\n",
"25\n"
] | [
"1\n",
"4\n"
] | Illustration to the second sample: | 500 | [
{
"input": "1",
"output": "1"
},
{
"input": "25",
"output": "4"
},
{
"input": "2",
"output": "1"
},
{
"input": "4115",
"output": "28"
},
{
"input": "9894",
"output": "38"
},
{
"input": "7969",
"output": "35"
},
{
"input": "6560",
"output": "33"
},
{
"input": "4",
"output": "2"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "2"
},
{
"input": "19",
"output": "3"
},
{
"input": "20",
"output": "4"
},
{
"input": "9880",
"output": "38"
},
{
"input": "9879",
"output": "37"
},
{
"input": "7770",
"output": "35"
},
{
"input": "7769",
"output": "34"
},
{
"input": "2925",
"output": "25"
},
{
"input": "220",
"output": "10"
},
{
"input": "219",
"output": "9"
},
{
"input": "3046",
"output": "25"
},
{
"input": "7590",
"output": "34"
},
{
"input": "1014",
"output": "17"
},
{
"input": "7142",
"output": "34"
},
{
"input": "9999",
"output": "38"
},
{
"input": "10000",
"output": "38"
}
] | 1,697,910,071 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 25 | 77 | 0 | number = int(input())
count = 0
cubs = 1
while number > 0:
if number - cubs >= 0:
number -= cubs
count += 1
cubs += count + 1
else:
break
print(count) | Title: Vanya and Cubes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got *n* cubes. He decided to build a pyramid from them. Vanya wants to build the pyramid as follows: the top level of the pyramid must consist of 1 cube, the second level must consist of 1<=+<=2<==<=3 cubes, the third level must have 1<=+<=2<=+<=3<==<=6 cubes, and so on. Thus, the *i*-th level of the pyramid must have 1<=+<=2<=+<=...<=+<=(*i*<=-<=1)<=+<=*i* cubes.
Vanya wants to know what is the maximum height of the pyramid that he can make using the given cubes.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=104) — the number of cubes given to Vanya.
Output Specification:
Print the maximum possible height of the pyramid in the single line.
Demo Input:
['1\n', '25\n']
Demo Output:
['1\n', '4\n']
Note:
Illustration to the second sample: | ```python
number = int(input())
count = 0
cubs = 1
while number > 0:
if number - cubs >= 0:
number -= cubs
count += 1
cubs += count + 1
else:
break
print(count)
``` | 3 | |
550 | A | Two Substrings | PROGRAMMING | 1,500 | [
"brute force",
"dp",
"greedy",
"implementation",
"strings"
] | null | null | You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order). | The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters. | Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise. | [
"ABA\n",
"BACFAB\n",
"AXBYBXA\n"
] | [
"NO\n",
"YES\n",
"NO\n"
] | In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA". | 1,000 | [
{
"input": "ABA",
"output": "NO"
},
{
"input": "BACFAB",
"output": "YES"
},
{
"input": "AXBYBXA",
"output": "NO"
},
{
"input": "ABABAB",
"output": "YES"
},
{
"input": "BBBBBBBBBB",
"output": "NO"
},
{
"input": "ABBA",
"output": "YES"
},
{
"input": "ABAXXXAB",
"output": "YES"
},
{
"input": "TESTABAXXABTEST",
"output": "YES"
},
{
"input": "A",
"output": "NO"
},
{
"input": "B",
"output": "NO"
},
{
"input": "X",
"output": "NO"
},
{
"input": "BA",
"output": "NO"
},
{
"input": "AB",
"output": "NO"
},
{
"input": "AA",
"output": "NO"
},
{
"input": "BB",
"output": "NO"
},
{
"input": "BAB",
"output": "NO"
},
{
"input": "AAB",
"output": "NO"
},
{
"input": "BAA",
"output": "NO"
},
{
"input": "ABB",
"output": "NO"
},
{
"input": "BBA",
"output": "NO"
},
{
"input": "AAA",
"output": "NO"
},
{
"input": "BBB",
"output": "NO"
},
{
"input": "AXBXBXA",
"output": "NO"
},
{
"input": "SKDSKDJABSDBADKFJDK",
"output": "YES"
},
{
"input": "ABAXXBBXXAA",
"output": "NO"
},
{
"input": "ABAB",
"output": "NO"
},
{
"input": "BABA",
"output": "NO"
},
{
"input": "AAAB",
"output": "NO"
},
{
"input": "AAAA",
"output": "NO"
},
{
"input": "AABA",
"output": "NO"
},
{
"input": "ABAA",
"output": "NO"
},
{
"input": "BAAA",
"output": "NO"
},
{
"input": "AABB",
"output": "NO"
},
{
"input": "BAAB",
"output": "YES"
},
{
"input": "BBAA",
"output": "NO"
},
{
"input": "BBBA",
"output": "NO"
},
{
"input": "BBAB",
"output": "NO"
},
{
"input": "BABB",
"output": "NO"
},
{
"input": "ABBB",
"output": "NO"
},
{
"input": "BBBB",
"output": "NO"
},
{
"input": "BABAB",
"output": "YES"
},
{
"input": "ABABA",
"output": "YES"
},
{
"input": "AAABAAACBBBC",
"output": "NO"
},
{
"input": "AABBBACBBBBBBAACBCCACBBAABBBBBCAACABAACABCACCBCBCCCBCBCABCBBCCBCBBAACBACAABACBBCACCBCCACCABBCBABBAAC",
"output": "YES"
},
{
"input": "CBBABDDBBADAC",
"output": "YES"
},
{
"input": "ABYFAB",
"output": "NO"
},
{
"input": "BABXXAB",
"output": "YES"
},
{
"input": "ABAXAB",
"output": "YES"
},
{
"input": "ABABXAB",
"output": "YES"
},
{
"input": "ABXABXABXABXABXBAXBAXBAXBA",
"output": "YES"
},
{
"input": "QQQQQQQQQABABQQQQQQQQ",
"output": "NO"
}
] | 1,695,753,409 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 16 | 31 | 6,041,600 | data = input()
index = data.find("AB")
if index == -1:
print("NO")
else:
data = data[:index] + data[index + 2 :]
index = data.find("BA")
if index == -1:
print("NO")
else:
print("YES") | Title: Two Substrings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
Input Specification:
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
Output Specification:
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
Demo Input:
['ABA\n', 'BACFAB\n', 'AXBYBXA\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA". | ```python
data = input()
index = data.find("AB")
if index == -1:
print("NO")
else:
data = data[:index] + data[index + 2 :]
index = data.find("BA")
if index == -1:
print("NO")
else:
print("YES")
``` | 0 | |
56 | B | Spoilt Permutation | PROGRAMMING | 1,300 | [
"implementation"
] | B. Spoilt Permutation | 2 | 256 | Vasya collects coins: he has exactly one coin for every year from 1 to *n*. Naturally, Vasya keeps all the coins in his collection in the order in which they were released. Once Vasya's younger brother made a change — he took all the coins whose release year dated from *l* to *r* inclusively and put them in the reverse order. That is, he took a certain segment [*l*,<=*r*] and reversed it. At that the segment's endpoints did not coincide. For example, if *n*<==<=8, then initially Vasya's coins were kept in the order 1 2 3 4 5 6 7 8. If Vasya's younger brother chose the segment [2,<=6], then after the reversal the coin order will change to 1 6 5 4 3 2 7 8. Vasya suspects that someone else could have spoilt the permutation after his brother. Help him to find that out. Check if the given permutation can be obtained from the permutation 1 2 ... *n* using exactly one segment reversal. If it is possible, find the segment itself. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000) which is the number of coins in Vasya's collection. The second line contains space-separated *n* integers which are the spoilt sequence of coins. It is guaranteed that the given sequence is a permutation, i.e. it contains only integers from 1 to *n*, and every number is used exactly 1 time. | If it is impossible to obtain the given permutation from the original one in exactly one action, print 0 0. Otherwise, print two numbers *l* *r* (1<=≤<=*l*<=<<=*r*<=≤<=*n*) which are the endpoints of the segment that needs to be reversed to obtain from permutation 1 2 ... *n* the given one. | [
"8\n1 6 5 4 3 2 7 8\n",
"4\n2 3 4 1\n",
"4\n1 2 3 4\n"
] | [
"2 6\n",
"0 0\n",
"0 0\n"
] | none | 1,000 | [
{
"input": "8\n1 6 5 4 3 2 7 8",
"output": "2 6"
},
{
"input": "4\n2 3 4 1",
"output": "0 0"
},
{
"input": "4\n1 2 3 4",
"output": "0 0"
},
{
"input": "8\n1 3 2 4 6 5 7 8",
"output": "0 0"
},
{
"input": "8\n1 3 4 2 6 5 7 8",
"output": "0 0"
},
{
"input": "1\n1",
"output": "0 0"
},
{
"input": "2\n1 2",
"output": "0 0"
},
{
"input": "2\n2 1",
"output": "1 2"
},
{
"input": "149\n9 120 122 97 93 70 85 56 102 16 103 112 88 84 118 135 113 62 65 19 89 15 108 73 82 21 147 27 115 130 136 6 1 90 29 94 149 17 53 132 99 123 64 95 71 67 141 126 59 8 10 114 121 134 107 87 128 79 66 55 72 39 31 111 60 137 2 4 23 129 133 47 12 54 100 77 98 30 86 125 11 5 45 148 57 49 91 28 74 18 140 3 144 78 142 101 110 131 127 20 63 139 96 32 80 50 52 69 75 76 119 26 33 109 48 116 117 35 44 83 124 68 7 14 51 40 41 104 22 105 42 38 46 37 61 146 13 106 43 36 25 143 92 138 24 81 145 34 58",
"output": "0 0"
},
{
"input": "35\n7 33 34 15 16 24 5 27 1 19 17 22 29 3 4 23 31 11 21 35 32 2 12 20 8 9 6 28 18 26 30 14 13 10 25",
"output": "0 0"
},
{
"input": "114\n26 20 11 61 28 89 49 42 103 74 99 71 19 67 111 85 92 13 31 18 47 91 23 95 40 29 79 2 109 70 33 82 90 5 21 77 45 41 15 86 35 46 58 87 83 62 43 9 66 3 106 14 73 107 17 22 110 104 4 100 32 52 54 55 112 96 97 44 98 75 94 80 72 69 59 57 60 108 65 30 64 78 16 10 53 84 27 6 76 7 93 114 37 105 8 113 68 1 102 24 63 39 34 51 101 25 12 48 81 36 88 56 38 50",
"output": "0 0"
},
{
"input": "133\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 127 126 125 124 123 122 121 120 119 118 117 116 115 114 113 112 111 110 109 108 107 106 105 104 103 102 101 100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 128 129 130 131 132 133",
"output": "85 127"
},
{
"input": "4\n1 2 4 3",
"output": "3 4"
},
{
"input": "4\n1 4 3 2",
"output": "2 4"
}
] | 1,690,487,102 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 92 | 0 | print("_RANDOM_GUESS_1690487102.598555")# 1690487102.5985744 | Title: Spoilt Permutation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya collects coins: he has exactly one coin for every year from 1 to *n*. Naturally, Vasya keeps all the coins in his collection in the order in which they were released. Once Vasya's younger brother made a change — he took all the coins whose release year dated from *l* to *r* inclusively and put them in the reverse order. That is, he took a certain segment [*l*,<=*r*] and reversed it. At that the segment's endpoints did not coincide. For example, if *n*<==<=8, then initially Vasya's coins were kept in the order 1 2 3 4 5 6 7 8. If Vasya's younger brother chose the segment [2,<=6], then after the reversal the coin order will change to 1 6 5 4 3 2 7 8. Vasya suspects that someone else could have spoilt the permutation after his brother. Help him to find that out. Check if the given permutation can be obtained from the permutation 1 2 ... *n* using exactly one segment reversal. If it is possible, find the segment itself.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000) which is the number of coins in Vasya's collection. The second line contains space-separated *n* integers which are the spoilt sequence of coins. It is guaranteed that the given sequence is a permutation, i.e. it contains only integers from 1 to *n*, and every number is used exactly 1 time.
Output Specification:
If it is impossible to obtain the given permutation from the original one in exactly one action, print 0 0. Otherwise, print two numbers *l* *r* (1<=≤<=*l*<=<<=*r*<=≤<=*n*) which are the endpoints of the segment that needs to be reversed to obtain from permutation 1 2 ... *n* the given one.
Demo Input:
['8\n1 6 5 4 3 2 7 8\n', '4\n2 3 4 1\n', '4\n1 2 3 4\n']
Demo Output:
['2 6\n', '0 0\n', '0 0\n']
Note:
none | ```python
print("_RANDOM_GUESS_1690487102.598555")# 1690487102.5985744
``` | 0 |
41 | A | Translation | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Translation | 2 | 256 | The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. | The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. | If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. | [
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,696,883,327 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 92 | 0 | s = input()
t = input()
cont = len(s)
is_diff = False
for character in t:
cont -= 1
if character != s[cont]:
is_diff = True
break
print("NO") if is_diff else print("YES")
| Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
s = input()
t = input()
cont = len(s)
is_diff = False
for character in t:
cont -= 1
if character != s[cont]:
is_diff = True
break
print("NO") if is_diff else print("YES")
``` | 3.977 |
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,623,742,751 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 154 | 0 | s=input()
count=0
times=0
for i in range(len(s)):
if s[i].isupper():
count=count+1
if s[i].islower():
times=times+1
if count>times:
print(s.upper())
if count<=times:
print(s.lower()) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
s=input()
count=0
times=0
for i in range(len(s)):
if s[i].isupper():
count=count+1
if s[i].islower():
times=times+1
if count>times:
print(s.upper())
if count<=times:
print(s.lower())
``` | 3.9615 |
920 | B | Tea Queue | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | Recently *n* students from city S moved to city P to attend a programming camp.
They moved there by train. In the evening, all students in the train decided that they want to drink some tea. Of course, no two people can use the same teapot simultaneously, so the students had to form a queue to get their tea.
*i*-th student comes to the end of the queue at the beginning of *l**i*-th second. If there are multiple students coming to the queue in the same moment, then the student with greater index comes after the student with lesser index. Students in the queue behave as follows: if there is nobody in the queue before the student, then he uses the teapot for exactly one second and leaves the queue with his tea; otherwise the student waits for the people before him to get their tea. If at the beginning of *r**i*-th second student *i* still cannot get his tea (there is someone before him in the queue), then he leaves the queue without getting any tea.
For each student determine the second he will use the teapot and get his tea (if he actually gets it). | The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=1000).
Then *t* test cases follow. The first line of each test case contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of students.
Then *n* lines follow. Each line contains two integer *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=5000) — the second *i*-th student comes to the end of the queue, and the second he leaves the queue if he still cannot get his tea.
It is guaranteed that for every condition *l**i*<=-<=1<=≤<=*l**i* holds.
The sum of *n* over all test cases doesn't exceed 1000.
Note that in hacks you have to set *t*<==<=1. | For each test case print *n* integers. *i*-th of them must be equal to the second when *i*-th student gets his tea, or 0 if he leaves without tea. | [
"2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3\n"
] | [
"1 2 \n1 0 2 \n"
] | The example contains 2 tests:
1. During 1-st second, students 1 and 2 come to the queue, and student 1 gets his tea. Student 2 gets his tea during 2-nd second. 1. During 1-st second, students 1 and 2 come to the queue, student 1 gets his tea, and student 2 leaves without tea. During 2-nd second, student 3 comes and gets his tea. | 0 | [
{
"input": "2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3",
"output": "1 2 \n1 0 2 "
},
{
"input": "19\n1\n1 1\n1\n1 2\n1\n1 1000\n1\n1 2000\n1\n2 2\n1\n2 3\n1\n2 1000\n1\n2 2000\n1\n1999 1999\n1\n1999 2000\n1\n2000 2000\n2\n1 1\n1 1\n2\n1 1\n1 2\n2\n1 2\n1 1\n2\n1 2000\n1 1\n2\n1 1\n1 2000\n2\n1 2000\n2 2\n2\n2 2000\n2 2\n2\n2 2\n2 2000",
"output": "1 \n1 \n1 \n1 \n2 \n2 \n2 \n2 \n1999 \n1999 \n2000 \n1 0 \n1 2 \n1 0 \n1 0 \n1 2 \n1 2 \n2 0 \n2 3 "
},
{
"input": "1\n11\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "1 0 0 0 0 0 0 0 0 0 0 "
},
{
"input": "1\n5\n1 1\n1 2\n1 5\n1 1\n1 1",
"output": "1 2 3 0 0 "
}
] | 1,517,632,435 | 2,147,483,647 | Python 3 | OK | TESTS | 8 | 61 | 5,632,000 | import sys
cases = int(sys.stdin.readline())
for x in range(0, cases):
people = int(sys.stdin.readline())
times = []
for i in range(0, people):
cur = [int(x) for x in sys.stdin.readline().strip().split(" ")]
times.append(cur)
time = 1
to_print = []
for t in times:
if(time < t[0]):
time = t[0]
if(time > t[1]):
to_print.append("0")
else:
to_print.append(str(time))
time += 1
print(" ".join(to_print))
| Title: Tea Queue
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently *n* students from city S moved to city P to attend a programming camp.
They moved there by train. In the evening, all students in the train decided that they want to drink some tea. Of course, no two people can use the same teapot simultaneously, so the students had to form a queue to get their tea.
*i*-th student comes to the end of the queue at the beginning of *l**i*-th second. If there are multiple students coming to the queue in the same moment, then the student with greater index comes after the student with lesser index. Students in the queue behave as follows: if there is nobody in the queue before the student, then he uses the teapot for exactly one second and leaves the queue with his tea; otherwise the student waits for the people before him to get their tea. If at the beginning of *r**i*-th second student *i* still cannot get his tea (there is someone before him in the queue), then he leaves the queue without getting any tea.
For each student determine the second he will use the teapot and get his tea (if he actually gets it).
Input Specification:
The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=1000).
Then *t* test cases follow. The first line of each test case contains one integer *n* (1<=≤<=*n*<=≤<=1000) — the number of students.
Then *n* lines follow. Each line contains two integer *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=5000) — the second *i*-th student comes to the end of the queue, and the second he leaves the queue if he still cannot get his tea.
It is guaranteed that for every condition *l**i*<=-<=1<=≤<=*l**i* holds.
The sum of *n* over all test cases doesn't exceed 1000.
Note that in hacks you have to set *t*<==<=1.
Output Specification:
For each test case print *n* integers. *i*-th of them must be equal to the second when *i*-th student gets his tea, or 0 if he leaves without tea.
Demo Input:
['2\n2\n1 3\n1 4\n3\n1 5\n1 1\n2 3\n']
Demo Output:
['1 2 \n1 0 2 \n']
Note:
The example contains 2 tests:
1. During 1-st second, students 1 and 2 come to the queue, and student 1 gets his tea. Student 2 gets his tea during 2-nd second. 1. During 1-st second, students 1 and 2 come to the queue, student 1 gets his tea, and student 2 leaves without tea. During 2-nd second, student 3 comes and gets his tea. | ```python
import sys
cases = int(sys.stdin.readline())
for x in range(0, cases):
people = int(sys.stdin.readline())
times = []
for i in range(0, people):
cur = [int(x) for x in sys.stdin.readline().strip().split(" ")]
times.append(cur)
time = 1
to_print = []
for t in times:
if(time < t[0]):
time = t[0]
if(time > t[1]):
to_print.append("0")
else:
to_print.append(str(time))
time += 1
print(" ".join(to_print))
``` | 3 | |
263 | A | Beautiful Matrix | PROGRAMMING | 800 | [
"implementation"
] | null | null | You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. | The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. | Print a single integer — the minimum number of moves needed to make the matrix beautiful. | [
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] | [
"3\n",
"1\n"
] | none | 500 | [
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,694,443,345 | 2,147,483,647 | Python 3 | OK | TESTS | 25 | 92 | 0 | mat = [[int(i) for i in input().split()] for _ in range(5)]
res = 0
for i in range(5):
for j in range(5):
if mat[i][j]:
res = abs(2 - i) + abs(2 - j)
print(res) | Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none | ```python
mat = [[int(i) for i in input().split()] for _ in range(5)]
res = 0
for i in range(5):
for j in range(5):
if mat[i][j]:
res = abs(2 - i) + abs(2 - j)
print(res)
``` | 3 | |
22 | B | Bargaining Table | PROGRAMMING | 1,500 | [
"brute force",
"dp"
] | B. Bargaining Table | 2 | 256 | Bob wants to put a new bargaining table in his office. To do so he measured the office room thoroughly and drew its plan: Bob's office room is a rectangular room *n*<=×<=*m* meters. Each square meter of the room is either occupied by some furniture, or free. A bargaining table is rectangular, and should be placed so, that its sides are parallel to the office walls. Bob doesn't want to change or rearrange anything, that's why all the squares that will be occupied by the table should be initially free. Bob wants the new table to sit as many people as possible, thus its perimeter should be maximal. Help Bob find out the maximum possible perimeter of a bargaining table for his office. | The first line contains 2 space-separated numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=25) — the office room dimensions. Then there follow *n* lines with *m* characters 0 or 1 each. 0 stands for a free square meter of the office room. 1 stands for an occupied square meter. It's guaranteed that at least one square meter in the room is free. | Output one number — the maximum possible perimeter of a bargaining table for Bob's office room. | [
"3 3\n000\n010\n000\n",
"5 4\n1100\n0000\n0000\n0000\n0000\n"
] | [
"8\n",
"16\n"
] | none | 0 | [
{
"input": "3 3\n000\n010\n000",
"output": "8"
},
{
"input": "5 4\n1100\n0000\n0000\n0000\n0000",
"output": "16"
},
{
"input": "3 3\n000\n110\n000",
"output": "8"
},
{
"input": "4 2\n00\n10\n11\n00",
"output": "6"
},
{
"input": "3 5\n00001\n00000\n10100",
"output": "12"
},
{
"input": "1 1\n0",
"output": "4"
},
{
"input": "10 11\n11111111101\n01111111111\n11101111111\n01111110111\n11111111111\n11111111111\n11111111111\n11110111111\n11111111111\n11111111111",
"output": "4"
},
{
"input": "7 7\n1110111\n1111111\n1111101\n1111101\n1111111\n1100111\n1011111",
"output": "6"
},
{
"input": "10 10\n0110001011\n0101010111\n0010110100\n1010000110\n0111100011\n1010100100\n1010010000\n1011100011\n1110011000\n0010100101",
"output": "16"
},
{
"input": "20 20\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000\n00000000000000000000",
"output": "80"
},
{
"input": "25 1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n0\n1\n1\n1\n0\n1\n1\n1\n1",
"output": "4"
},
{
"input": "25 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "52"
},
{
"input": "1 25\n1111111111111111011010110",
"output": "4"
},
{
"input": "1 25\n0000000000000000000000000",
"output": "52"
},
{
"input": "3 4\n1111\n1101\n1011",
"output": "4"
}
] | 1,676,900,437 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 23 | 342 | 29,900,800 | import sys; R = sys.stdin.readline
S = lambda: map(int,R().split())
n,m = S()
a = [R().rstrip() for _ in range(n)]
d = {}
r = 4
for i in range(n):
for j in range(m):
if a[i][j]=='1': continue
d[(i,j,i,j)] = 1
for l in range(j+1,m):
if a[i][l]=='1': break
d[(i,j,i,l)] = 1
r = max(r,2*(l-j)+4)
for k in range(i+1,n):
if a[k][j]=='1': break
d[(i,j,k,j)] = 1
r = max(r,2*(k-i)+4)
for l in range(j+1,m):
if a[k][l]=='1': break
if (i,j,k-1,l) in d and (i,j,k,l-1) in d:
d[(i,j,k,l)] = 1
r = max(r,2*(k-i+l-j)+4)
print(r) | Title: Bargaining Table
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob wants to put a new bargaining table in his office. To do so he measured the office room thoroughly and drew its plan: Bob's office room is a rectangular room *n*<=×<=*m* meters. Each square meter of the room is either occupied by some furniture, or free. A bargaining table is rectangular, and should be placed so, that its sides are parallel to the office walls. Bob doesn't want to change or rearrange anything, that's why all the squares that will be occupied by the table should be initially free. Bob wants the new table to sit as many people as possible, thus its perimeter should be maximal. Help Bob find out the maximum possible perimeter of a bargaining table for his office.
Input Specification:
The first line contains 2 space-separated numbers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=25) — the office room dimensions. Then there follow *n* lines with *m* characters 0 or 1 each. 0 stands for a free square meter of the office room. 1 stands for an occupied square meter. It's guaranteed that at least one square meter in the room is free.
Output Specification:
Output one number — the maximum possible perimeter of a bargaining table for Bob's office room.
Demo Input:
['3 3\n000\n010\n000\n', '5 4\n1100\n0000\n0000\n0000\n0000\n']
Demo Output:
['8\n', '16\n']
Note:
none | ```python
import sys; R = sys.stdin.readline
S = lambda: map(int,R().split())
n,m = S()
a = [R().rstrip() for _ in range(n)]
d = {}
r = 4
for i in range(n):
for j in range(m):
if a[i][j]=='1': continue
d[(i,j,i,j)] = 1
for l in range(j+1,m):
if a[i][l]=='1': break
d[(i,j,i,l)] = 1
r = max(r,2*(l-j)+4)
for k in range(i+1,n):
if a[k][j]=='1': break
d[(i,j,k,j)] = 1
r = max(r,2*(k-i)+4)
for l in range(j+1,m):
if a[k][l]=='1': break
if (i,j,k-1,l) in d and (i,j,k,l-1) in d:
d[(i,j,k,l)] = 1
r = max(r,2*(k-i+l-j)+4)
print(r)
``` | 3.858805 |
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,645,290,264 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 81 | 186 | 0 | vecs = list(zip(*[[int(x) for x in input().split()]for i in range(int(input()))]))
def main():
for i in vecs:
if sum(i) != 0:
return "NO"
return "YES"
print(main())
| Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
vecs = list(zip(*[[int(x) for x in input().split()]for i in range(int(input()))]))
def main():
for i in vecs:
if sum(i) != 0:
return "NO"
return "YES"
print(main())
``` | 3.9535 |
461 | A | Appleman and Toastman | PROGRAMMING | 1,200 | [
"greedy",
"sortings"
] | null | null | Appleman and Toastman play a game. Initially Appleman gives one group of *n* numbers to the Toastman, then they start to complete the following tasks:
- Each time Toastman gets a group of numbers, he sums up all the numbers and adds this sum to the score. Then he gives the group to the Appleman. - Each time Appleman gets a group consisting of a single number, he throws this group out. Each time Appleman gets a group consisting of more than one number, he splits the group into two non-empty groups (he can do it in any way) and gives each of them to Toastman.
After guys complete all the tasks they look at the score value. What is the maximum possible value of score they can get? | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=106) — the initial group that is given to Toastman. | Print a single integer — the largest possible score. | [
"3\n3 1 5\n",
"1\n10\n"
] | [
"26\n",
"10\n"
] | Consider the following situation in the first example. Initially Toastman gets group [3, 1, 5] and adds 9 to the score, then he give the group to Appleman. Appleman splits group [3, 1, 5] into two groups: [3, 5] and [1]. Both of them should be given to Toastman. When Toastman receives group [1], he adds 1 to score and gives the group to Appleman (he will throw it out). When Toastman receives group [3, 5], he adds 8 to the score and gives the group to Appleman. Appleman splits [3, 5] in the only possible way: [5] and [3]. Then he gives both groups to Toastman. When Toastman receives [5], he adds 5 to the score and gives the group to Appleman (he will throws it out). When Toastman receives [3], he adds 3 to the score and gives the group to Appleman (he will throws it out). Finally Toastman have added 9 + 1 + 8 + 5 + 3 = 26 to the score. This is the optimal sequence of actions. | 500 | [
{
"input": "3\n3 1 5",
"output": "26"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "10\n8 10 2 5 6 2 4 7 2 1",
"output": "376"
},
{
"input": "10\n171308 397870 724672 431255 228496 892002 542924 718337 888642 161821",
"output": "40204082"
},
{
"input": "10\n1 2 2 2 4 5 6 7 8 10",
"output": "376"
},
{
"input": "10\n161821 171308 228496 397870 431255 542924 718337 724672 888642 892002",
"output": "40204082"
},
{
"input": "1\n397870",
"output": "397870"
},
{
"input": "1\n1000000",
"output": "1000000"
},
{
"input": "10\n10 8 7 6 5 4 2 2 2 1",
"output": "376"
},
{
"input": "10\n892002 888642 724672 718337 542924 431255 397870 228496 171308 161821",
"output": "40204082"
},
{
"input": "10\n5 2 6 10 10 10 10 2 2 5",
"output": "485"
},
{
"input": "10\n431255 724672 228496 397870 397870 397870 397870 724672 888642 431255",
"output": "36742665"
},
{
"input": "10\n2 2 2 5 5 6 10 10 10 10",
"output": "485"
},
{
"input": "10\n228496 397870 397870 397870 397870 431255 431255 724672 724672 888642",
"output": "36742665"
},
{
"input": "10\n10 10 10 10 6 5 5 2 2 2",
"output": "485"
},
{
"input": "10\n888642 724672 724672 431255 431255 397870 397870 397870 397870 228496",
"output": "36742665"
},
{
"input": "10\n10 10 10 10 10 10 10 10 10 10",
"output": "640"
},
{
"input": "10\n1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000",
"output": "64000000"
},
{
"input": "1\n397870",
"output": "397870"
},
{
"input": "2\n1 2",
"output": "6"
},
{
"input": "2\n2 3",
"output": "10"
},
{
"input": "2\n1 1",
"output": "4"
}
] | 1,451,297,398 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | n=int(input())
a=[int(i) for i in input().split()]
a.sort()
zhecijiaji=sum(a)
he=zhecijiaji*2
for i in range(n-2):
zhecijiaji=zhecijiaji-a[i]
he=he+zhecijiaji
print(he)
| Title: Appleman and Toastman
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Appleman and Toastman play a game. Initially Appleman gives one group of *n* numbers to the Toastman, then they start to complete the following tasks:
- Each time Toastman gets a group of numbers, he sums up all the numbers and adds this sum to the score. Then he gives the group to the Appleman. - Each time Appleman gets a group consisting of a single number, he throws this group out. Each time Appleman gets a group consisting of more than one number, he splits the group into two non-empty groups (he can do it in any way) and gives each of them to Toastman.
After guys complete all the tasks they look at the score value. What is the maximum possible value of score they can get?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=106) — the initial group that is given to Toastman.
Output Specification:
Print a single integer — the largest possible score.
Demo Input:
['3\n3 1 5\n', '1\n10\n']
Demo Output:
['26\n', '10\n']
Note:
Consider the following situation in the first example. Initially Toastman gets group [3, 1, 5] and adds 9 to the score, then he give the group to Appleman. Appleman splits group [3, 1, 5] into two groups: [3, 5] and [1]. Both of them should be given to Toastman. When Toastman receives group [1], he adds 1 to score and gives the group to Appleman (he will throw it out). When Toastman receives group [3, 5], he adds 8 to the score and gives the group to Appleman. Appleman splits [3, 5] in the only possible way: [5] and [3]. Then he gives both groups to Toastman. When Toastman receives [5], he adds 5 to the score and gives the group to Appleman (he will throws it out). When Toastman receives [3], he adds 3 to the score and gives the group to Appleman (he will throws it out). Finally Toastman have added 9 + 1 + 8 + 5 + 3 = 26 to the score. This is the optimal sequence of actions. | ```python
n=int(input())
a=[int(i) for i in input().split()]
a.sort()
zhecijiaji=sum(a)
he=zhecijiaji*2
for i in range(n-2):
zhecijiaji=zhecijiaji-a[i]
he=he+zhecijiaji
print(he)
``` | 0 | |
873 | B | Balanced Substring | PROGRAMMING | 1,500 | [
"dp",
"implementation"
] | null | null | You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*. | The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*. | If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring. | [
"8\n11010111\n",
"3\n111\n"
] | [
"4\n",
"0\n"
] | In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring. | 0 | [
{
"input": "8\n11010111",
"output": "4"
},
{
"input": "3\n111",
"output": "0"
},
{
"input": "11\n00001000100",
"output": "2"
},
{
"input": "10\n0100000000",
"output": "2"
},
{
"input": "13\n0001000011010",
"output": "6"
},
{
"input": "14\n00000100101011",
"output": "10"
},
{
"input": "14\n01111101111111",
"output": "2"
},
{
"input": "18\n110010101101111111",
"output": "10"
},
{
"input": "11\n00010000011",
"output": "4"
},
{
"input": "10\n1000010110",
"output": "6"
},
{
"input": "15\n100000100000011",
"output": "4"
},
{
"input": "18\n011010101110111101",
"output": "8"
},
{
"input": "10\n0011011111",
"output": "6"
},
{
"input": "3\n011",
"output": "2"
},
{
"input": "14\n11111111111111",
"output": "0"
},
{
"input": "65\n11001000110001001011011110111100000000101001001010101111000100010",
"output": "48"
},
{
"input": "10\n0011111000",
"output": "10"
},
{
"input": "13\n1110000001110",
"output": "12"
},
{
"input": "3\n110",
"output": "2"
},
{
"input": "4\n1110",
"output": "2"
},
{
"input": "9\n001011001",
"output": "8"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n01",
"output": "2"
},
{
"input": "12\n110000110000",
"output": "8"
},
{
"input": "3\n001",
"output": "2"
},
{
"input": "14\n11000011000000",
"output": "8"
},
{
"input": "19\n0000011111111100000",
"output": "18"
},
{
"input": "45\n011010001100001111110001011100000001101100111",
"output": "44"
},
{
"input": "18\n000001111111100000",
"output": "16"
},
{
"input": "4\n0101",
"output": "4"
},
{
"input": "12\n000101011001",
"output": "10"
}
] | 1,696,780,223 | 2,147,483,647 | Python 3 | OK | TESTS | 53 | 78 | 14,848,000 | n = int(input())
s = input()
zero = 0
one = 0
dct = {0: -1}
ans = 0
for i in range(n):
if s[i] == '0':
zero += 1
else:
one += 1
diff = zero - one
#print(i, diff)
if diff not in dct:
dct[diff] = i
else:
ans = max(ans, i - dct[diff])
#print(dct[diff], 'a')
print(ans)
| Title: Balanced Substring
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting only of characters 0 and 1. A substring [*l*,<=*r*] of *s* is a string *s**l**s**l*<=+<=1*s**l*<=+<=2... *s**r*, and its length equals to *r*<=-<=*l*<=+<=1. A substring is called balanced if the number of zeroes (0) equals to the number of ones in this substring.
You have to determine the length of the longest balanced substring of *s*.
Input Specification:
The first line contains *n* (1<=≤<=*n*<=≤<=100000) — the number of characters in *s*.
The second line contains a string *s* consisting of exactly *n* characters. Only characters 0 and 1 can appear in *s*.
Output Specification:
If there is no non-empty balanced substring in *s*, print 0. Otherwise, print the length of the longest balanced substring.
Demo Input:
['8\n11010111\n', '3\n111\n']
Demo Output:
['4\n', '0\n']
Note:
In the first example you can choose the substring [3, 6]. It is balanced, and its length is 4. Choosing the substring [2, 5] is also possible.
In the second example it's impossible to find a non-empty balanced substring. | ```python
n = int(input())
s = input()
zero = 0
one = 0
dct = {0: -1}
ans = 0
for i in range(n):
if s[i] == '0':
zero += 1
else:
one += 1
diff = zero - one
#print(i, diff)
if diff not in dct:
dct[diff] = i
else:
ans = max(ans, i - dct[diff])
#print(dct[diff], 'a')
print(ans)
``` | 3 | |
754 | A | Lesha and array splitting | PROGRAMMING | 1,200 | [
"constructive algorithms",
"greedy",
"implementation"
] | null | null | One spring day on his way to university Lesha found an array *A*. Lesha likes to split arrays into several parts. This time Lesha decided to split the array *A* into several, possibly one, new arrays so that the sum of elements in each of the new arrays is not zero. One more condition is that if we place the new arrays one after another they will form the old array *A*.
Lesha is tired now so he asked you to split the array. Help Lesha! | The first line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array *A*.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=103<=≤<=*a**i*<=≤<=103) — the elements of the array *A*. | If it is not possible to split the array *A* and satisfy all the constraints, print single line containing "NO" (without quotes).
Otherwise in the first line print "YES" (without quotes). In the next line print single integer *k* — the number of new arrays. In each of the next *k* lines print two integers *l**i* and *r**i* which denote the subarray *A*[*l**i*... *r**i*] of the initial array *A* being the *i*-th new array. Integers *l**i*, *r**i* should satisfy the following conditions:
- *l*1<==<=1 - *r**k*<==<=*n* - *r**i*<=+<=1<==<=*l**i*<=+<=1 for each 1<=≤<=*i*<=<<=*k*.
If there are multiple answers, print any of them. | [
"3\n1 2 -3\n",
"8\n9 -12 3 4 -4 -10 7 3\n",
"1\n0\n",
"4\n1 2 3 -5\n"
] | [
"YES\n2\n1 2\n3 3\n",
"YES\n2\n1 2\n3 8\n",
"NO\n",
"YES\n4\n1 1\n2 2\n3 3\n4 4\n"
] | none | 500 | [
{
"input": "3\n1 2 -3",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "8\n9 -12 3 4 -4 -10 7 3",
"output": "YES\n8\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8"
},
{
"input": "1\n0",
"output": "NO"
},
{
"input": "4\n1 2 3 -5",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "6\n0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n507 -724 -243 -846 697 -569 -786 472 756 -272 731 -534 -664 202 592 -381 161 -668 -895 296 472 -868 599 396 -617 310 -283 -118 829 -218 807 939 -152 -343 -96 692 -570 110 442 159 -446 -631 -881 784 894 -3 -792 654 -273 -791 638 -599 -763 586 -812 248 -590 455 926 -402 61 228 209 419 -511 310 -283 857 369 472 -82 -435 -717 -421 862 -384 659 -235 406 793 -167 -504 -432 -951 0 165 36 650 -145 -500 988 -513 -495 -476 312 -754 332 819 -797 -715",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "100\n1 -2 -1 -1 2 2 0 1 -1 1 0 -2 1 -1 0 -2 -1 -1 2 0 -1 2 0 1 -2 -2 -1 1 2 0 -2 -2 -1 1 1 -1 -2 -1 0 -1 2 1 -1 -2 0 2 1 1 -2 1 1 -1 2 -2 2 0 1 -1 1 -2 0 0 0 0 0 0 -2 -2 2 1 2 2 0 -1 1 1 -2 -2 -2 1 0 2 -1 -2 -1 0 0 0 2 1 -2 0 -2 0 2 1 -2 -1 2 1",
"output": "YES\n78\n1 1\n2 2\n3 3\n4 4\n5 5\n6 7\n8 8\n9 9\n10 11\n12 12\n13 13\n14 15\n16 16\n17 17\n18 18\n19 20\n21 21\n22 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 39\n40 40\n41 41\n42 42\n43 43\n44 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 56\n57 57\n58 58\n59 59\n60 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 73\n74 74\n75 75\n76 76\n77 77\n78 78\n79 79\n80 81\n82 82\n83 83\n84 84\n85 88\n89 89\n90 90\n91 92\n93 94\n95 95\n96 96\n..."
},
{
"input": "7\n0 0 0 0 3 -3 0",
"output": "YES\n2\n1 5\n6 7"
},
{
"input": "5\n0 0 -4 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "100\n2 -38 51 -71 -24 19 35 -27 48 18 64 -4 30 -28 74 -17 -19 -25 54 41 3 -46 -43 -42 87 -76 -62 28 1 32 7 -76 15 0 -82 -33 17 40 -41 -7 43 -18 -27 65 -27 -13 46 -38 75 7 62 -23 7 -12 80 36 37 14 6 -40 -11 -35 -77 -24 -59 75 -41 -21 17 -21 -14 67 -36 16 -1 34 -26 30 -62 -4 -63 15 -49 18 57 7 77 23 -26 8 -20 8 -16 9 50 -24 -33 9 -9 -33",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75 75\n76..."
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -38 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 100"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n0 0 -17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 17 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 34\n35 100"
},
{
"input": "3\n1 -3 3",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "3\n1 0 -1",
"output": "YES\n2\n1 2\n3 3"
},
{
"input": "3\n3 0 0",
"output": "YES\n1\n1 3"
},
{
"input": "3\n0 0 0",
"output": "NO"
},
{
"input": "3\n-3 3 0",
"output": "YES\n2\n1 1\n2 3"
},
{
"input": "4\n3 -2 -1 3",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "4\n-1 0 1 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "4\n0 0 0 3",
"output": "YES\n1\n1 4"
},
{
"input": "4\n0 0 0 0",
"output": "NO"
},
{
"input": "4\n3 0 -3 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "5\n-3 2 2 0 -2",
"output": "YES\n4\n1 1\n2 2\n3 4\n5 5"
},
{
"input": "5\n0 -1 2 0 -1",
"output": "YES\n3\n1 2\n3 4\n5 5"
},
{
"input": "5\n0 2 0 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "5\n0 0 0 0 0",
"output": "NO"
},
{
"input": "5\n0 0 0 0 0",
"output": "NO"
},
{
"input": "20\n101 89 -166 -148 -38 -135 -138 193 14 -134 -185 -171 -52 -191 195 39 -148 200 51 -73",
"output": "YES\n20\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20"
},
{
"input": "20\n-118 -5 101 7 9 144 55 -55 -9 -126 -71 -71 189 -64 -187 123 0 -48 -12 138",
"output": "YES\n19\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 17\n18 18\n19 19\n20 20"
},
{
"input": "20\n-161 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 20"
},
{
"input": "20\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "20\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 -137 0 0 0 0 137",
"output": "YES\n2\n1 19\n20 20"
},
{
"input": "40\n64 -94 -386 -78 35 -233 33 82 -5 -200 368 -259 124 353 390 -305 -247 -133 379 44 133 -146 151 -217 -16 53 -157 186 -203 -8 117 -71 272 -290 -97 133 52 113 -280 -176",
"output": "YES\n40\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40"
},
{
"input": "40\n120 -96 -216 131 231 -80 -166 -102 16 227 -120 105 43 -83 -53 229 24 190 -268 119 230 348 -33 19 0 -187 -349 -25 80 -38 -30 138 -104 337 -98 0 1 -66 -243 -231",
"output": "YES\n38\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 36\n37 37\n38 38\n39 39\n40 40"
},
{
"input": "40\n0 0 0 0 0 0 324 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 40"
},
{
"input": "40\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "40\n0 0 0 0 0 308 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -308 0 0 0 0 0 0 0",
"output": "YES\n2\n1 32\n33 40"
},
{
"input": "60\n-288 -213 -213 -23 496 489 137 -301 -219 -296 -577 269 -153 -52 -505 -138 -377 500 -256 405 588 274 -115 375 -93 117 -360 -160 429 -339 502 310 502 572 -41 -26 152 -203 562 -525 -179 -67 424 62 -329 -127 352 -474 417 -30 518 326 200 -598 471 107 339 107 -9 -244",
"output": "YES\n60\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60"
},
{
"input": "60\n112 141 -146 -389 175 399 -59 327 -41 397 263 -422 157 0 471 -2 -381 -438 99 368 173 9 -171 118 24 111 120 70 11 317 -71 -574 -139 0 -477 -211 -116 -367 16 568 -75 -430 75 -179 -21 156 291 -422 441 -224 -8 -337 -104 381 60 -138 257 91 103 -359",
"output": "YES\n58\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -238 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 60"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "60\n0 0 0 0 0 0 0 0 0 -98 0 0 0 0 0 0 0 0 98 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 18\n19 60"
},
{
"input": "80\n-295 -774 -700 -366 -304 -173 -672 288 -721 -256 -348 650 223 211 379 -13 -483 162 800 631 -550 -704 -357 -306 490 713 -80 -234 -669 675 -688 471 315 607 -87 -327 -799 514 248 379 271 325 -244 98 -100 -447 574 -154 554 -377 380 -423 -140 -147 -189 -420 405 464 -110 273 -226 -109 -578 641 -426 -548 214 -184 -397 570 -428 -676 652 -155 127 462 338 534 -782 -481",
"output": "YES\n80\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "80\n237 66 409 -208 -460 4 -448 29 -420 -192 -21 -76 -147 435 205 -42 -299 -29 244 -480 -4 -38 2 -214 -311 556 692 111 -19 -84 -90 -350 -354 125 -207 -137 93 367 -481 -462 -440 -92 424 -107 221 -100 -631 -72 105 201 226 -90 197 -264 427 113 202 -144 -115 398 331 147 56 -24 292 -267 -31 -11 202 506 334 -103 534 -155 -472 -124 -257 209 12 360",
"output": "YES\n80\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75..."
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 668 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 80"
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "80\n0 0 0 0 0 0 0 0 0 0 0 0 -137 137 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n2\n1 13\n14 80"
},
{
"input": "100\n-98 369 544 197 -991 231 399 521 582 -820 -650 -919 -615 -411 -843 -974 231 140 239 -209 721 84 -834 -27 162 460 -157 -40 0 -778 -491 -607 -34 -647 834 -7 -518 -5 -31 -766 -54 -698 -838 497 980 -77 238 549 -135 7 -629 -892 455 181 527 314 465 -321 656 -390 368 384 601 332 561 -1000 -636 -106 412 -216 -58 -365 -155 -445 404 114 260 -392 -20 840 -395 620 -860 -936 1 882 958 536 589 235 300 676 478 434 229 698 157 -95 908 -170",
"output": "YES\n99\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n75 75\n76..."
},
{
"input": "100\n-149 -71 -300 288 -677 -580 248 49 -167 264 -215 878 7 252 -239 25 -369 -22 526 -415 -175 173 549 679 161 -411 743 -454 -34 -714 282 -198 -47 -519 -45 71 615 -214 -317 399 86 -97 246 689 -22 -197 -139 237 -501 477 -385 -421 -463 -641 409 -279 538 -382 48 189 652 -696 74 303 6 -183 336 17 -178 -617 -739 280 -202 454 864 218 480 293 -118 -518 -24 -866 -357 410 239 -833 510 316 -168 38 -370 -22 741 470 -60 -507 -209 704 141 -148",
"output": "YES\n100\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54\n55 55\n56 56\n57 57\n58 58\n59 59\n60 60\n61 61\n62 62\n63 63\n64 64\n65 65\n66 66\n67 67\n68 68\n69 69\n70 70\n71 71\n72 72\n73 73\n74 74\n7..."
},
{
"input": "100\n0 0 697 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "YES\n1\n1 100"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -475 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 475 0 0 0 0",
"output": "YES\n2\n1 95\n96 100"
},
{
"input": "4\n0 0 3 -3",
"output": "YES\n2\n1 3\n4 4"
},
{
"input": "4\n1 0 0 0",
"output": "YES\n1\n1 4"
},
{
"input": "4\n3 3 3 3",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "2\n0 1",
"output": "YES\n1\n1 2"
},
{
"input": "4\n0 -1 1 0",
"output": "YES\n2\n1 2\n3 4"
},
{
"input": "1\n1",
"output": "YES\n1\n1 1"
},
{
"input": "5\n0 0 1 0 0",
"output": "YES\n1\n1 5"
},
{
"input": "4\n0 0 1 0",
"output": "YES\n1\n1 4"
},
{
"input": "10\n1 2 0 0 3 -3 0 0 -3 0",
"output": "YES\n5\n1 1\n2 4\n5 5\n6 8\n9 10"
},
{
"input": "3\n0 -1 0",
"output": "YES\n1\n1 3"
},
{
"input": "2\n1 0",
"output": "YES\n1\n1 2"
},
{
"input": "5\n3 -3 0 0 0",
"output": "YES\n2\n1 1\n2 5"
},
{
"input": "3\n0 1 0",
"output": "YES\n1\n1 3"
},
{
"input": "4\n0 0 0 1",
"output": "YES\n1\n1 4"
},
{
"input": "4\n1 -1 1 -1",
"output": "YES\n4\n1 1\n2 2\n3 3\n4 4"
},
{
"input": "1\n-1",
"output": "YES\n1\n1 1"
},
{
"input": "2\n1 1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n1 -1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n0 0",
"output": "NO"
},
{
"input": "2\n0 -1",
"output": "YES\n1\n1 2"
},
{
"input": "2\n-1 1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "2\n-1 0",
"output": "YES\n1\n1 2"
},
{
"input": "2\n-1 -1",
"output": "YES\n2\n1 1\n2 2"
},
{
"input": "3\n5 -5 5",
"output": "YES\n3\n1 1\n2 2\n3 3"
},
{
"input": "5\n1 0 -1 0 1",
"output": "YES\n3\n1 2\n3 4\n5 5"
},
{
"input": "6\n0 0 0 3 0 0",
"output": "YES\n1\n1 6"
},
{
"input": "3\n1 -1 1",
"output": "YES\n3\n1 1\n2 2\n3 3"
}
] | 1,641,183,605 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 15 | 0 | print('aa') | Title: Lesha and array splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One spring day on his way to university Lesha found an array *A*. Lesha likes to split arrays into several parts. This time Lesha decided to split the array *A* into several, possibly one, new arrays so that the sum of elements in each of the new arrays is not zero. One more condition is that if we place the new arrays one after another they will form the old array *A*.
Lesha is tired now so he asked you to split the array. Help Lesha!
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array *A*.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=103<=≤<=*a**i*<=≤<=103) — the elements of the array *A*.
Output Specification:
If it is not possible to split the array *A* and satisfy all the constraints, print single line containing "NO" (without quotes).
Otherwise in the first line print "YES" (without quotes). In the next line print single integer *k* — the number of new arrays. In each of the next *k* lines print two integers *l**i* and *r**i* which denote the subarray *A*[*l**i*... *r**i*] of the initial array *A* being the *i*-th new array. Integers *l**i*, *r**i* should satisfy the following conditions:
- *l*1<==<=1 - *r**k*<==<=*n* - *r**i*<=+<=1<==<=*l**i*<=+<=1 for each 1<=≤<=*i*<=<<=*k*.
If there are multiple answers, print any of them.
Demo Input:
['3\n1 2 -3\n', '8\n9 -12 3 4 -4 -10 7 3\n', '1\n0\n', '4\n1 2 3 -5\n']
Demo Output:
['YES\n2\n1 2\n3 3\n', 'YES\n2\n1 2\n3 8\n', 'NO\n', 'YES\n4\n1 1\n2 2\n3 3\n4 4\n']
Note:
none | ```python
print('aa')
``` | 0 | |
680 | B | Bear and Finding Criminals | PROGRAMMING | 1,000 | [
"constructive algorithms",
"implementation"
] | null | null | There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD. | The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city. | Print the number of criminals Limak will catch. | [
"6 3\n1 1 1 0 1 0\n",
"5 2\n0 0 0 1 0\n"
] | [
"3\n",
"1\n"
] | In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is. | 1,000 | [
{
"input": "6 3\n1 1 1 0 1 0",
"output": "3"
},
{
"input": "5 2\n0 0 0 1 0",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "9 3\n1 1 1 1 1 1 1 1 0",
"output": "8"
},
{
"input": "9 5\n1 0 1 0 1 0 1 0 1",
"output": "5"
},
{
"input": "20 17\n1 1 0 1 1 1 1 0 1 0 1 1 1 0 1 1 0 0 0 0",
"output": "10"
},
{
"input": "100 60\n1 1 1 1 1 1 0 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 0 1 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 0 0 1 0 0 0 1 1 1 0 1 0 0 1 1 1 0 1 1 1 0 0 1 1 0 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 1 1 1 0 1 0 0",
"output": "27"
},
{
"input": "8 1\n1 0 1 1 0 0 1 0",
"output": "4"
},
{
"input": "11 11\n0 1 0 0 1 1 1 0 0 0 0",
"output": "4"
},
{
"input": "19 10\n0 1 1 0 1 0 0 1 1 0 0 1 0 1 0 0 1 0 1",
"output": "4"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "3"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "98 70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "41"
},
{
"input": "99 70\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "9"
},
{
"input": "99 60\n0 0 0 1 1 0 1 1 0 0 1 0 0 0 0 0 1 0 1 0 0 0 1 0 1 1 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 1 0 0 1 1 1 0 0 0 0 1 1 0 1 1 1 1 0 0 0 0 0 0 1 1 1",
"output": "34"
},
{
"input": "98 24\n0 0 0 1 1 0 1 1 0 0 0 0 1 0 0 1 0 0 1 1 1 0 0 1 0 0 1 0 1 0 0 1 1 0 1 1 1 0 1 0 0 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 1 1 0 0 1 0 0 0 1 0 1 1 0 1 0 1 1 1 0 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 1 0 1 0 0 1 1",
"output": "39"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "2 1\n0 1",
"output": "1"
}
] | 1,636,382,152 | 2,147,483,647 | PyPy 3 | OK | TESTS | 24 | 93 | 17,715,200 | n, p = map(int, input().split())
a, res, p = list(map(int, input().split())), 0, p - 1
for x in range(p + 1, n):
if a[x] == 1 and ((p << 1) < x or a[(p << 1) - x] == 1): res += 1
for x in range(p - 1, -1, -1):
if a[x] == 1 and ((p << 1) - x >= n or a[(p << 1) - x] == 1): res += 1
print(res + a[p]) | Title: Bear and Finding Criminals
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD.
Input Specification:
The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city.
Output Specification:
Print the number of criminals Limak will catch.
Demo Input:
['6 3\n1 1 1 0 1 0\n', '5 2\n0 0 0 1 0\n']
Demo Output:
['3\n', '1\n']
Note:
In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is. | ```python
n, p = map(int, input().split())
a, res, p = list(map(int, input().split())), 0, p - 1
for x in range(p + 1, n):
if a[x] == 1 and ((p << 1) < x or a[(p << 1) - x] == 1): res += 1
for x in range(p - 1, -1, -1):
if a[x] == 1 and ((p << 1) - x >= n or a[(p << 1) - x] == 1): res += 1
print(res + a[p])
``` | 3 | |
893 | C | Rumor | PROGRAMMING | 1,300 | [
"dfs and similar",
"graphs",
"greedy"
] | null | null | Vova promised himself that he would never play computer games... But recently Firestorm — a well-known game developing company — published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it.
Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it.
Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on.
The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest?
Take a look at the notes if you think you haven't understood the problem completely. | The first line contains two integer numbers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of characters in Overcity and the number of pairs of friends.
The second line contains *n* integer numbers *c**i* (0<=≤<=*c**i*<=≤<=109) — the amount of gold *i*-th character asks to start spreading the rumor.
Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*). It is guaranteed that each pair is listed at most once. | Print one number — the minimum amount of gold Vova has to spend in order to finish the quest. | [
"5 2\n2 5 3 4 8\n1 4\n4 5\n",
"10 0\n1 2 3 4 5 6 7 8 9 10\n",
"10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n"
] | [
"10\n",
"55\n",
"15\n"
] | In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor.
In the second example Vova has to bribe everyone.
In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters. | 0 | [
{
"input": "5 2\n2 5 3 4 8\n1 4\n4 5",
"output": "10"
},
{
"input": "10 0\n1 2 3 4 5 6 7 8 9 10",
"output": "55"
},
{
"input": "10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10",
"output": "15"
},
{
"input": "1 0\n0",
"output": "0"
},
{
"input": "1 0\n1000000000",
"output": "1000000000"
},
{
"input": "2 0\n0 0",
"output": "0"
},
{
"input": "2 0\n1000000000 0",
"output": "1000000000"
},
{
"input": "2 0\n0 1000000000",
"output": "1000000000"
},
{
"input": "2 0\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "2 1\n0 0\n1 2",
"output": "0"
}
] | 1,618,766,434 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 3 | 1,045 | 17,305,600 |
N, M = list(map(int, input().split()))
cost = list(map(int, input().split()))
graph = [[] for _ in range(N)]
for _ in range(M):
u, v = list(map(int, input().split()))
u -= 1
v -= 1
graph[u].append(v)
graph[v].append(u)
def DFS(node):
for nei in graph[node]:
if visited[nei] == False:
visited[nei] = True
DFS(nei)
sorted_cost = sorted([(val, idx) for idx, val in enumerate(cost)])
visited = [False] * N
result = 0
for c, idx in sorted_cost:
if graph[idx]:
if visited[idx] == False:
visited[idx] = True
DFS(idx)
result += c
for idx, visit in enumerate(visited):
if visit == False:
result += cost[idx]
print(result)
| Title: Rumor
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vova promised himself that he would never play computer games... But recently Firestorm — a well-known game developing company — published their newest game, World of Farcraft, and it became really popular. Of course, Vova started playing it.
Now he tries to solve a quest. The task is to come to a settlement named Overcity and spread a rumor in it.
Vova knows that there are *n* characters in Overcity. Some characters are friends to each other, and they share information they got. Also Vova knows that he can bribe each character so he or she starts spreading the rumor; *i*-th character wants *c**i* gold in exchange for spreading the rumor. When a character hears the rumor, he tells it to all his friends, and they start spreading the rumor to their friends (for free), and so on.
The quest is finished when all *n* characters know the rumor. What is the minimum amount of gold Vova needs to spend in order to finish the quest?
Take a look at the notes if you think you haven't understood the problem completely.
Input Specification:
The first line contains two integer numbers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of characters in Overcity and the number of pairs of friends.
The second line contains *n* integer numbers *c**i* (0<=≤<=*c**i*<=≤<=109) — the amount of gold *i*-th character asks to start spreading the rumor.
Then *m* lines follow, each containing a pair of numbers (*x**i*,<=*y**i*) which represent that characters *x**i* and *y**i* are friends (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*). It is guaranteed that each pair is listed at most once.
Output Specification:
Print one number — the minimum amount of gold Vova has to spend in order to finish the quest.
Demo Input:
['5 2\n2 5 3 4 8\n1 4\n4 5\n', '10 0\n1 2 3 4 5 6 7 8 9 10\n', '10 5\n1 6 2 7 3 8 4 9 5 10\n1 2\n3 4\n5 6\n7 8\n9 10\n']
Demo Output:
['10\n', '55\n', '15\n']
Note:
In the first example the best decision is to bribe the first character (he will spread the rumor to fourth character, and the fourth one will spread it to fifth). Also Vova has to bribe the second and the third characters, so they know the rumor.
In the second example Vova has to bribe everyone.
In the third example the optimal decision is to bribe the first, the third, the fifth, the seventh and the ninth characters. | ```python
N, M = list(map(int, input().split()))
cost = list(map(int, input().split()))
graph = [[] for _ in range(N)]
for _ in range(M):
u, v = list(map(int, input().split()))
u -= 1
v -= 1
graph[u].append(v)
graph[v].append(u)
def DFS(node):
for nei in graph[node]:
if visited[nei] == False:
visited[nei] = True
DFS(nei)
sorted_cost = sorted([(val, idx) for idx, val in enumerate(cost)])
visited = [False] * N
result = 0
for c, idx in sorted_cost:
if graph[idx]:
if visited[idx] == False:
visited[idx] = True
DFS(idx)
result += c
for idx, visit in enumerate(visited):
if visit == False:
result += cost[idx]
print(result)
``` | -1 | |
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
] | A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] | [
"word\nl10n\ni18n\np43s\n"
] | none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,694,497,657 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | n = input()
def long_words(n):
if len(n) > 10:
length_between = len(n) - 2
word = n[0] + str(length_between) + n[-1]
return word
print(long_words(n)) | Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
n = input()
def long_words(n):
if len(n) > 10:
length_between = len(n) - 2
word = n[0] + str(length_between) + n[-1]
return word
print(long_words(n))
``` | 0 |
371 | C | Hamburgers | PROGRAMMING | 1,600 | [
"binary search",
"brute force"
] | null | null | Polycarpus loves hamburgers very much. He especially adores the hamburgers he makes with his own hands. Polycarpus thinks that there are only three decent ingredients to make hamburgers from: a bread, sausage and cheese. He writes down the recipe of his favorite "Le Hamburger de Polycarpus" as a string of letters 'B' (bread), 'S' (sausage) и 'C' (cheese). The ingredients in the recipe go from bottom to top, for example, recipe "ВSCBS" represents the hamburger where the ingredients go from bottom to top as bread, sausage, cheese, bread and sausage again.
Polycarpus has *n**b* pieces of bread, *n**s* pieces of sausage and *n**c* pieces of cheese in the kitchen. Besides, the shop nearby has all three ingredients, the prices are *p**b* rubles for a piece of bread, *p**s* for a piece of sausage and *p**c* for a piece of cheese.
Polycarpus has *r* rubles and he is ready to shop on them. What maximum number of hamburgers can he cook? You can assume that Polycarpus cannot break or slice any of the pieces of bread, sausage or cheese. Besides, the shop has an unlimited number of pieces of each ingredient. | The first line of the input contains a non-empty string that describes the recipe of "Le Hamburger de Polycarpus". The length of the string doesn't exceed 100, the string contains only letters 'B' (uppercase English B), 'S' (uppercase English S) and 'C' (uppercase English C).
The second line contains three integers *n**b*, *n**s*, *n**c* (1<=≤<=*n**b*,<=*n**s*,<=*n**c*<=≤<=100) — the number of the pieces of bread, sausage and cheese on Polycarpus' kitchen. The third line contains three integers *p**b*, *p**s*, *p**c* (1<=≤<=*p**b*,<=*p**s*,<=*p**c*<=≤<=100) — the price of one piece of bread, sausage and cheese in the shop. Finally, the fourth line contains integer *r* (1<=≤<=*r*<=≤<=1012) — the number of rubles Polycarpus has.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | Print the maximum number of hamburgers Polycarpus can make. If he can't make any hamburger, print 0. | [
"BBBSSC\n6 4 1\n1 2 3\n4\n",
"BBC\n1 10 1\n1 10 1\n21\n",
"BSC\n1 1 1\n1 1 3\n1000000000000\n"
] | [
"2\n",
"7\n",
"200000000001\n"
] | none | 1,500 | [
{
"input": "BBBSSC\n6 4 1\n1 2 3\n4",
"output": "2"
},
{
"input": "BBC\n1 10 1\n1 10 1\n21",
"output": "7"
},
{
"input": "BSC\n1 1 1\n1 1 3\n1000000000000",
"output": "200000000001"
},
{
"input": "B\n1 1 1\n1 1 1\n381",
"output": "382"
},
{
"input": "BSC\n3 5 6\n7 3 9\n100",
"output": "10"
},
{
"input": "BSC\n100 1 1\n100 1 1\n100",
"output": "51"
},
{
"input": "SBBCCSBB\n1 50 100\n31 59 21\n100000",
"output": "370"
},
{
"input": "BBBBCCCCCCCCCCCCCCCCCCCCSSSSBBBBBBBBSS\n100 100 100\n1 1 1\n3628800",
"output": "95502"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n200",
"output": "0"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n2000",
"output": "1"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n300",
"output": "0"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n300000000",
"output": "42858"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n914159265358",
"output": "130594181"
},
{
"input": "SSSSSSSSSSBBBBBBBBBCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSBB\n31 53 97\n13 17 31\n914159265358",
"output": "647421579"
},
{
"input": "BBBCSBSBBSSSSCCCCBBCSBBBBSSBBBCBSCCSSCSSCSBSSSCCCCBSCSSBSSSCCCBBCCCSCBCBBCCSCCCCSBBCCBBBBCCCCCCBSSCB\n91 87 17\n64 44 43\n958532915587",
"output": "191668251"
},
{
"input": "CSSCBBCCCSBSCBBBCSBBBCBSBCSCBCSCBCBSBCBCSSBBSBBCBBBBSCSBBCCBCCBCBBSBSBCSCSBBSSBBCSSBCSCSCCSSBCBBCBSB\n56 34 48\n78 6 96\n904174875419",
"output": "140968956"
},
{
"input": "CCSCCCSBBBSCBSCSCCSSBBBSSBBBSBBBCBCSSBCSCBBCCCBCBCBCCCSSBSBBCCCCCBBSCBSCBCBBCBBCSSBCSBSSCCSCCSCCBBBS\n33 73 67\n4 56 42\n886653164314",
"output": "277425898"
},
{
"input": "SBCSSCBBSSBCSSBBBSSBSCBSSSCBBSBBBBCSBCSBSCBSCBSCBSBSSCCCCBSBCCBCBSCCCBSCCBSBBCBSSCCCCSBSBBBSSSBCSCBC\n94 16 85\n14 18 91\n836590091442",
"output": "217522127"
},
{
"input": "BSCSBSCCSCSSCCCSBCSSBCBBSCCBSCCSSSSSSSSSCCSBSCCBBCBBSBSCCCCBCSBSBSSBBBBBSSBSSCBCCSSBSSSCBBCSBBSBCCCB\n67 54 8\n36 73 37\n782232051273",
"output": "154164772"
},
{
"input": "CBBCBSBCCSCBSSCCBCSBCSBBSCBBCSCCBSCCSCSBBSSBSBSCBBSBBCSSSSBBBBSBBCBCSBBCBCSSBBCSBSCCSCSBCSCBSCCBBCSC\n71 71 52\n52 88 3\n654400055575",
"output": "137826467"
},
{
"input": "CBBCBSBCCSCBSSCCBCSBCSBBSCBBCSCCBSCCSCSBBSBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCBBCSC\n100 1 1\n1 17 23\n954400055575",
"output": "1355681897"
},
{
"input": "C\n100 100 100\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n100 100 100\n100 100 100\n1000000000000",
"output": "100000001"
},
{
"input": "B\n100 100 100\n1 1 1\n1",
"output": "101"
},
{
"input": "SC\n2 1 1\n1 1 1\n100000000000",
"output": "50000000001"
},
{
"input": "B\n100 1 1\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\n1 1 1\n100 100 100\n1000000000000",
"output": "100000000"
},
{
"input": "CC\n1 1 1\n100 100 100\n1",
"output": "0"
},
{
"input": "B\n100 100 100\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "BSC\n100 100 100\n1 1 1\n1000000000000",
"output": "333333333433"
},
{
"input": "BSC\n100 100 100\n1 1 1\n1",
"output": "100"
}
] | 1,592,904,730 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 23 | 155 | 20,172,800 | #cost for x hamburgers
import math
def func(t):
return (max(0,(c1*t)-a)*x)+(max(0,(c2*t)-b)*y)+(max(0,(c3*t)-c)*z);
s=input()
a,b,c=map(int,input().split())
x,y,z=map(int,input().split())
r=int(input())
c1=s.count('B')
c2=s.count('S')
c3=s.count('C')
low=0
high=r*100
mid=0
ori=0
while(low<high):
mid=low+(((high-low))//2)
ans=func(mid)
if(ans<=r):
if(mid>ori):
ori=mid
low=mid
else:
break;
if(ans>r):
high=mid
print(ori)
| Title: Hamburgers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus loves hamburgers very much. He especially adores the hamburgers he makes with his own hands. Polycarpus thinks that there are only three decent ingredients to make hamburgers from: a bread, sausage and cheese. He writes down the recipe of his favorite "Le Hamburger de Polycarpus" as a string of letters 'B' (bread), 'S' (sausage) и 'C' (cheese). The ingredients in the recipe go from bottom to top, for example, recipe "ВSCBS" represents the hamburger where the ingredients go from bottom to top as bread, sausage, cheese, bread and sausage again.
Polycarpus has *n**b* pieces of bread, *n**s* pieces of sausage and *n**c* pieces of cheese in the kitchen. Besides, the shop nearby has all three ingredients, the prices are *p**b* rubles for a piece of bread, *p**s* for a piece of sausage and *p**c* for a piece of cheese.
Polycarpus has *r* rubles and he is ready to shop on them. What maximum number of hamburgers can he cook? You can assume that Polycarpus cannot break or slice any of the pieces of bread, sausage or cheese. Besides, the shop has an unlimited number of pieces of each ingredient.
Input Specification:
The first line of the input contains a non-empty string that describes the recipe of "Le Hamburger de Polycarpus". The length of the string doesn't exceed 100, the string contains only letters 'B' (uppercase English B), 'S' (uppercase English S) and 'C' (uppercase English C).
The second line contains three integers *n**b*, *n**s*, *n**c* (1<=≤<=*n**b*,<=*n**s*,<=*n**c*<=≤<=100) — the number of the pieces of bread, sausage and cheese on Polycarpus' kitchen. The third line contains three integers *p**b*, *p**s*, *p**c* (1<=≤<=*p**b*,<=*p**s*,<=*p**c*<=≤<=100) — the price of one piece of bread, sausage and cheese in the shop. Finally, the fourth line contains integer *r* (1<=≤<=*r*<=≤<=1012) — the number of rubles Polycarpus has.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print the maximum number of hamburgers Polycarpus can make. If he can't make any hamburger, print 0.
Demo Input:
['BBBSSC\n6 4 1\n1 2 3\n4\n', 'BBC\n1 10 1\n1 10 1\n21\n', 'BSC\n1 1 1\n1 1 3\n1000000000000\n']
Demo Output:
['2\n', '7\n', '200000000001\n']
Note:
none | ```python
#cost for x hamburgers
import math
def func(t):
return (max(0,(c1*t)-a)*x)+(max(0,(c2*t)-b)*y)+(max(0,(c3*t)-c)*z);
s=input()
a,b,c=map(int,input().split())
x,y,z=map(int,input().split())
r=int(input())
c1=s.count('B')
c2=s.count('S')
c3=s.count('C')
low=0
high=r*100
mid=0
ori=0
while(low<high):
mid=low+(((high-low))//2)
ans=func(mid)
if(ans<=r):
if(mid>ori):
ori=mid
low=mid
else:
break;
if(ans>r):
high=mid
print(ori)
``` | 0 | |
682 | B | Alyona and Mex | PROGRAMMING | 1,200 | [
"sortings"
] | null | null | Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all.
Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array.
Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array.
The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array. | Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations. | [
"5\n1 3 3 3 6\n",
"2\n2 1\n"
] | [
"5\n",
"3\n"
] | In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5.
To reach the answer to the second sample case one must not decrease any of the array elements. | 1,000 | [
{
"input": "5\n1 3 3 3 6",
"output": "5"
},
{
"input": "2\n2 1",
"output": "3"
},
{
"input": "1\n1",
"output": "2"
},
{
"input": "1\n1000000000",
"output": "2"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n1 3",
"output": "3"
},
{
"input": "2\n2 2",
"output": "3"
},
{
"input": "2\n2 3",
"output": "3"
},
{
"input": "2\n3 3",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "3"
},
{
"input": "3\n3 1 1",
"output": "3"
},
{
"input": "3\n1 1 4",
"output": "3"
},
{
"input": "3\n2 1 2",
"output": "3"
},
{
"input": "3\n3 2 1",
"output": "4"
},
{
"input": "3\n2 4 1",
"output": "4"
},
{
"input": "3\n3 3 1",
"output": "4"
},
{
"input": "3\n1 3 4",
"output": "4"
},
{
"input": "3\n4 1 4",
"output": "4"
},
{
"input": "3\n2 2 2",
"output": "3"
},
{
"input": "3\n3 2 2",
"output": "4"
},
{
"input": "3\n4 2 2",
"output": "4"
},
{
"input": "3\n2 3 3",
"output": "4"
},
{
"input": "3\n4 2 3",
"output": "4"
},
{
"input": "3\n4 4 2",
"output": "4"
},
{
"input": "3\n3 3 3",
"output": "4"
},
{
"input": "3\n4 3 3",
"output": "4"
},
{
"input": "3\n4 3 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "4\n1 1 1 1",
"output": "2"
},
{
"input": "4\n1 1 2 1",
"output": "3"
},
{
"input": "4\n1 1 3 1",
"output": "3"
},
{
"input": "4\n1 4 1 1",
"output": "3"
},
{
"input": "4\n1 2 1 2",
"output": "3"
},
{
"input": "4\n1 3 2 1",
"output": "4"
},
{
"input": "4\n2 1 4 1",
"output": "4"
},
{
"input": "4\n3 3 1 1",
"output": "4"
},
{
"input": "4\n1 3 4 1",
"output": "4"
},
{
"input": "4\n1 1 4 4",
"output": "4"
},
{
"input": "4\n2 2 2 1",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "4"
},
{
"input": "4\n2 4 1 2",
"output": "4"
},
{
"input": "4\n3 3 1 2",
"output": "4"
},
{
"input": "4\n2 3 4 1",
"output": "5"
},
{
"input": "4\n1 4 2 4",
"output": "5"
},
{
"input": "4\n3 1 3 3",
"output": "4"
},
{
"input": "4\n3 4 3 1",
"output": "5"
},
{
"input": "4\n1 4 4 3",
"output": "5"
},
{
"input": "4\n4 1 4 4",
"output": "5"
},
{
"input": "4\n2 2 2 2",
"output": "3"
},
{
"input": "4\n2 2 3 2",
"output": "4"
},
{
"input": "4\n2 2 2 4",
"output": "4"
},
{
"input": "4\n2 2 3 3",
"output": "4"
},
{
"input": "4\n2 2 3 4",
"output": "5"
},
{
"input": "4\n2 4 4 2",
"output": "5"
},
{
"input": "4\n2 3 3 3",
"output": "4"
},
{
"input": "4\n2 4 3 3",
"output": "5"
},
{
"input": "4\n4 4 2 3",
"output": "5"
},
{
"input": "4\n4 4 4 2",
"output": "5"
},
{
"input": "4\n3 3 3 3",
"output": "4"
},
{
"input": "4\n3 3 3 4",
"output": "5"
},
{
"input": "4\n4 3 3 4",
"output": "5"
},
{
"input": "4\n4 4 3 4",
"output": "5"
},
{
"input": "4\n4 4 4 4",
"output": "5"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 3 3",
"output": "4"
},
{
"input": "20\n1 1 1 1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8",
"output": "9"
},
{
"input": "4\n2 2 2 3",
"output": "4"
},
{
"input": "3\n1 1 2",
"output": "3"
},
{
"input": "15\n1 2 2 20 23 25 28 60 66 71 76 77 79 99 100",
"output": "15"
},
{
"input": "7\n1 2 2 2 5 5 1",
"output": "5"
},
{
"input": "4\n1 1 1 2",
"output": "3"
},
{
"input": "5\n1 1 1 1 10000",
"output": "3"
},
{
"input": "5\n1 1 1 1 2",
"output": "3"
},
{
"input": "7\n1 3 3 3 3 3 6",
"output": "5"
},
{
"input": "4\n1 1 1 3",
"output": "3"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 100",
"output": "3"
},
{
"input": "4\n1 1 2 2",
"output": "3"
},
{
"input": "5\n1 1 1 3 4",
"output": "4"
},
{
"input": "8\n1 1 1 1 2 2 3 40",
"output": "5"
},
{
"input": "5\n1 1 1 1 1",
"output": "2"
},
{
"input": "7\n1 2 2 2 2 2 4",
"output": "4"
},
{
"input": "10\n1 1 1 10000000 10000000 10000000 10000000 10000000 10000000 10000000",
"output": "9"
},
{
"input": "10\n1 1 1 1 1 1 1 1 2 3",
"output": "4"
},
{
"input": "4\n8 8 8 8",
"output": "5"
},
{
"input": "5\n5 6 6 6 7",
"output": "6"
}
] | 1,496,112,196 | 2,147,483,647 | Python 3 | OK | TESTS | 127 | 140 | 8,806,400 | if __name__ == '__main__':
n = int(input())
line = list(map(int, input().split()))
line.sort()
rest = 1
for it in line:
rest += 1 if rest <= it else 0
print(rest)
| Title: Alyona and Mex
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all.
Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array.
Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array.
The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
Output Specification:
Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations.
Demo Input:
['5\n1 3 3 3 6\n', '2\n2 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5.
To reach the answer to the second sample case one must not decrease any of the array elements. | ```python
if __name__ == '__main__':
n = int(input())
line = list(map(int, input().split()))
line.sort()
rest = 1
for it in line:
rest += 1 if rest <= it else 0
print(rest)
``` | 3 | |
456 | A | Laptops | PROGRAMMING | 1,100 | [
"sortings"
] | null | null | One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct. | If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes). | [
"2\n1 2\n2 1\n"
] | [
"Happy Alex\n"
] | none | 500 | [
{
"input": "2\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "2\n1 1\n2 2",
"output": "Poor Alex"
},
{
"input": "3\n2 2\n3 3\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n3 3\n1 2\n2 1",
"output": "Happy Alex"
},
{
"input": "1\n1 1",
"output": "Poor Alex"
},
{
"input": "3\n2 3\n1 1\n3 2",
"output": "Happy Alex"
},
{
"input": "4\n4 1\n3 2\n2 3\n1 4",
"output": "Happy Alex"
},
{
"input": "2\n2 1\n1 2",
"output": "Happy Alex"
},
{
"input": "3\n3 2\n1 1\n2 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 1\n3 3",
"output": "Happy Alex"
},
{
"input": "3\n1 2\n2 3\n3 1",
"output": "Happy Alex"
}
] | 1,672,507,037 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 139 | 6,860,800 | n = int(input())
laptops = []
for i in range(n):
a, b = map(int, input().split())
laptops.append([a, b])
laptops.sort(key=lambda x: x[0])
i = 1
for laptop in laptops[1:]:
if not laptops[i - 1][1] > laptop[1]:
print("Poor Alex")
exit()
i += 1
print("Happy Alex")
| Title: Laptops
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Dima and Alex had an argument about the price and quality of laptops. Dima thinks that the more expensive a laptop is, the better it is. Alex disagrees. Alex thinks that there are two laptops, such that the price of the first laptop is less (strictly smaller) than the price of the second laptop but the quality of the first laptop is higher (strictly greater) than the quality of the second laptop.
Please, check the guess of Alex. You are given descriptions of *n* laptops. Determine whether two described above laptops exist.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of laptops.
Next *n* lines contain two integers each, *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*), where *a**i* is the price of the *i*-th laptop, and *b**i* is the number that represents the quality of the *i*-th laptop (the larger the number is, the higher is the quality).
All *a**i* are distinct. All *b**i* are distinct.
Output Specification:
If Alex is correct, print "Happy Alex", otherwise print "Poor Alex" (without the quotes).
Demo Input:
['2\n1 2\n2 1\n']
Demo Output:
['Happy Alex\n']
Note:
none | ```python
n = int(input())
laptops = []
for i in range(n):
a, b = map(int, input().split())
laptops.append([a, b])
laptops.sort(key=lambda x: x[0])
i = 1
for laptop in laptops[1:]:
if not laptops[i - 1][1] > laptop[1]:
print("Poor Alex")
exit()
i += 1
print("Happy Alex")
``` | 0 | |
158 | A | Next Round | PROGRAMMING | 800 | [
"*special",
"implementation"
] | null | null | "Contestant who earns a score equal to or greater than the *k*-th place finisher's score will advance to the next round, as long as the contestant earns a positive score..." — an excerpt from contest rules.
A total of *n* participants took part in the contest (*n*<=≥<=*k*), and you already know their scores. Calculate how many participants will advance to the next round. | The first line of the input contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50) separated by a single space.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100), where *a**i* is the score earned by the participant who got the *i*-th place. The given sequence is non-increasing (that is, for all *i* from 1 to *n*<=-<=1 the following condition is fulfilled: *a**i*<=≥<=*a**i*<=+<=1). | Output the number of participants who advance to the next round. | [
"8 5\n10 9 8 7 7 7 5 5\n",
"4 2\n0 0 0 0\n"
] | [
"6\n",
"0\n"
] | In the first example the participant on the 5th place earned 7 points. As the participant on the 6th place also earned 7 points, there are 6 advancers.
In the second example nobody got a positive score. | 500 | [
{
"input": "8 5\n10 9 8 7 7 7 5 5",
"output": "6"
},
{
"input": "4 2\n0 0 0 0",
"output": "0"
},
{
"input": "5 1\n1 1 1 1 1",
"output": "5"
},
{
"input": "5 5\n1 1 1 1 1",
"output": "5"
},
{
"input": "1 1\n10",
"output": "1"
},
{
"input": "17 14\n16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0",
"output": "14"
},
{
"input": "5 5\n3 2 1 0 0",
"output": "3"
},
{
"input": "8 6\n10 9 8 7 7 7 5 5",
"output": "6"
},
{
"input": "8 7\n10 9 8 7 7 7 5 5",
"output": "8"
},
{
"input": "8 4\n10 9 8 7 7 7 5 5",
"output": "6"
},
{
"input": "8 3\n10 9 8 7 7 7 5 5",
"output": "3"
},
{
"input": "8 1\n10 9 8 7 7 7 5 5",
"output": "1"
},
{
"input": "8 2\n10 9 8 7 7 7 5 5",
"output": "2"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "50 25\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "50 25\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "50 25\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "26"
},
{
"input": "50 25\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "11 5\n100 99 98 97 96 95 94 93 92 91 90",
"output": "5"
},
{
"input": "10 4\n100 81 70 69 64 43 34 29 15 3",
"output": "4"
},
{
"input": "11 6\n87 71 62 52 46 46 43 35 32 25 12",
"output": "6"
},
{
"input": "17 12\n99 88 86 82 75 75 74 65 58 52 45 30 21 16 7 2 2",
"output": "12"
},
{
"input": "20 3\n98 98 96 89 87 82 82 80 76 74 74 68 61 60 43 32 30 22 4 2",
"output": "3"
},
{
"input": "36 12\n90 87 86 85 83 80 79 78 76 70 69 69 61 61 59 58 56 48 45 44 42 41 33 31 27 25 23 21 20 19 15 14 12 7 5 5",
"output": "12"
},
{
"input": "49 8\n99 98 98 96 92 92 90 89 89 86 86 85 83 80 79 76 74 69 67 67 58 56 55 51 49 47 47 46 45 41 41 40 39 34 34 33 25 23 18 15 13 13 11 9 5 4 3 3 1",
"output": "9"
},
{
"input": "49 29\n100 98 98 96 96 96 95 87 85 84 81 76 74 70 63 63 63 62 57 57 56 54 53 52 50 47 45 41 41 39 38 31 30 28 27 26 23 22 20 15 15 11 7 6 6 4 2 1 0",
"output": "29"
},
{
"input": "49 34\n99 98 96 96 93 92 90 89 88 86 85 85 82 76 73 69 66 64 63 63 60 59 57 57 56 55 54 54 51 48 47 44 42 42 40 39 38 36 33 26 24 23 19 17 17 14 12 7 4",
"output": "34"
},
{
"input": "50 44\n100 100 99 97 95 91 91 84 83 83 79 71 70 69 69 62 61 60 59 59 58 58 58 55 55 54 52 48 47 45 44 44 38 36 32 31 28 28 25 25 24 24 24 22 17 15 14 13 12 4",
"output": "44"
},
{
"input": "50 13\n99 95 94 94 88 87 81 79 78 76 74 72 72 69 68 67 67 67 66 63 62 61 58 57 55 55 54 51 50 50 48 48 42 41 38 35 34 32 31 30 26 24 13 13 12 6 5 4 3 3",
"output": "13"
},
{
"input": "50 30\n100 98 96 94 91 89 88 81 81 81 81 81 76 73 72 71 70 69 66 64 61 59 59 56 52 50 49 48 43 39 36 35 34 34 31 29 27 26 24 22 16 16 15 14 14 14 9 7 4 3",
"output": "30"
},
{
"input": "2 1\n10 10",
"output": "2"
},
{
"input": "2 2\n10 10",
"output": "2"
},
{
"input": "2 2\n10 0",
"output": "1"
},
{
"input": "2 2\n10 1",
"output": "2"
},
{
"input": "2 1\n10 0",
"output": "1"
},
{
"input": "2 1\n10 2",
"output": "1"
},
{
"input": "50 13\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "50 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "50 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "10 1\n5 5 5 3 3 3 0 0 0 0",
"output": "3"
},
{
"input": "10 2\n5 5 5 3 3 3 0 0 0 0",
"output": "3"
},
{
"input": "10 3\n5 5 5 3 3 3 0 0 0 0",
"output": "3"
},
{
"input": "10 4\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 5\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 6\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 7\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 8\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 9\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
},
{
"input": "10 10\n5 5 5 3 3 3 0 0 0 0",
"output": "6"
}
] | 1,697,236,500 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | nk=str(input())
a=str(input())
k=nk[-1]
espa=0
compte = 0
for i in range (len(a)) :
if espa==int(k)-1 :
compar=a[i-1]
if a[i]==' ':
espa=espa+1
if espa<int(k) :
if a[i]=='0' :
compte = compte-1
else :
if espa>=int(k):
if a[i]==compar :
compte=compte+1
compte =compte +int(k)
if a[0]=='0' :
compte=0
if compte <0 :
compte =0
print(compte)
| Title: Next Round
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Contestant who earns a score equal to or greater than the *k*-th place finisher's score will advance to the next round, as long as the contestant earns a positive score..." — an excerpt from contest rules.
A total of *n* participants took part in the contest (*n*<=≥<=*k*), and you already know their scores. Calculate how many participants will advance to the next round.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50) separated by a single space.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100), where *a**i* is the score earned by the participant who got the *i*-th place. The given sequence is non-increasing (that is, for all *i* from 1 to *n*<=-<=1 the following condition is fulfilled: *a**i*<=≥<=*a**i*<=+<=1).
Output Specification:
Output the number of participants who advance to the next round.
Demo Input:
['8 5\n10 9 8 7 7 7 5 5\n', '4 2\n0 0 0 0\n']
Demo Output:
['6\n', '0\n']
Note:
In the first example the participant on the 5th place earned 7 points. As the participant on the 6th place also earned 7 points, there are 6 advancers.
In the second example nobody got a positive score. | ```python
nk=str(input())
a=str(input())
k=nk[-1]
espa=0
compte = 0
for i in range (len(a)) :
if espa==int(k)-1 :
compar=a[i-1]
if a[i]==' ':
espa=espa+1
if espa<int(k) :
if a[i]=='0' :
compte = compte-1
else :
if espa>=int(k):
if a[i]==compar :
compte=compte+1
compte =compte +int(k)
if a[0]=='0' :
compte=0
if compte <0 :
compte =0
print(compte)
``` | 0 | |
102 | B | Sum of Digits | PROGRAMMING | 1,000 | [
"implementation"
] | B. Sum of Digits | 2 | 265 | Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit? | The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes. | Print the number of times a number can be replaced by the sum of its digits until it only contains one digit. | [
"0\n",
"10\n",
"991\n"
] | [
"0\n",
"1\n",
"3\n"
] | In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit. | 1,000 | [
{
"input": "0",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "991",
"output": "3"
},
{
"input": "99",
"output": "2"
},
{
"input": "100",
"output": "1"
},
{
"input": "123456789",
"output": "2"
},
{
"input": "32",
"output": "1"
},
{
"input": "86",
"output": "2"
},
{
"input": "2",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "34",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "28",
"output": "2"
},
{
"input": "23",
"output": "1"
},
{
"input": "57",
"output": "2"
},
{
"input": "29",
"output": "2"
},
{
"input": "353869285",
"output": "3"
},
{
"input": "549548646",
"output": "2"
},
{
"input": "858893424",
"output": "2"
},
{
"input": "644818852",
"output": "3"
},
{
"input": "360322525",
"output": "3"
},
{
"input": "122937520",
"output": "2"
},
{
"input": "288403032",
"output": "2"
},
{
"input": "677257481",
"output": "3"
},
{
"input": "58059561",
"output": "3"
},
{
"input": "211288847",
"output": "2"
},
{
"input": "339900034079539584",
"output": "2"
},
{
"input": "784084029310269952",
"output": "3"
},
{
"input": "774730557264864000",
"output": "3"
},
{
"input": "478233807148352256",
"output": "3"
},
{
"input": "165646874056812544",
"output": "3"
},
{
"input": "477533739511673792",
"output": "3"
},
{
"input": "660119944377002240",
"output": "3"
},
{
"input": "448375218506078080",
"output": "3"
},
{
"input": "77213334785795616",
"output": "3"
},
{
"input": "165767221702271872",
"output": "3"
},
{
"input": "1",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561",
"output": "3"
},
{
"input": "9",
"output": "0"
}
] | 1,653,991,784 | 2,147,483,647 | Python 3 | OK | TESTS | 51 | 92 | 0 | s=input()
c=0
while len(s)>1:
s=str(sum(map(int,s)))
c+=1
print(c)
| Title: Sum of Digits
Time Limit: 2 seconds
Memory Limit: 265 megabytes
Problem Description:
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
Input Specification:
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Output Specification:
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
Demo Input:
['0\n', '10\n', '991\n']
Demo Output:
['0\n', '1\n', '3\n']
Note:
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit. | ```python
s=input()
c=0
while len(s)>1:
s=str(sum(map(int,s)))
c+=1
print(c)
``` | 3.977 |
96 | A | Football | PROGRAMMING | 900 | [
"implementation",
"strings"
] | A. Football | 2 | 256 | Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not. | The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field. | Print "YES" if the situation is dangerous. Otherwise, print "NO". | [
"001001\n",
"1000000001\n"
] | [
"NO\n",
"YES\n"
] | none | 500 | [
{
"input": "001001",
"output": "NO"
},
{
"input": "1000000001",
"output": "YES"
},
{
"input": "00100110111111101",
"output": "YES"
},
{
"input": "11110111111111111",
"output": "YES"
},
{
"input": "01",
"output": "NO"
},
{
"input": "10100101",
"output": "NO"
},
{
"input": "1010010100000000010",
"output": "YES"
},
{
"input": "101010101",
"output": "NO"
},
{
"input": "000000000100000000000110101100000",
"output": "YES"
},
{
"input": "100001000000110101100000",
"output": "NO"
},
{
"input": "100001000011010110000",
"output": "NO"
},
{
"input": "010",
"output": "NO"
},
{
"input": "10101011111111111111111111111100",
"output": "YES"
},
{
"input": "1001101100",
"output": "NO"
},
{
"input": "1001101010",
"output": "NO"
},
{
"input": "1111100111",
"output": "NO"
},
{
"input": "00110110001110001111",
"output": "NO"
},
{
"input": "11110001001111110001",
"output": "NO"
},
{
"input": "10001111001011111101",
"output": "NO"
},
{
"input": "10000010100000001000110001010100001001001010011",
"output": "YES"
},
{
"input": "01111011111010111100101100001011001010111110000010",
"output": "NO"
},
{
"input": "00100000100100101110011001011011101110110110010100",
"output": "NO"
},
{
"input": "10110100110001001011110101110010100010000000000100101010111110111110100011",
"output": "YES"
},
{
"input": "00011101010101111001011011001101101011111101000010100000111000011100101011",
"output": "NO"
},
{
"input": "01110000110100110101110100111000101101011101011110110100100111100001110111",
"output": "NO"
},
{
"input": "11110110011000100111100111101101011111110100010101011011111101110110110111",
"output": "YES"
},
{
"input": "100100010101110010001011001110100011100010011110100101100011010001001010001001101111001100",
"output": "NO"
},
{
"input": "111110010001011010010011111100110110001111000010100011011100111101111101110010101111011110000001010",
"output": "NO"
},
{
"input": "111110111100010100000100001010111011101011000111011011011010110010100010000101011111000011010011110",
"output": "NO"
},
{
"input": "1011110110111010110111111010010010100011111011110000011000110010011110111010110100011010100010111000",
"output": "NO"
},
{
"input": "0010100111100010110110000011100111110100111110001010000100111111111010111100101101010101001011010110",
"output": "YES"
},
{
"input": "1111010100010100101011101100101101110011000010100010000001111100010011100101010001101111000001011000",
"output": "NO"
},
{
"input": "0101100011001110001110100111100011010101011000000000110110010010111100101111010111100011101100100101",
"output": "YES"
},
{
"input": "0001101110011101110000000010011111101001101111100001001010110000110001100000010001111011011110001101",
"output": "YES"
},
{
"input": "1000010000100000100010000100001000010000100001000010000100001000010000100001000010000100001000010000",
"output": "NO"
},
{
"input": "1000000000100000000010000000001000000000100000000010000000001000000000100000000010000000001000000000",
"output": "YES"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "YES"
},
{
"input": "1111111111111111111111111111111111111111011111111111111111111111111111111111111111111111111111111111",
"output": "YES"
},
{
"input": "10100101000",
"output": "NO"
},
{
"input": "11110111011101",
"output": "NO"
},
{
"input": "10000000",
"output": "YES"
},
{
"input": "00000001",
"output": "YES"
},
{
"input": "01111111",
"output": "YES"
},
{
"input": "11111110",
"output": "YES"
}
] | 1,683,724,884 | 2,147,483,647 | Python 3 | OK | TESTS | 44 | 92 | 0 | s = input()
first = 0
second = 0
for i in s:
if i == '1':
first += 1
second = 0
else:
second += 1
first = 0
if first == 7 or second == 7:
print('YES')
break
else:
print('NO')
| Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves football very much. One day, as he was watching a football match, he was writing the players' current positions on a piece of paper. To simplify the situation he depicted it as a string consisting of zeroes and ones. A zero corresponds to players of one team; a one corresponds to players of another team. If there are at least 7 players of some team standing one after another, then the situation is considered dangerous. For example, the situation 00100110111111101 is dangerous and 11110111011101 is not. You are given the current situation. Determine whether it is dangerous or not.
Input Specification:
The first input line contains a non-empty string consisting of characters "0" and "1", which represents players. The length of the string does not exceed 100 characters. There's at least one player from each team present on the field.
Output Specification:
Print "YES" if the situation is dangerous. Otherwise, print "NO".
Demo Input:
['001001\n', '1000000001\n']
Demo Output:
['NO\n', 'YES\n']
Note:
none | ```python
s = input()
first = 0
second = 0
for i in s:
if i == '1':
first += 1
second = 0
else:
second += 1
first = 0
if first == 7 or second == 7:
print('YES')
break
else:
print('NO')
``` | 3.977 |
205 | A | Little Elephant and Rozdil | PROGRAMMING | 900 | [
"brute force",
"implementation"
] | null | null | The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities. | Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes). | [
"2\n7 4\n",
"7\n7 4 47 100 4 9 12\n"
] | [
"2\n",
"Still Rozdil\n"
] | In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil". | 500 | [
{
"input": "2\n7 4",
"output": "2"
},
{
"input": "7\n7 4 47 100 4 9 12",
"output": "Still Rozdil"
},
{
"input": "1\n47",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "Still Rozdil"
},
{
"input": "7\n7 6 5 4 3 2 1",
"output": "7"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "Still Rozdil"
},
{
"input": "4\n1000000000 100000000 1000000 1000000",
"output": "Still Rozdil"
},
{
"input": "20\n7 1 1 2 1 1 8 7 7 8 4 3 7 10 5 3 10 5 10 6",
"output": "Still Rozdil"
},
{
"input": "20\n3 3 6 9 8 2 4 1 7 3 2 9 7 7 9 7 2 6 2 7",
"output": "8"
},
{
"input": "47\n35 79 84 56 67 95 80 34 77 68 14 55 95 32 40 89 58 79 96 66 50 79 35 86 31 74 91 35 22 72 84 38 11 59 73 51 65 11 11 62 30 12 32 71 69 15 11",
"output": "Still Rozdil"
},
{
"input": "47\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "32"
},
{
"input": "25\n73 56 65 70 57 57 49 50 65 68 54 48 66 55 55 66 60 70 47 62 63 70 62 70 63",
"output": "19"
},
{
"input": "100\n922 938 103 689 526 118 314 496 373 47 224 544 495 656 804 754 269 356 354 536 817 597 787 178 516 659 790 993 786 169 866 779 997 350 674 437 219 546 564 893 402 449 751 628 238 686 392 951 716 439 332 563 215 146 746 311 866 773 548 675 731 183 890 802 488 944 473 25 662 559 732 534 777 144 502 593 839 692 84 337 679 718 1005 663 709 940 86 469 310 960 902 233 606 761 116 231 662 903 68 622",
"output": "68"
},
{
"input": "5\n5 5 2 3 1",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "3\n7 7 4",
"output": "3"
},
{
"input": "3\n2 2 1",
"output": "3"
},
{
"input": "3\n4 4 3",
"output": "3"
},
{
"input": "2\n10000001 10000002",
"output": "1"
},
{
"input": "4\n3 3 2 1",
"output": "4"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "2\n1000000000 100000000",
"output": "2"
},
{
"input": "1\n99999999",
"output": "1"
},
{
"input": "3\n5 5 3",
"output": "3"
},
{
"input": "3\n7 7 5",
"output": "3"
},
{
"input": "3\n3 3 1",
"output": "3"
},
{
"input": "4\n10 10 10 1",
"output": "4"
}
] | 1,579,158,738 | 2,147,483,647 | Python 3 | OK | TESTS | 45 | 248 | 8,704,000 | z=int(input())
x=list(map(int,input().split()))
print(['Still Rozdil','%d'%(x.index(min(x))+1)][x.count(min(x))==1])
| Title: Little Elephant and Rozdil
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves Ukraine very much. Most of all he loves town Rozdol (ukr. "Rozdil").
However, Rozdil is dangerous to settle, so the Little Elephant wants to go to some other town. The Little Elephant doesn't like to spend much time on travelling, so for his journey he will choose a town that needs minimum time to travel to. If there are multiple such cities, then the Little Elephant won't go anywhere.
For each town except for Rozdil you know the time needed to travel to this town. Find the town the Little Elephant will go to or print "Still Rozdil", if he stays in Rozdil.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the number of cities. The next line contains *n* integers, separated by single spaces: the *i*-th integer represents the time needed to go from town Rozdil to the *i*-th town. The time values are positive integers, not exceeding 109.
You can consider the cities numbered from 1 to *n*, inclusive. Rozdil is not among the numbered cities.
Output Specification:
Print the answer on a single line — the number of the town the Little Elephant will go to. If there are multiple cities with minimum travel time, print "Still Rozdil" (without the quotes).
Demo Input:
['2\n7 4\n', '7\n7 4 47 100 4 9 12\n']
Demo Output:
['2\n', 'Still Rozdil\n']
Note:
In the first sample there are only two cities where the Little Elephant can go. The travel time for the first town equals 7, to the second one — 4. The town which is closest to Rodzil (the only one) is the second one, so the answer is 2.
In the second sample the closest cities are cities two and five, the travelling time to both of them equals 4, so the answer is "Still Rozdil". | ```python
z=int(input())
x=list(map(int,input().split()))
print(['Still Rozdil','%d'%(x.index(min(x))+1)][x.count(min(x))==1])
``` | 3 | |
330 | A | Cakeminator | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat. | The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry. | Output the maximum number of cake cells that the cakeminator can eat. | [
"3 4\nS...\n....\n..S.\n"
] | [
"8\n"
] | For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | 500 | [
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,652,775,015 | 2,147,483,647 | Python 3 | OK | TESTS | 42 | 92 | 4,505,600 | n,m=map(int,input().split());a=[];b=[]
for i in range(n):
s=str(input())
a.append(list(map(str,s)))
p=0
for i in range(m):
b.append(list(map(str,('0'*n))))
for i in range(n):
if ('S' in a[i])==False:
p+=m
a[i]=list(map(str,('0'*m)))
for i in range(n):
for j in range(m):
b[j][i]=a[i][j]
for i in range(m):
if ('S' in b[i])==False:
p+=b[i].count('.')
print(p)
| Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats). | ```python
n,m=map(int,input().split());a=[];b=[]
for i in range(n):
s=str(input())
a.append(list(map(str,s)))
p=0
for i in range(m):
b.append(list(map(str,('0'*n))))
for i in range(n):
if ('S' in a[i])==False:
p+=m
a[i]=list(map(str,('0'*m)))
for i in range(n):
for j in range(m):
b[j][i]=a[i][j]
for i in range(m):
if ('S' in b[i])==False:
p+=b[i].count('.')
print(p)
``` | 3 | |
914 | C | Travelling Salesman and Special Numbers | PROGRAMMING | 1,800 | [
"brute force",
"combinatorics",
"dp"
] | null | null | The Travelling Salesman spends a lot of time travelling so he tends to get bored. To pass time, he likes to perform operations on numbers. One such operation is to take a positive integer *x* and reduce it to the number of bits set to 1 in the binary representation of *x*. For example for number 13 it's true that 1310<==<=11012, so it has 3 bits set and 13 will be reduced to 3 in one operation.
He calls a number special if the minimum number of operations to reduce it to 1 is *k*.
He wants to find out how many special numbers exist which are not greater than *n*. Please help the Travelling Salesman, as he is about to reach his destination!
Since the answer can be large, output it modulo 109<=+<=7. | The first line contains integer *n* (1<=≤<=*n*<=<<=21000).
The second line contains integer *k* (0<=≤<=*k*<=≤<=1000).
Note that *n* is given in its binary representation without any leading zeros. | Output a single integer — the number of special numbers not greater than *n*, modulo 109<=+<=7. | [
"110\n2\n",
"111111011\n2\n"
] | [
"3\n",
"169\n"
] | In the first sample, the three special numbers are 3, 5 and 6. They get reduced to 2 in one operation (since there are two set bits in each of 3, 5 and 6) and then to 1 in one more operation (since there is only one set bit in 2). | 1,500 | [
{
"input": "110\n2",
"output": "3"
},
{
"input": "111111011\n2",
"output": "169"
},
{
"input": "100011110011110110100\n7",
"output": "0"
},
{
"input": "110100110\n0",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000\n2",
"output": "79284496"
},
{
"input": "100000000000000000000100000000000010100100001001000010011101010\n3",
"output": "35190061"
},
{
"input": "101010110000\n3",
"output": "1563"
},
{
"input": "11010110000\n3",
"output": "1001"
},
{
"input": "100\n6",
"output": "0"
},
{
"input": "100100100100\n5",
"output": "0"
},
{
"input": "10000000000\n4",
"output": "120"
},
{
"input": "10\n868",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "10\n0",
"output": "1"
},
{
"input": "101110011101100100010010101001010111001\n8",
"output": "0"
},
{
"input": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111\n10",
"output": "0"
},
{
"input": "10000000000000000000000000000\n1",
"output": "28"
},
{
"input": "111111111111111111111111111111111111\n2",
"output": "338250841"
},
{
"input": "10010110001111110001100000110111010011010110100111100010001011000011000011000100011010000000000110110010111111\n2",
"output": "678359035"
},
{
"input": "11111100010011110101100110100010001011100111001011001111101111110111001111011011110101100101001000111001000100000011011110110010001000111101001101001010100011\n1",
"output": "157"
},
{
"input": "10011101000010110111001\n1",
"output": "22"
},
{
"input": "10000110011100011111100010011010111110111110100011110101110010000001111100110000001000101011001000111110111100110111010011011100000000111101001010110\n1",
"output": "148"
},
{
"input": "11101011101101101111101100001101110010011011101101010101101111100011101111010111011\n1",
"output": "82"
},
{
"input": "11101111100100100110010100010100101111\n4",
"output": "839492816"
},
{
"input": "111111000110010101000000101001111000101100000110100101111000001011001011110111000000000010\n0",
"output": "1"
},
{
"input": "10000001011010001011101011100010110001010110111100110001010011111111010110101100100010101111\n1",
"output": "91"
},
{
"input": "100111000100101100\n4",
"output": "42232"
},
{
"input": "11001101101010100\n3",
"output": "55119"
},
{
"input": "10000010100111000111001111011001\n1",
"output": "31"
},
{
"input": "110001010001001\n0",
"output": "1"
},
{
"input": "10000010111110110111000001011111111010111101000101001000100111101011001101001111111011110111101100001101100011011111010010001001010100011000111100110101100001100001011111000111001010010010110000111110011111010111001001000111010111111100101101010111100010010111001001111010100110011001111111100000101000100011001011100011000101010100000001100110011011001110101100000111001111011\n732",
"output": "0"
},
{
"input": "111001100100110011100111101100010000111100111\n37",
"output": "0"
},
{
"input": "110101100110100001001011010001011001100100000111000000111100000001010000010001111101000101110001001000110001110001100100100000110101000110111000011010101010011011011000110101110010010111110101101110000010000101101010100101010011010001010010101110001010000001010001111000110100101010001011001110110010\n481",
"output": "0"
},
{
"input": "101011000000101110010001011010000110010100001011101110110000000001001000101011100100110111100110100010010001010111001010110011001011110111100100110000000001000100101101101101010101011100101001010000001111110011101000111111110001000101110000000011111101001100101101100111000000101111011110110001110001001110010001011010000001100001010010000100011001111100000100010000000101011100001010011100110001100111111011011100101101011110110000101000001110010001111100110101010\n129",
"output": "0"
},
{
"input": "1010010001000110110001010110101110100110101100011111101000001001001000001100000000011\n296",
"output": "0"
},
{
"input": "1100001110101110010111011111000111011011100011001000010111000010010011000111111011000100110010100111000000001110101001000110010000111000001001000111011010001001000010001111000111101001100101110000001111110001110111011101011000011010010101001111101101100011101010010110\n6",
"output": "0"
},
{
"input": "101010111001011101010100110100001111010111011000101000100100100111101101101000001110111110011100001110010010010000110101011101011111111011110000001011011101101111001011000111001100000110100100110\n7",
"output": "0"
},
{
"input": "11100001100000001101001111111101000000111010000001001000111101000100100111101100100011100111101100010110000010100100101001101001101001111101101000101010111111110001011000010011011011101010110110011010111011111000100001010110000010000101011001110011011001010001000010000110010110101100010101001111101101111100010010011000000100001000111010011011101000100111001110000000001110000010110000100010110100110011010110000100111110001100001011101\n3",
"output": "591387665"
},
{
"input": "10001011100010111001100001010011011011001100111000000010110010000000010000000011011110011110111110110011000000011110010011110001110110100010111010100111111000000100011011111011111111010000000001110000100100010100111001001000011010010010010001011110010101001001000101110011110000110010011110111011000010110110110101110011100011111001111001111110001011111110111111111010100111101101011000101000100001101001101010101111011001100000110011000\n1",
"output": "436"
},
{
"input": "10101010100111001111011010\n1",
"output": "25"
},
{
"input": "1110100100000010010000001111\n7",
"output": "0"
},
{
"input": "10011000111011110111100110111100011000100111110\n7",
"output": "0"
},
{
"input": "110110000010000001110101000000110010101110000011110101001111000111001111100110001001100011011\n5",
"output": "0"
},
{
"input": "11000011000010000011010011001000100010\n5",
"output": "0"
},
{
"input": "1011100011101000001101111111101111011101000110110001111001010111110111101110101011111110\n7",
"output": "0"
},
{
"input": "100110100010110011010110011101110001010000110011001100011000101000010110111000\n3",
"output": "637252489"
},
{
"input": "11110110000010111011111100010000001010001110110000101001\n6",
"output": "0"
},
{
"input": "100000001100101011100111100101001101110\n3",
"output": "186506375"
},
{
"input": "10011001111000101010111100111010110110000100101001011101011100000010011111100011101\n1",
"output": "82"
},
{
"input": "1111101000100110001010001001\n3",
"output": "122853842"
},
{
"input": "11010101010101001100101110100001001100111001111100100000001100100010010001010001001100001000111010010101101001100101100000000101001011010011000010100011101010111111100010101011111001110000010000111001101101001100010011101000110101110110001101\n4",
"output": "571603984"
},
{
"input": "100001111010010111101010000100000010011000001100101001000110010010001101001101101001001110000101101010011000011101000101111011001101001111011111000000001100100100011011111010000010011111010011001011111010100100001011010011011001010111011111110111100001001101001001101110101101111000110011011100001011011111001110001000110001100110101100001010000001001100000001101010111110001010011101001111010111\n3",
"output": "329948438"
},
{
"input": "1111110000010010100110001010001000111100001101110100100011101110000011001100010\n3",
"output": "774501673"
},
{
"input": "101100101001110000011101\n3",
"output": "5671856"
},
{
"input": "1011\n3",
"output": "2"
},
{
"input": "100010100\n3",
"output": "150"
},
{
"input": "110110010000000011010010100011111001111101110011100100100110001111100001\n3",
"output": "134209222"
},
{
"input": "11101000011\n3",
"output": "1074"
},
{
"input": "1000000101100011101000101010110111101010111100110\n4",
"output": "325122368"
},
{
"input": "1101\n3",
"output": "3"
},
{
"input": "101100100\n2",
"output": "139"
},
{
"input": "11011011111000010101010100000100110101\n4",
"output": "363038940"
},
{
"input": "10010110100010001010000000110100001000010000\n4",
"output": "399815120"
},
{
"input": "101101000001111101010001110\n4",
"output": "41258563"
},
{
"input": "1100000110100011100011110000010001110111\n4",
"output": "615102266"
},
{
"input": "10011100101110000100000011001000\n4",
"output": "937000434"
},
{
"input": "1110111100101001000100\n4",
"output": "1562803"
},
{
"input": "101110100101001000\n2",
"output": "38552"
},
{
"input": "11110110001110101001101110011011010010010101011000\n3",
"output": "895709102"
},
{
"input": "111001001001101111000\n4",
"output": "680132"
},
{
"input": "111101001101101110110010100010000101011100111\n4",
"output": "632815766"
},
{
"input": "1010100110101101101100001001101001100\n3",
"output": "555759044"
},
{
"input": "1011010011010010111111000011111100001001101010100011011110101\n3",
"output": "760546372"
},
{
"input": "101110010111100010011010001001001111001\n3",
"output": "557969925"
},
{
"input": "11010011111101111111010011011101101111010001001001100000111\n3",
"output": "389792479"
},
{
"input": "1011110111001010110001100011010000011111000100000000011000000101010101010000\n4",
"output": "184972385"
},
{
"input": "1111101000110001110011101001001101000000001000010001110000100111100110100101001100110111010010110000100100011001000110110000010010000101000010101011110101001000101000001101000101011100000101011100101011011001110011111000001011111111011100110010100111010010101000010010001001010101010101001110001001011111101111001101011111110010011001011110001100100011101010110010001110101111110010011111111111\n4",
"output": "678711158"
},
{
"input": "10111010100111101011010100001101000111000001111101000101101001100101011000100110100010100101001011110101111001111011000011010000010100110000100110110011001110001001001010110001011111000100010010010111100010110001011010101101010000101110011011100001100101011110110101100010111011111001011110110111110100101100111001000101100111001100001\n3",
"output": "187155647"
},
{
"input": "10100001110001001101000111010111011011101010111100000101001101001010000100000011110110111\n4",
"output": "108160984"
},
{
"input": "1110011001101101000011001110011111100011101100100000010100111010111001110011100111011111100100111001010101000001001010010010110010100100000011111000000001111010110011000010000100101011000101110100100001101111011110011001000111111010100001010001111100000100100101000001011111011110010111010100111001101000001000111000110100000000010101110000011010010011001000111001111101\n3",
"output": "652221861"
},
{
"input": "100110011001000111111110001010011001110100111010010101100110000110011010111010011110101110011101111000001101010111010101111110100100111010010010101000111011111000010101\n3",
"output": "72690238"
},
{
"input": "111000000101110011000110000\n3",
"output": "54271713"
},
{
"input": "1001000100000\n2",
"output": "1196"
},
{
"input": "10110100000101000110011000010\n3",
"output": "177315776"
},
{
"input": "111000010010111110010111011111001011011011011000110\n4",
"output": "131135624"
},
{
"input": "11001101101100010101011111100111001011010011\n4",
"output": "249690295"
},
{
"input": "101111101000011110011\n3",
"output": "818095"
},
{
"input": "11\n1",
"output": "1"
},
{
"input": "1101000100001110101110101011000100100111111110000011010101100111010\n3",
"output": "748765378"
},
{
"input": "1101011100011011000110101100111010011101001000100011111011011\n3",
"output": "541620851"
},
{
"input": "111000110101110110000001011000000011111011100000000101000011111100101000110101111111001110011100010101011010000001011110101100100101001101110101011101111000\n3",
"output": "154788917"
},
{
"input": "10000010000001111111011111010000101101101101010000100101000101011001011101111100001111001000100010111011101110111011000001110011111001100101101100000001011110010111101010001100111011110110111100100001110100100011101011011000010110010110101010100100000101001110101100110110100111110110100011111100010000011110000101010111111001001101101111\n4",
"output": "46847153"
},
{
"input": "1001100001011111100011111010001111001000000000110101100100011000111101111011010111110001001001111110011100100111011111011110101101001011111100101011000110100110011001101111001011101110011111101011100001011010100000100111011011\n4",
"output": "449157617"
},
{
"input": "1111110011110000001101111011001110111100001101111111110011101110111001001000011101100101001000000001110001010001101111001000010111110100110010001001110111100111000010111100011101001010010001111001100011100100111001101100010100111001000101100010100100101011010000011011010100101111011111101100001100010111111011111010\n3",
"output": "20014881"
},
{
"input": "11011101110100111111011101110111001101001001000111010010011100010100000101010011111101011000000110000110111101001111010101111110111011000011101111001101101100101110101010111011100010110111110001001011111110011110000011000111011010111100011000011011001101111100001101000010100011100000\n4",
"output": "545014668"
},
{
"input": "110100011111110101001011010110011010000010001111111011010011111100101000111000010000000001000010100101011001110101011100111111100101111011000011100100111100100100001101100000011010111110000101110110001100110011000111001101001101011101111101111111011000101010100111100101010111110011011111001100011011101110010100001110100010111\n4",
"output": "228787489"
},
{
"input": "111111011010010110111111\n4",
"output": "7297383"
},
{
"input": "111100111101110100010001110010001001001101110011011011011001110000000111111100100011001011100010001011100101100011010101100000101010000001110111100000111110100010011001111011101010001111011110111100100100101111100000010100110110101000111100001001000011110111101101001110010011111001011011110111111110110110010111101011001100010011100010001101001010100000100101001110111010011011101000011001101000011010110100111011101011001001001001110100000100111011011101010001\n3",
"output": "703566590"
},
{
"input": "111000100110111000010100000010001000001011100000000011101010101100010001010111101011110101000101110100000110110010001010101001000101000010010101101000000001110111100101111101010011100011000001101101101011101111100100011011111111101000101011101111101111111101000111101101101100000001000001111111011100110011000010100111011100000000111100001000111100000011110100011100101001001101110011101110111001010011100011111010010000001011001001010111100011111110010011000100101110\n4",
"output": "518347346"
},
{
"input": "11110011010101111001001000010111000101000100000010010001010110011100011100110110011011011111000101111100011101101010001011010000110000101111100011110101010011110001110001011001010000110111001101111101000000110010101110001100010000000101001001001000000010010100000110000010000111100110110001000110011011100\n1000",
"output": "0"
},
{
"input": "10011010111010010111111110001010001010001010110010110010010111101111000101110101010111100101001100011001001001111011111100011110101011011001101101001111111101010010110011111101110010001000111111100011000000111111111100011000000000110101111000001011101000110000111110110000010000010011000011011110101111111101100101000100000100010001010000110100111010110011000010001101011101101001010111101101110000101010111001011001100101000010110011110110011011001111110100011010010110011101011001111101\n208",
"output": "0"
},
{
"input": "1100101001110100100010011111001011101100101\n1000",
"output": "0"
},
{
"input": "10\n1",
"output": "1"
},
{
"input": "111\n1",
"output": "2"
},
{
"input": "11100001111100111110011100111100110111100111001101\n1",
"output": "49"
},
{
"input": "1000000000000000000001010100101\n1",
"output": "30"
},
{
"input": "110\n1",
"output": "2"
},
{
"input": "11011100\n1",
"output": "7"
},
{
"input": "10000000000000000000\n1",
"output": "19"
},
{
"input": "1111111011111110111\n1",
"output": "18"
},
{
"input": "1000\n1",
"output": "3"
},
{
"input": "100\n1",
"output": "2"
}
] | 1,557,902,661 | 2,147,483,647 | PyPy 3 | OK | TESTS | 141 | 171 | 6,041,600 | R = lambda: map(int, input().split())
mod = 10 ** 9 + 7
maxn = 1001
c = [[0 for j in range(maxn)] for i in range(maxn)]
for i in range(maxn):
c[i][0] = 1
for i in range(1, maxn):
for j in range(i + 1):
c[i][j] = (c[i - 1][j] + c[i - 1][j - 1]) % mod
arr = list(map(int, input()))
k = int(input())
if k == 0:
print(1 if arr.count(1) else 0)
exit(0)
ops = [0] * (maxn + 1)
ans = 0
for i in range(2, maxn):
cnt = bin(i).count('1')
ops[i] = ops[cnt] + 1
for i in range(1, maxn):
if ops[i] == k - 1:
oc = i
for j, x in enumerate(arr):
if x and oc >= 0:
ans = (ans + c[len(arr) - j - 1][oc]) % mod
oc -= 1
ans = (ans + 1) % mod if arr.count(1) == i else ans
if k == 1:
ans = (ans + mod - 1) % mod
print(ans) | Title: Travelling Salesman and Special Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Travelling Salesman spends a lot of time travelling so he tends to get bored. To pass time, he likes to perform operations on numbers. One such operation is to take a positive integer *x* and reduce it to the number of bits set to 1 in the binary representation of *x*. For example for number 13 it's true that 1310<==<=11012, so it has 3 bits set and 13 will be reduced to 3 in one operation.
He calls a number special if the minimum number of operations to reduce it to 1 is *k*.
He wants to find out how many special numbers exist which are not greater than *n*. Please help the Travelling Salesman, as he is about to reach his destination!
Since the answer can be large, output it modulo 109<=+<=7.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=<<=21000).
The second line contains integer *k* (0<=≤<=*k*<=≤<=1000).
Note that *n* is given in its binary representation without any leading zeros.
Output Specification:
Output a single integer — the number of special numbers not greater than *n*, modulo 109<=+<=7.
Demo Input:
['110\n2\n', '111111011\n2\n']
Demo Output:
['3\n', '169\n']
Note:
In the first sample, the three special numbers are 3, 5 and 6. They get reduced to 2 in one operation (since there are two set bits in each of 3, 5 and 6) and then to 1 in one more operation (since there is only one set bit in 2). | ```python
R = lambda: map(int, input().split())
mod = 10 ** 9 + 7
maxn = 1001
c = [[0 for j in range(maxn)] for i in range(maxn)]
for i in range(maxn):
c[i][0] = 1
for i in range(1, maxn):
for j in range(i + 1):
c[i][j] = (c[i - 1][j] + c[i - 1][j - 1]) % mod
arr = list(map(int, input()))
k = int(input())
if k == 0:
print(1 if arr.count(1) else 0)
exit(0)
ops = [0] * (maxn + 1)
ans = 0
for i in range(2, maxn):
cnt = bin(i).count('1')
ops[i] = ops[cnt] + 1
for i in range(1, maxn):
if ops[i] == k - 1:
oc = i
for j, x in enumerate(arr):
if x and oc >= 0:
ans = (ans + c[len(arr) - j - 1][oc]) % mod
oc -= 1
ans = (ans + 1) % mod if arr.count(1) == i else ans
if k == 1:
ans = (ans + mod - 1) % mod
print(ans)
``` | 3 | |
828 | B | Black Square | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | Polycarp has a checkered sheet of paper of size *n*<=×<=*m*. Polycarp painted some of cells with black, the others remained white. Inspired by Malevich's "Black Square", Polycarp wants to paint minimum possible number of white cells with black so that all black cells form a square.
You are to determine the minimum possible number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. The square's side should have positive length. | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the sizes of the sheet.
The next *n* lines contain *m* letters 'B' or 'W' each — the description of initial cells' colors. If a letter is 'B', then the corresponding cell is painted black, otherwise it is painted white. | Print the minimum number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. If it is impossible, print -1. | [
"5 4\nWWWW\nWWWB\nWWWB\nWWBB\nWWWW\n",
"1 2\nBB\n",
"3 3\nWWW\nWWW\nWWW\n"
] | [
"5\n",
"-1\n",
"1\n"
] | In the first example it is needed to paint 5 cells — (2, 2), (2, 3), (3, 2), (3, 3) and (4, 2). Then there will be a square with side equal to three, and the upper left corner in (2, 2).
In the second example all the cells are painted black and form a rectangle, so it's impossible to get a square.
In the third example all cells are colored white, so it's sufficient to color any cell black. | 750 | [
{
"input": "5 4\nWWWW\nWWWB\nWWWB\nWWBB\nWWWW",
"output": "5"
},
{
"input": "1 2\nBB",
"output": "-1"
},
{
"input": "3 3\nWWW\nWWW\nWWW",
"output": "1"
},
{
"input": "100 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB",
"output": "-1"
},
{
"input": "1 1\nW",
"output": "1"
},
{
"input": "2 4\nWWWW\nWBWW",
"output": "0"
},
{
"input": "4 5\nWWWWW\nBBWWW\nBBWWW\nWWWWW",
"output": "0"
},
{
"input": "5 4\nWWWW\nWWWW\nWWWB\nWWWW\nWWWW",
"output": "0"
},
{
"input": "10 5\nWWWWB\nWWWWW\nWWWBB\nWWBWW\nWWWWW\nWWWWW\nWWWWW\nWWWWW\nWWWWW\nWWWWW",
"output": "12"
},
{
"input": "5 10\nWWWWWWWWWW\nWWWWBWBBWW\nWWWWWWWWWW\nWWWWBWWWWW\nWWWWWWBWWW",
"output": "11"
},
{
"input": "20 10\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWBBWBWWWW\nWWBWWBWWWW\nWWWWBWWWWW\nWWWWBWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW",
"output": "9"
},
{
"input": "10 20\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWWWWWWBW\nWWWWWWWWWWWWWWWWWBWW\nWWWWWWWWWWWWWWWWWWWW",
"output": "2"
},
{
"input": "1 1\nW",
"output": "1"
},
{
"input": "1 1\nB",
"output": "0"
},
{
"input": "2 2\nWW\nWW",
"output": "1"
},
{
"input": "2 2\nWW\nWB",
"output": "0"
},
{
"input": "2 2\nWW\nBW",
"output": "0"
},
{
"input": "2 2\nWW\nBB",
"output": "2"
},
{
"input": "2 2\nWB\nWW",
"output": "0"
},
{
"input": "2 2\nWB\nWB",
"output": "2"
},
{
"input": "2 2\nWB\nBW",
"output": "2"
},
{
"input": "2 2\nWB\nBB",
"output": "1"
},
{
"input": "2 2\nBW\nWW",
"output": "0"
},
{
"input": "2 2\nBW\nWB",
"output": "2"
},
{
"input": "2 2\nBW\nBW",
"output": "2"
},
{
"input": "2 2\nBW\nBB",
"output": "1"
},
{
"input": "2 2\nBB\nWW",
"output": "2"
},
{
"input": "2 2\nBB\nWB",
"output": "1"
},
{
"input": "2 2\nBB\nBW",
"output": "1"
},
{
"input": "2 2\nBB\nBB",
"output": "0"
},
{
"input": "1 2\nWW",
"output": "1"
},
{
"input": "1 2\nWB",
"output": "0"
},
{
"input": "1 2\nBW",
"output": "0"
},
{
"input": "2 1\nW\nW",
"output": "1"
},
{
"input": "2 1\nW\nB",
"output": "0"
},
{
"input": "2 1\nB\nW",
"output": "0"
},
{
"input": "2 1\nB\nB",
"output": "-1"
},
{
"input": "20 10\nWWBWWWBBWW\nWWWWWBWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWBBBWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWWWWWWWWWW\nWBWWWWWBWW\nWBWWBWWWBW\nWWBWBWWWWW\nWWWBWWBBWW\nWWBBWBWBWW\nBBWWWWWBWW\nWWBWWBBBWW\nWWWBWBBWWW\nWWWBBWBWWW\nWWWWWWWWWW\nWWWBWWWWWW\nWWWWWWWWWW",
"output": "-1"
},
{
"input": "10 20\nWWWWWWWBWWWWWWWBWWWB\nWWWBWWWBWWWWWWWWWWWW\nBWWWWWWWWWWWWWWWWWBB\nWWWWWWBWWBWWBWWWBWWW\nWWWWWWWWBWWBWWWBWWWW\nWBWWWWWWWBWWWWWWWWWW\nWWWBWBWWBWWWWWBBWWWB\nWWBBWWWWWWWWWWWWWWWW\nWWWWWWWWWWWWWBWWWWBW\nWWWWWWWWWWWWBWWBWWWB",
"output": "-1"
},
{
"input": "1 100\nBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "1 100\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWB",
"output": "0"
},
{
"input": "1 100\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "0"
},
{
"input": "1 100\nBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW",
"output": "-1"
},
{
"input": "1 100\nWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWBWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWB",
"output": "-1"
},
{
"input": "100 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB",
"output": "0"
},
{
"input": "100 1\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW",
"output": "0"
},
{
"input": "100 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW",
"output": "0"
},
{
"input": "100 1\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW",
"output": "-1"
},
{
"input": "1 5\nWBBWW",
"output": "-1"
},
{
"input": "20 1\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nW\nB\nB\nB",
"output": "-1"
},
{
"input": "3 3\nWBW\nWBB\nWWW",
"output": "1"
},
{
"input": "4 6\nWWWWWW\nWWWBWW\nWWWWWB\nWWWWWW",
"output": "7"
},
{
"input": "5 5\nWBWBW\nWWWWW\nWWWWW\nWWWWW\nWWWWW",
"output": "7"
},
{
"input": "3 3\nBBB\nBBB\nBBB",
"output": "0"
},
{
"input": "5 5\nWWBWW\nWWWWW\nWWWWW\nWWWWW\nWWBWW",
"output": "23"
},
{
"input": "5 4\nWWBW\nBWWB\nWWWW\nWWWW\nWWWW",
"output": "13"
},
{
"input": "5 4\nWWWW\nWWWB\nWWWB\nWWWW\nWBBW",
"output": "12"
},
{
"input": "6 6\nWWBWWW\nWWWWWW\nWWWWWW\nWWWWWW\nWWWWWW\nWWWBWW",
"output": "34"
},
{
"input": "3 3\nBBW\nWWW\nBWW",
"output": "6"
},
{
"input": "3 3\nBWB\nWWW\nBWW",
"output": "6"
},
{
"input": "6 6\nWBWWWW\nBWWWBW\nWWWWWW\nWWBWWW\nWWWWWW\nWWWWWW",
"output": "21"
},
{
"input": "3 3\nWWW\nWBW\nWWW",
"output": "0"
},
{
"input": "3 3\nBBB\nWWW\nWWW",
"output": "6"
},
{
"input": "5 5\nWWBWW\nWWBWW\nWBBBW\nWWBWW\nWWBWW",
"output": "18"
},
{
"input": "5 2\nWB\nWB\nWB\nWW\nWW",
"output": "-1"
},
{
"input": "4 7\nBBBBBWW\nWWWWWWW\nWWWWWWW\nWWWWWWW",
"output": "-1"
},
{
"input": "5 4\nWWWW\nWWWB\nWWWW\nWWBB\nWWWW",
"output": "6"
},
{
"input": "4 4\nWWWW\nWBWW\nWWWW\nWWWW",
"output": "0"
},
{
"input": "2 5\nWWWWW\nBBBWW",
"output": "-1"
},
{
"input": "6 6\nWWBWWW\nWWWWWW\nWWWWBW\nWWWWWW\nWWWWWW\nWWBWWW",
"output": "33"
},
{
"input": "3 3\nWBW\nWBW\nWBW",
"output": "6"
},
{
"input": "3 5\nWWBBB\nBWBBB\nWWBBB",
"output": "-1"
},
{
"input": "5 5\nWWWWB\nBWWWW\nWWWWB\nWWWWW\nWWWWW",
"output": "22"
},
{
"input": "5 5\nBWWWB\nWWWWW\nWWWWW\nWWWWW\nBWWWW",
"output": "22"
},
{
"input": "4 5\nWWWWW\nBWWWW\nBBBWW\nWWWWW",
"output": "5"
},
{
"input": "4 4\nBBBB\nWWWW\nWWWW\nWWWW",
"output": "12"
},
{
"input": "4 6\nWWWWWW\nBWWWWW\nBWWWWW\nBBBBBB",
"output": "-1"
},
{
"input": "3 6\nWWWWWW\nBBBWWW\nWWWWWW",
"output": "6"
},
{
"input": "5 2\nWW\nBW\nBW\nBB\nWW",
"output": "-1"
},
{
"input": "5 5\nWWWWW\nWWWWW\nBBBBB\nWWWWW\nWWWWW",
"output": "20"
},
{
"input": "5 5\nWWWWW\nWWWWW\nWWWWB\nWBWWW\nWWWWW",
"output": "14"
},
{
"input": "1 5\nWWBWW",
"output": "0"
},
{
"input": "1 3\nBBB",
"output": "-1"
},
{
"input": "2 4\nWWBW\nBWBW",
"output": "-1"
},
{
"input": "6 6\nBBBBBB\nWWWWWW\nWWWWWW\nWWWWWW\nWWWWWW\nWWWWWW",
"output": "30"
},
{
"input": "4 4\nWWWW\nWWWW\nWWWW\nWWWW",
"output": "1"
},
{
"input": "3 3\nWWW\nWWW\nWWB",
"output": "0"
},
{
"input": "5 1\nB\nB\nW\nW\nW",
"output": "-1"
},
{
"input": "2 3\nWBW\nWBW",
"output": "2"
},
{
"input": "5 2\nWW\nWB\nWB\nWB\nWW",
"output": "-1"
},
{
"input": "5 5\nWWWWW\nBWWWW\nWWWWB\nWWWWW\nWWWWW",
"output": "23"
}
] | 1,540,045,366 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 21 | 124 | 0 | n,m = map(int,input().split())
a = []; c = []; d = []
for i in range(n):
b = list(input())
if "B" in b:
c.append(b.count("B"))
d.append(i)
a.append(b)
if d == [] or c == []: print(1)
elif abs(d[0]-d[-1])>m or max(c)>n: print(-1)
else:
k = 0
q = max(max(c),(d[-1]-d[0]+1))
for i in range(d[0],d[-1]+1):
k += q -a[i].count("B")
print(k) | Title: Black Square
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has a checkered sheet of paper of size *n*<=×<=*m*. Polycarp painted some of cells with black, the others remained white. Inspired by Malevich's "Black Square", Polycarp wants to paint minimum possible number of white cells with black so that all black cells form a square.
You are to determine the minimum possible number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. The square's side should have positive length.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the sizes of the sheet.
The next *n* lines contain *m* letters 'B' or 'W' each — the description of initial cells' colors. If a letter is 'B', then the corresponding cell is painted black, otherwise it is painted white.
Output Specification:
Print the minimum number of cells needed to be painted black so that the black cells form a black square with sides parallel to the painting's sides. All the cells that do not belong to the square should be white. If it is impossible, print -1.
Demo Input:
['5 4\nWWWW\nWWWB\nWWWB\nWWBB\nWWWW\n', '1 2\nBB\n', '3 3\nWWW\nWWW\nWWW\n']
Demo Output:
['5\n', '-1\n', '1\n']
Note:
In the first example it is needed to paint 5 cells — (2, 2), (2, 3), (3, 2), (3, 3) and (4, 2). Then there will be a square with side equal to three, and the upper left corner in (2, 2).
In the second example all the cells are painted black and form a rectangle, so it's impossible to get a square.
In the third example all cells are colored white, so it's sufficient to color any cell black. | ```python
n,m = map(int,input().split())
a = []; c = []; d = []
for i in range(n):
b = list(input())
if "B" in b:
c.append(b.count("B"))
d.append(i)
a.append(b)
if d == [] or c == []: print(1)
elif abs(d[0]-d[-1])>m or max(c)>n: print(-1)
else:
k = 0
q = max(max(c),(d[-1]-d[0]+1))
for i in range(d[0],d[-1]+1):
k += q -a[i].count("B")
print(k)
``` | 0 | |
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,696,075,297 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 92 | 0 | #!/usr/bin/env python
# coding: utf-8
# In[8]:
n, k = map(int, input().split())
out = int((n*k)/2)
print(out)
# In[ ]:
| Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
#!/usr/bin/env python
# coding: utf-8
# In[8]:
n, k = map(int, input().split())
out = int((n*k)/2)
print(out)
# In[ ]:
``` | 3.977 |
475 | B | Strongly Connected City | PROGRAMMING | 1,400 | [
"brute force",
"dfs and similar",
"graphs",
"implementation"
] | null | null | Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection.
The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern. | The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets.
The second line contains a string of length *n*, made of characters '<' and '>', denoting direction of each horizontal street. If the *i*-th character is equal to '<', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south.
The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east. | If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO". | [
"3 3\n><>\nv^v\n",
"4 6\n<><>\nv^v^v^\n"
] | [
"NO\n",
"YES\n"
] | The figure above shows street directions in the second sample test case. | 1,000 | [
{
"input": "3 3\n><>\nv^v",
"output": "NO"
},
{
"input": "4 6\n<><>\nv^v^v^",
"output": "YES"
},
{
"input": "2 2\n<>\nv^",
"output": "YES"
},
{
"input": "2 2\n>>\n^v",
"output": "NO"
},
{
"input": "3 3\n>><\n^^v",
"output": "YES"
},
{
"input": "3 4\n>><\n^v^v",
"output": "YES"
},
{
"input": "3 8\n>><\nv^^^^^^^",
"output": "NO"
},
{
"input": "7 2\n<><<<<>\n^^",
"output": "NO"
},
{
"input": "4 5\n><<<\n^^^^v",
"output": "YES"
},
{
"input": "2 20\n><\n^v^^v^^v^^^v^vv^vv^^",
"output": "NO"
},
{
"input": "2 20\n<>\nv^vv^v^^vvv^^^v^vvv^",
"output": "YES"
},
{
"input": "20 2\n<><<><<>><<<>><><<<<\n^^",
"output": "NO"
},
{
"input": "20 2\n><>><>><>><<<><<><><\n^v",
"output": "YES"
},
{
"input": "11 12\n><<<><><<>>\nvv^^^^vvvvv^",
"output": "NO"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "16 11\n<<<<>><><<<<<><<\nvv^v^vvvv^v",
"output": "NO"
},
{
"input": "14 7\n><<<<>>>>>>><<\nvv^^^vv",
"output": "NO"
},
{
"input": "5 14\n<<><>\nv^vv^^vv^v^^^v",
"output": "NO"
},
{
"input": "8 18\n>>>><>>>\nv^vv^v^^^^^vvv^^vv",
"output": "NO"
},
{
"input": "18 18\n<<><>><<>><>><><<<\n^^v^v^vvvv^v^vv^vv",
"output": "NO"
},
{
"input": "4 18\n<<<>\n^^^^^vv^vv^^vv^v^v",
"output": "NO"
},
{
"input": "19 18\n><><>>><<<<<>>><<<>\n^^v^^v^^v^vv^v^vvv",
"output": "NO"
},
{
"input": "14 20\n<<<><><<>><><<\nvvvvvvv^v^vvvv^^^vv^",
"output": "NO"
},
{
"input": "18 18\n><>>><<<>><><>>>><\nvv^^^^v^v^^^^v^v^^",
"output": "NO"
},
{
"input": "8 18\n<><<<>>>\n^^^^^^v^^^vv^^vvvv",
"output": "NO"
},
{
"input": "11 12\n><><><<><><\n^^v^^^^^^^^v",
"output": "YES"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "16 11\n>><<><<<<>>><><<\n^^^^vvvv^vv",
"output": "YES"
},
{
"input": "14 7\n<><><<<>>>><>>\nvv^^v^^",
"output": "YES"
},
{
"input": "5 14\n>>>><\n^v^v^^^vv^vv^v",
"output": "YES"
},
{
"input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^",
"output": "YES"
},
{
"input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v",
"output": "YES"
},
{
"input": "4 18\n<<>>\nv^v^v^^vvvv^v^^vv^",
"output": "YES"
},
{
"input": "19 18\n>>>><><<>>><<<><<<<\n^v^^^^vv^^v^^^^v^v",
"output": "YES"
},
{
"input": "14 20\n<>><<<><<>>>>>\nvv^^v^^^^v^^vv^^vvv^",
"output": "YES"
},
{
"input": "18 18\n><><<><><>>><>>>><\n^^vvv^v^^^v^vv^^^v",
"output": "YES"
},
{
"input": "8 18\n<<<><>>>\nv^^vvv^^v^v^vvvv^^",
"output": "YES"
},
{
"input": "20 19\n<><>>>>><<<<<><<>>>>\nv^vv^^vvvvvv^vvvv^v",
"output": "NO"
},
{
"input": "20 19\n<<<><<<>><<<>><><><>\nv^v^vvv^vvv^^^vvv^^",
"output": "YES"
},
{
"input": "19 20\n<><<<><><><<<<<<<<>\n^v^^^^v^^vvvv^^^^vvv",
"output": "NO"
},
{
"input": "19 20\n>>>>>>>><>>><><<<><\n^v^v^^^vvv^^^v^^vvvv",
"output": "YES"
},
{
"input": "20 20\n<<<>>>><>><<>><<>>>>\n^vvv^^^^vv^^^^^v^^vv",
"output": "NO"
},
{
"input": "20 20\n>>><><<><<<<<<<><<><\nvv^vv^vv^^^^^vv^^^^^",
"output": "NO"
},
{
"input": "20 20\n><<><<<<<<<>>><>>><<\n^^^^^^^^vvvv^vv^vvvv",
"output": "YES"
},
{
"input": "20 20\n<>>>>>>>><>>><>><<<>\nvv^^vv^^^^v^vv^v^^^^",
"output": "YES"
},
{
"input": "20 20\n><>><<>><>>>>>>>><<>\n^^v^vv^^^vvv^v^^^vv^",
"output": "NO"
},
{
"input": "20 20\n<<<<><<>><><<<>><<><\nv^^^^vvv^^^vvvv^v^vv",
"output": "NO"
},
{
"input": "20 20\n><<<><<><>>><><<<<<<\nvv^^vvv^^v^^v^vv^vvv",
"output": "NO"
},
{
"input": "20 20\n<<>>><>>>><<<<>>><<>\nv^vv^^^^^vvv^^v^^v^v",
"output": "NO"
},
{
"input": "20 20\n><<><<><<<<<<>><><>>\nv^^^v^vv^^v^^vvvv^vv",
"output": "NO"
},
{
"input": "20 20\n<<<<<<<<><>><><>><<<\n^vvv^^^v^^^vvv^^^^^v",
"output": "NO"
},
{
"input": "20 20\n>>><<<<<>>><><><<><<\n^^^vvv^^^v^^v^^v^vvv",
"output": "YES"
},
{
"input": "20 20\n<><<<><><>><><><<<<>\n^^^vvvv^vv^v^^^^v^vv",
"output": "NO"
},
{
"input": "20 20\n>>>>>>>>>><>>><>><>>\n^vvv^^^vv^^^^^^vvv^v",
"output": "NO"
},
{
"input": "20 20\n<><>><><<<<<>><<>>><\nv^^^v^v^v^vvvv^^^vv^",
"output": "NO"
},
{
"input": "20 20\n><<<><<<><<<><>>>><<\nvvvv^^^^^vv^v^^vv^v^",
"output": "NO"
},
{
"input": "20 20\n<<><<<<<<>>>>><<<>>>\nvvvvvv^v^vvv^^^^^^^^",
"output": "YES"
},
{
"input": "20 20\n><<><<>>>>><><>><>>>\nv^^^^vvv^^^^^v^v^vv^",
"output": "NO"
},
{
"input": "20 20\n<<>>><>><<>>>><<<><<\n^^vvv^^vvvv^vv^^v^v^",
"output": "NO"
},
{
"input": "20 20\n><<>><>>>><<><>><><<\n^v^^^^^^vvvv^v^v^v^^",
"output": "NO"
},
{
"input": "20 20\n<<><<<<><><<>>><>>>>\n^^vvvvv^v^^^^^^^vvv^",
"output": "NO"
},
{
"input": "20 20\n>><<<<<<><>>>><>>><>\n^^^v^v^vv^^vv^vvv^^^",
"output": "NO"
},
{
"input": "20 20\n>>>>>>>>>>>>>>>>>>>>\nvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "2 2\n><\nv^",
"output": "NO"
},
{
"input": "2 2\n<>\n^v",
"output": "NO"
},
{
"input": "3 3\n>><\nvvv",
"output": "NO"
},
{
"input": "2 3\n<>\nv^^",
"output": "YES"
},
{
"input": "4 4\n>>><\nvvv^",
"output": "NO"
},
{
"input": "20 20\n<><><><><><><><><><>\nvvvvvvvvvvvvvvvvvvvv",
"output": "NO"
},
{
"input": "4 4\n<>>>\nv^^^",
"output": "YES"
},
{
"input": "20 20\n<><><><><><><><><><>\nv^v^v^v^v^v^v^v^v^v^",
"output": "YES"
},
{
"input": "2 3\n<>\n^v^",
"output": "NO"
},
{
"input": "4 3\n<><>\n^vv",
"output": "NO"
},
{
"input": "3 3\n<<>\nvv^",
"output": "YES"
},
{
"input": "2 3\n><\nvv^",
"output": "NO"
},
{
"input": "7 6\n>>><>><\n^vv^vv",
"output": "YES"
},
{
"input": "2 2\n<<\nv^",
"output": "NO"
},
{
"input": "3 3\n>><\n^^^",
"output": "NO"
},
{
"input": "3 3\n<><\nv^v",
"output": "NO"
},
{
"input": "20 20\n><><><><><><><><><><\n^v^v^v^v^v^v^v^v^v^v",
"output": "YES"
},
{
"input": "4 4\n<>>>\nvvv^",
"output": "YES"
}
] | 1,424,140,175 | 2,147,483,647 | Python 3 | OK | TESTS | 81 | 124 | 204,800 | def main():
n, m = map(int, input().split())
nm = n * m
neigh = [[] for _ in range(nm)]
for y, c in enumerate(input()):
for x in range(y * m + 1, y * m + m):
if c == '<':
neigh[x].append(x - 1)
else:
neigh[x - 1].append(x)
for x, c in enumerate(input()):
for y in range(m + x, nm, m):
if c == '^':
neigh[y].append(y - m)
else:
neigh[y - m].append(y)
def dfs(yx):
l[yx] = False
for yx1 in neigh[yx]:
if l[yx1]:
dfs(yx1)
for i in range(nm):
l = [True] * nm
dfs(i)
if any(l):
print('NO')
return
print('YES')
if __name__ == '__main__':
main() | Title: Strongly Connected City
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine a city with *n* horizontal streets crossing *m* vertical streets, forming an (*n*<=-<=1)<=×<=(*m*<=-<=1) grid. In order to increase the traffic flow, mayor of the city has decided to make each street one way. This means in each horizontal street, the traffic moves only from west to east or only from east to west. Also, traffic moves only from north to south or only from south to north in each vertical street. It is possible to enter a horizontal street from a vertical street, or vice versa, at their intersection.
The mayor has received some street direction patterns. Your task is to check whether it is possible to reach any junction from any other junction in the proposed street direction pattern.
Input Specification:
The first line of input contains two integers *n* and *m*, (2<=≤<=*n*,<=*m*<=≤<=20), denoting the number of horizontal streets and the number of vertical streets.
The second line contains a string of length *n*, made of characters '<' and '>', denoting direction of each horizontal street. If the *i*-th character is equal to '<', the street is directed from east to west otherwise, the street is directed from west to east. Streets are listed in order from north to south.
The third line contains a string of length *m*, made of characters '^' and 'v', denoting direction of each vertical street. If the *i*-th character is equal to '^', the street is directed from south to north, otherwise the street is directed from north to south. Streets are listed in order from west to east.
Output Specification:
If the given pattern meets the mayor's criteria, print a single line containing "YES", otherwise print a single line containing "NO".
Demo Input:
['3 3\n><>\nv^v\n', '4 6\n<><>\nv^v^v^\n']
Demo Output:
['NO\n', 'YES\n']
Note:
The figure above shows street directions in the second sample test case. | ```python
def main():
n, m = map(int, input().split())
nm = n * m
neigh = [[] for _ in range(nm)]
for y, c in enumerate(input()):
for x in range(y * m + 1, y * m + m):
if c == '<':
neigh[x].append(x - 1)
else:
neigh[x - 1].append(x)
for x, c in enumerate(input()):
for y in range(m + x, nm, m):
if c == '^':
neigh[y].append(y - m)
else:
neigh[y - m].append(y)
def dfs(yx):
l[yx] = False
for yx1 in neigh[yx]:
if l[yx1]:
dfs(yx1)
for i in range(nm):
l = [True] * nm
dfs(i)
if any(l):
print('NO')
return
print('YES')
if __name__ == '__main__':
main()
``` | 3 | |
586 | A | Alena's Schedule | PROGRAMMING | 900 | [
"implementation"
] | null | null | Alena has successfully passed the entrance exams to the university and is now looking forward to start studying.
One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes).
The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks).
The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not.
Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university.
Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home.
Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair. | The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university.
The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces. | Print a single number — the number of pairs during which Alena stays at the university. | [
"5\n0 1 0 1 1\n",
"7\n1 0 1 0 0 1 0\n",
"1\n0\n"
] | [
"4\n",
"4\n",
"0\n"
] | In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair.
In the last sample Alena doesn't have a single pair, so she spends all the time at home. | 500 | [
{
"input": "5\n0 1 0 1 1",
"output": "4"
},
{
"input": "7\n1 0 1 0 0 1 0",
"output": "4"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "9"
},
{
"input": "11\n0 0 0 0 0 0 0 0 0 0 1",
"output": "1"
},
{
"input": "12\n1 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "20\n1 1 0 1 1 1 1 1 1 1 1 0 1 1 1 0 0 1 0 0",
"output": "16"
},
{
"input": "41\n1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 0 0 0 0 1 0 0 1 0 1 1",
"output": "28"
},
{
"input": "63\n1 1 0 1 1 0 0 0 1 1 0 0 1 1 1 1 0 1 1 0 1 0 1 1 1 1 1 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 0 0 1 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 0",
"output": "39"
},
{
"input": "80\n0 1 1 1 0 1 1 1 1 1 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 0 1 0 1 0 0 0 1 1 0 1 1 0 0 0 0 1 1 1 0 0 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 0 1 1 1 1 1 0 0 0 1 1 0 0 1 1",
"output": "52"
},
{
"input": "99\n1 1 0 0 0 1 0 0 1 1 1 1 0 0 0 1 0 1 1 0 1 1 1 1 0 0 0 0 1 1 1 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 1 1 1 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 0 0 1 0 1 0 1 0 1 1 0 1 0 1",
"output": "72"
},
{
"input": "100\n0 1 1 0 1 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 1 0 0 1 0 0 1 0 0 0 0 1 1 1 1 1 1 0 0 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 1 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 0 1 1 1 1 0 1 1 1 0",
"output": "65"
},
{
"input": "11\n0 1 1 0 0 0 0 0 0 0 0",
"output": "2"
},
{
"input": "11\n0 1 0 1 0 0 1 1 0 1 1",
"output": "8"
},
{
"input": "11\n1 0 1 0 1 1 0 1 1 1 0",
"output": "10"
},
{
"input": "11\n1 0 0 0 0 0 1 0 1 1 1",
"output": "6"
},
{
"input": "22\n0 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0 0 1 0",
"output": "7"
},
{
"input": "22\n0 1 0 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 0 0 0 1",
"output": "16"
},
{
"input": "22\n1 0 1 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "22\n1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 1",
"output": "14"
},
{
"input": "33\n0 1 1 0 1 1 0 1 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 1 1 0 1 1 0 0",
"output": "26"
},
{
"input": "33\n0 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 1 1 0 1 0 1 0 0 1 1 1 0 1 1 1 0 1",
"output": "27"
},
{
"input": "33\n1 0 1 0 1 0 0 0 1 0 1 1 1 0 0 0 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1 1 0",
"output": "25"
},
{
"input": "33\n1 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 0 1 0 1 0 1 0 0 0 0 1 1",
"output": "24"
},
{
"input": "44\n0 1 1 0 1 0 0 0 0 1 1 0 0 0 0 0 1 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 1 0 1 1 0 0",
"output": "19"
},
{
"input": "44\n0 1 1 1 1 0 1 0 0 1 0 1 0 0 1 1 0 1 1 0 0 1 0 1 0 1 1 0 1 0 1 0 1 0 1 0 0 0 0 0 1 0 1 1",
"output": "32"
},
{
"input": "44\n1 0 1 0 0 1 0 1 0 1 0 1 0 1 1 1 1 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 1 0 0 1 0 0 1 0",
"output": "23"
},
{
"input": "44\n1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 1 1 0 1 0 1 1 0 1 0 1 1 1 1",
"output": "32"
},
{
"input": "55\n0 1 1 0 1 0 0 0 1 0 0 0 1 0 1 0 0 1 0 0 0 0 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 1 1 0 0 1 0",
"output": "23"
},
{
"input": "55\n0 1 1 0 1 0 1 1 1 1 0 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 0 1 0 0 1 1 1 1 1 0 0 0 1 1 1 1 1 1 1 1 0 1 1 0 0 0 1",
"output": "39"
},
{
"input": "55\n1 0 1 0 0 1 0 0 1 1 0 1 0 1 0 0 1 1 0 0 0 0 1 1 1 0 0 0 1 1 1 1 0 1 0 1 0 0 0 1 0 1 1 0 0 0 1 0 1 0 0 1 1 0 0",
"output": "32"
},
{
"input": "55\n1 0 1 0 1 0 1 0 1 1 0 0 1 1 1 1 0 1 0 0 0 1 1 0 0 1 0 1 0 1 1 1 0 0 0 0 0 0 1 0 0 0 1 1 1 0 0 0 1 0 1 0 1 1 1",
"output": "36"
},
{
"input": "66\n0 1 1 0 0 1 0 1 0 1 0 1 1 0 1 1 0 0 1 1 0 1 0 0 0 0 0 0 0 1 0 0 0 1 1 1 1 1 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 1 1 0 1 1 1 0 0 0 0 0 1 0",
"output": "41"
},
{
"input": "66\n0 1 1 0 1 1 1 0 0 0 1 1 0 1 1 0 0 1 1 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 1 0 0 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 0 1 0 0 1 0 0 1 1 0 1",
"output": "42"
},
{
"input": "66\n1 0 1 0 0 0 1 0 1 0 1 0 1 1 0 1 0 1 1 0 0 0 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 1 1 0 1 0 0 0 1 1 0 1 0 1 1 0 0 0 1 1 0 1 1 0 1 1 0 0",
"output": "46"
},
{
"input": "66\n1 0 1 0 0 0 1 1 1 1 1 0 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 1 0 0 1 0 1 0 1 0 0 1 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 0 0 0 1 0 1 1 0 0 0 1",
"output": "46"
},
{
"input": "77\n0 0 1 0 0 1 0 0 1 1 1 1 0 1 0 0 1 0 0 0 0 1 0 0 0 0 1 0 1 0 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 0 0 1 0 0 1 1 1 0 1 0 1 1 0 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 0 1 0",
"output": "47"
},
{
"input": "77\n0 0 1 0 0 0 1 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 0 0 0 1 1 0 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 0 0 0 1 0 0 1 0 1 1 0 1 0 0 0 0 1 1",
"output": "44"
},
{
"input": "77\n1 0 0 0 1 0 1 1 0 0 1 0 0 0 1 1 1 1 0 1 0 0 0 0 0 0 1 1 0 0 0 1 0 1 0 1 1 1 0 1 1 1 0 0 0 1 1 0 1 1 1 0 1 1 0 0 1 0 0 1 1 1 1 0 1 0 0 0 1 0 1 1 0 0 0 0 0",
"output": "45"
},
{
"input": "77\n1 0 1 0 0 1 1 0 0 0 0 0 0 0 0 0 0 1 0 1 1 1 0 0 1 1 1 0 1 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 1 1 1 1 1 1 1 0 0 1 1 0 0 1 0 1 1 1 1 1 1 1 1 0 0 1 0 1 1",
"output": "51"
},
{
"input": "88\n0 0 1 0 0 0 0 0 0 0 0 1 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 1 0 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 0 0 0 0 1 0 0 0 1 0 1 1 0 1 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 1 0 0 1 1 1 0",
"output": "44"
},
{
"input": "88\n0 0 1 0 0 0 1 1 0 1 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 1 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 1 1 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 1 0 1 0 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "88\n1 0 0 0 1 1 1 0 1 1 0 0 0 0 0 0 1 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 0 0 0 0 1 0 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 1 1 0 0 1 0 1 1 1 0 1 0 1 1 1 1 0 1 0 1 1 1 0 0 0",
"output": "53"
},
{
"input": "88\n1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 1 1 0 1 1 1 1 1 1 1 0 0 1 0 1 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 1 0 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 1 0 0 1 1 0 1 1 1 1 0 1 1 0 1",
"output": "63"
},
{
"input": "99\n0 0 0 0 1 0 0 1 0 0 0 1 1 1 1 1 1 0 1 1 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 1 0 0 0 1 0 0 1 0 1 0 1 0 0 0 0 1 0 1 1 0 0 1 1 1 0 0 1 1 0 0 0 0 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 1 0 1 0 1 0 0 0 1 1 0 0 0 0",
"output": "56"
},
{
"input": "99\n0 0 1 0 0 1 1 0 0 0 1 1 0 0 1 0 0 0 1 1 1 1 0 0 0 1 1 0 0 0 1 0 1 1 0 0 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 0 1 0 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 0 0 1 0 1 0 1 0 1 1 1 0 0 1 1 1 0 0 0 0 0 0 1 1 1",
"output": "58"
},
{
"input": "99\n1 1 0 0 1 1 1 0 0 0 1 0 1 0 1 1 0 0 0 0 0 0 0 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 0 1 0 1 0 0 1 0 1 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 0 1 0 0 1 0 1 1 0 1 1 0 0 1 0 0 1 0 1 0 1 1 0 1 0 1 1 1 1 0 0 1 0",
"output": "65"
},
{
"input": "99\n1 1 1 0 1 0 1 1 0 1 1 0 0 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 0 1 1 0 1 0 1 0 0 1 1 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 0 1 0 1 0 0 0 1 1 1 1 0 0 1 1 0 1 0 0 0 1 0 1 1 1 0 0 1 1 1 1 1 0 1 1 1 1",
"output": "77"
},
{
"input": "90\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "90"
},
{
"input": "95\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "95\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "95"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
}
] | 1,661,194,857 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 13 | 31 | 0 | lessons = int(input())
schedule = list(map(int, input().split(' ')))
if 1 not in schedule:
print(0)
else:
first_lesson = schedule.index(1)
last_lesson = lessons - schedule[::-1].index(1) - 1
pairs_at_home = len(schedule[0:first_lesson]) + len(schedule[last_lesson + 1:])
i = first_lesson
while i < last_lesson:
if schedule[i] == schedule[i + 1] == 0:
pairs_at_home += 2
i += 2
else:
i += 1
print(lessons - pairs_at_home)
| Title: Alena's Schedule
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alena has successfully passed the entrance exams to the university and is now looking forward to start studying.
One two-hour lesson at the Russian university is traditionally called a pair, it lasts for two academic hours (an academic hour is equal to 45 minutes).
The University works in such a way that every day it holds exactly *n* lessons. Depending on the schedule of a particular group of students, on a given day, some pairs may actually contain classes, but some may be empty (such pairs are called breaks).
The official website of the university has already published the schedule for tomorrow for Alena's group. Thus, for each of the *n* pairs she knows if there will be a class at that time or not.
Alena's House is far from the university, so if there are breaks, she doesn't always go home. Alena has time to go home only if the break consists of at least two free pairs in a row, otherwise she waits for the next pair at the university.
Of course, Alena does not want to be sleepy during pairs, so she will sleep as long as possible, and will only come to the first pair that is presented in her schedule. Similarly, if there are no more pairs, then Alena immediately goes home.
Alena appreciates the time spent at home, so she always goes home when it is possible, and returns to the university only at the beginning of the next pair. Help Alena determine for how many pairs she will stay at the university. Note that during some pairs Alena may be at the university waiting for the upcoming pair.
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of lessons at the university.
The second line contains *n* numbers *a**i* (0<=≤<=*a**i*<=≤<=1). Number *a**i* equals 0, if Alena doesn't have the *i*-th pairs, otherwise it is equal to 1. Numbers *a*1,<=*a*2,<=...,<=*a**n* are separated by spaces.
Output Specification:
Print a single number — the number of pairs during which Alena stays at the university.
Demo Input:
['5\n0 1 0 1 1\n', '7\n1 0 1 0 0 1 0\n', '1\n0\n']
Demo Output:
['4\n', '4\n', '0\n']
Note:
In the first sample Alena stays at the university from the second to the fifth pair, inclusive, during the third pair she will be it the university waiting for the next pair.
In the last sample Alena doesn't have a single pair, so she spends all the time at home. | ```python
lessons = int(input())
schedule = list(map(int, input().split(' ')))
if 1 not in schedule:
print(0)
else:
first_lesson = schedule.index(1)
last_lesson = lessons - schedule[::-1].index(1) - 1
pairs_at_home = len(schedule[0:first_lesson]) + len(schedule[last_lesson + 1:])
i = first_lesson
while i < last_lesson:
if schedule[i] == schedule[i + 1] == 0:
pairs_at_home += 2
i += 2
else:
i += 1
print(lessons - pairs_at_home)
``` | 0 | |
431 | A | Black Square | PROGRAMMING | 800 | [
"implementation"
] | null | null | Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares? | The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104).
The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip. | Print a single integer — the total number of calories that Jury wastes. | [
"1 2 3 4\n123214\n",
"1 5 3 2\n11221\n"
] | [
"13\n",
"13\n"
] | none | 500 | [
{
"input": "1 2 3 4\n123214",
"output": "13"
},
{
"input": "1 5 3 2\n11221",
"output": "13"
},
{
"input": "5 5 5 1\n3422",
"output": "16"
},
{
"input": "4 3 2 1\n2",
"output": "3"
},
{
"input": "5651 6882 6954 4733\n2442313421",
"output": "60055"
},
{
"input": "0 0 0 0\n4132",
"output": "0"
},
{
"input": "3163 5778 83 7640\n11141442444",
"output": "64270"
},
{
"input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442",
"output": "420780"
},
{
"input": "0 0 0 0\n1",
"output": "0"
},
{
"input": "1 2 3 4\n4",
"output": "4"
},
{
"input": "2343 7653 1242 5432\n1",
"output": "2343"
},
{
"input": "2343 7653 1242 5432\n2",
"output": "7653"
},
{
"input": "2343 7653 1242 5432\n3",
"output": "1242"
},
{
"input": "2343 7653 1242 5432\n4",
"output": "5432"
},
{
"input": "1 2 3 4\n123412",
"output": "13"
},
{
"input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111",
"output": "2650"
},
{
"input": "1 2 3 4\n11111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "1 2 3 4\n23123231321231231231231231221232123121312321",
"output": "87"
},
{
"input": "1 2 3 4\n1111111111111222222222233333333333444444444444444",
"output": "126"
},
{
"input": "2 3 1 4\n121321232412342112312313213123123412131231231232",
"output": "105"
}
] | 1,693,591,227 | 2,147,483,647 | Python 3 | OK | TESTS | 49 | 93 | 102,400 | def main(arr, s):
n = 0
for i in range(len(s)):
n += arr[int(s[i]) - 1]
return n
if __name__ == "__main__":
arr = list(map(int, input().split()))
s = str(input())
print(main(arr, s)) | Title: Black Square
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
Input Specification:
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104).
The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Output Specification:
Print a single integer — the total number of calories that Jury wastes.
Demo Input:
['1 2 3 4\n123214\n', '1 5 3 2\n11221\n']
Demo Output:
['13\n', '13\n']
Note:
none | ```python
def main(arr, s):
n = 0
for i in range(len(s)):
n += arr[int(s[i]) - 1]
return n
if __name__ == "__main__":
arr = list(map(int, input().split()))
s = str(input())
print(main(arr, s))
``` | 3 | |
453 | A | Little Pony and Expected Maximum | PROGRAMMING | 1,600 | [
"probabilities"
] | null | null | Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times. | A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105). | Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4. | [
"6 1\n",
"6 3\n",
"2 2\n"
] | [
"3.500000000000\n",
"4.958333333333\n",
"1.750000000000\n"
] | Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value | 500 | [
{
"input": "6 1",
"output": "3.500000000000"
},
{
"input": "6 3",
"output": "4.958333333333"
},
{
"input": "2 2",
"output": "1.750000000000"
},
{
"input": "5 4",
"output": "4.433600000000"
},
{
"input": "5 8",
"output": "4.814773760000"
},
{
"input": "3 10",
"output": "2.982641534996"
},
{
"input": "3 6",
"output": "2.910836762689"
},
{
"input": "1 8",
"output": "1.000000000000"
},
{
"input": "24438 9",
"output": "21994.699969310015"
},
{
"input": "94444 9",
"output": "85000.099992058866"
},
{
"input": "8 66716",
"output": "8.000000000000"
},
{
"input": "4 25132",
"output": "4.000000000000"
},
{
"input": "51520 73331",
"output": "51519.682650242677"
},
{
"input": "54230 31747",
"output": "54228.743352775018"
},
{
"input": "24236 90163",
"output": "24235.975171545670"
},
{
"input": "26946 99523",
"output": "26945.974480086279"
},
{
"input": "50323 7",
"output": "44033.124988408454"
},
{
"input": "53033 3",
"output": "39775.249995286234"
},
{
"input": "55743 5",
"output": "46452.999992525307"
},
{
"input": "59964 79",
"output": "59214.949890211828"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "1 1",
"output": "1.000000000000"
},
{
"input": "3 1",
"output": "2.000000000000"
},
{
"input": "1 2",
"output": "1.000000000000"
},
{
"input": "53513 34040",
"output": "53511.875329020870"
},
{
"input": "100000 100000",
"output": "99999.418033254507"
},
{
"input": "1 100000",
"output": "1.000000000000"
},
{
"input": "100000 1",
"output": "50000.499999999935"
},
{
"input": "2 100000",
"output": "2.000000000000"
},
{
"input": "100000 2",
"output": "66667.166665000332"
},
{
"input": "50000 100000",
"output": "49999.843487110789"
},
{
"input": "99999 1111",
"output": "99909.571915885972"
},
{
"input": "99999 99999",
"output": "99998.418033254609"
},
{
"input": "1000 1000",
"output": "999.419018443269"
},
{
"input": "50000 50000",
"output": "49999.418043215679"
},
{
"input": "88888 88888",
"output": "88887.418034499773"
},
{
"input": "99999 100000",
"output": "99998.418042461126"
},
{
"input": "100000 555",
"output": "99820.643422392372"
},
{
"input": "10000 10000",
"output": "9999.418122897887"
},
{
"input": "100000 5001",
"output": "99980.503829474910"
},
{
"input": "100000 1000",
"output": "99900.599066768002"
}
] | 1,680,811,811 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 12 | 1,000 | 14,745,600 | sides, times = [int(i) for i in input().split()]
sums = 0
for i in range(1,sides+1): sums += i*(i**times-(i-1)**times)
print(sums/(sides**times)) | Title: Little Pony and Expected Maximum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Twilight Sparkle was playing Ludo with her friends Rainbow Dash, Apple Jack and Flutter Shy. But she kept losing. Having returned to the castle, Twilight Sparkle became interested in the dice that were used in the game.
The dice has *m* faces: the first face of the dice contains a dot, the second one contains two dots, and so on, the *m*-th face contains *m* dots. Twilight Sparkle is sure that when the dice is tossed, each face appears with probability . Also she knows that each toss is independent from others. Help her to calculate the expected maximum number of dots she could get after tossing the dice *n* times.
Input Specification:
A single line contains two integers *m* and *n* (1<=≤<=*m*,<=*n*<=≤<=105).
Output Specification:
Output a single real number corresponding to the expected maximum. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=<=-<=4.
Demo Input:
['6 1\n', '6 3\n', '2 2\n']
Demo Output:
['3.500000000000\n', '4.958333333333\n', '1.750000000000\n']
Note:
Consider the third test example. If you've made two tosses:
1. You can get 1 in the first toss, and 2 in the second. Maximum equals to 2. 1. You can get 1 in the first toss, and 1 in the second. Maximum equals to 1. 1. You can get 2 in the first toss, and 1 in the second. Maximum equals to 2. 1. You can get 2 in the first toss, and 2 in the second. Maximum equals to 2.
The probability of each outcome is 0.25, that is expectation equals to:
You can read about expectation using the following link: http://en.wikipedia.org/wiki/Expected_value | ```python
sides, times = [int(i) for i in input().split()]
sums = 0
for i in range(1,sides+1): sums += i*(i**times-(i-1)**times)
print(sums/(sides**times))
``` | 0 | |
591 | A | Wizards' Duel | PROGRAMMING | 900 | [
"implementation",
"math"
] | null | null | Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight. | The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively. | Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if . | [
"100\n50\n50\n",
"199\n60\n40\n"
] | [
"50\n",
"119.4\n"
] | In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor. | 500 | [
{
"input": "100\n50\n50",
"output": "50"
},
{
"input": "199\n60\n40",
"output": "119.4"
},
{
"input": "1\n1\n1",
"output": "0.5"
},
{
"input": "1\n1\n500",
"output": "0.001996007984"
},
{
"input": "1\n500\n1",
"output": "0.998003992"
},
{
"input": "1\n500\n500",
"output": "0.5"
},
{
"input": "1000\n1\n1",
"output": "500"
},
{
"input": "1000\n1\n500",
"output": "1.996007984"
},
{
"input": "1000\n500\n1",
"output": "998.003992"
},
{
"input": "1000\n500\n500",
"output": "500"
},
{
"input": "101\n11\n22",
"output": "33.66666667"
},
{
"input": "987\n1\n3",
"output": "246.75"
},
{
"input": "258\n25\n431",
"output": "14.14473684"
},
{
"input": "979\n39\n60",
"output": "385.6666667"
},
{
"input": "538\n479\n416",
"output": "287.9351955"
},
{
"input": "583\n112\n248",
"output": "181.3777778"
},
{
"input": "978\n467\n371",
"output": "545.0190931"
},
{
"input": "980\n322\n193",
"output": "612.7378641"
},
{
"input": "871\n401\n17",
"output": "835.576555"
},
{
"input": "349\n478\n378",
"output": "194.885514"
},
{
"input": "425\n458\n118",
"output": "337.9340278"
},
{
"input": "919\n323\n458",
"output": "380.0729834"
},
{
"input": "188\n59\n126",
"output": "59.95675676"
},
{
"input": "644\n428\n484",
"output": "302.2280702"
},
{
"input": "253\n80\n276",
"output": "56.85393258"
},
{
"input": "745\n152\n417",
"output": "199.0158172"
},
{
"input": "600\n221\n279",
"output": "265.2"
},
{
"input": "690\n499\n430",
"output": "370.6243272"
},
{
"input": "105\n68\n403",
"output": "15.15923567"
},
{
"input": "762\n462\n371",
"output": "422.6218487"
},
{
"input": "903\n460\n362",
"output": "505.3284672"
},
{
"input": "886\n235\n95",
"output": "630.9393939"
},
{
"input": "655\n203\n18",
"output": "601.6515837"
},
{
"input": "718\n29\n375",
"output": "51.53960396"
},
{
"input": "296\n467\n377",
"output": "163.7819905"
},
{
"input": "539\n61\n56",
"output": "281.017094"
},
{
"input": "133\n53\n124",
"output": "39.82485876"
},
{
"input": "998\n224\n65",
"output": "773.5363322"
},
{
"input": "961\n173\n47",
"output": "755.6954545"
},
{
"input": "285\n468\n62",
"output": "251.6603774"
},
{
"input": "496\n326\n429",
"output": "214.1668874"
},
{
"input": "627\n150\n285",
"output": "216.2068966"
},
{
"input": "961\n443\n50",
"output": "863.535497"
},
{
"input": "623\n422\n217",
"output": "411.4334898"
},
{
"input": "678\n295\n29",
"output": "617.3148148"
}
] | 1,689,861,617 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 15 | 0 | l,p,q=input().split()
l=int(l)
p=int(p)
q=int(q)
s=l/(p+q)*p
print(s)
| Title: Wizards' Duel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
Input Specification:
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Output Specification:
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['100\n50\n50\n', '199\n60\n40\n']
Demo Output:
['50\n', '119.4\n']
Note:
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor. | ```python
l,p,q=input().split()
l=int(l)
p=int(p)
q=int(q)
s=l/(p+q)*p
print(s)
``` | -1 | |
241 | A | Old Peykan | PROGRAMMING | 1,300 | [
"greedy"
] | null | null | There are *n* cities in the country where the Old Peykan lives. These cities are located on a straight line, we'll denote them from left to right as *c*1,<=*c*2,<=...,<=*c**n*. The Old Peykan wants to travel from city *c*1 to *c**n* using roads. There are (*n*<=-<=1) one way roads, the *i*-th road goes from city *c**i* to city *c**i*<=+<=1 and is *d**i* kilometers long.
The Old Peykan travels 1 kilometer in 1 hour and consumes 1 liter of fuel during this time.
Each city *c**i* (except for the last city *c**n*) has a supply of *s**i* liters of fuel which immediately transfers to the Old Peykan if it passes the city or stays in it. This supply refreshes instantly *k* hours after it transfers. The Old Peykan can stay in a city for a while and fill its fuel tank many times.
Initially (at time zero) the Old Peykan is at city *c*1 and *s*1 liters of fuel is transferred to it's empty tank from *c*1's supply. The Old Peykan's fuel tank capacity is unlimited. Old Peykan can not continue its travel if its tank is emptied strictly between two cities.
Find the minimum time the Old Peykan needs to reach city *c**n*. | The first line of the input contains two space-separated integers *m* and *k* (1<=≤<=*m*,<=*k*<=≤<=1000). The value *m* specifies the number of roads between cities which is equal to *n*<=-<=1.
The next line contains *m* space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=1000) and the following line contains *m* space-separated integers *s*1,<=*s*2,<=...,<=*s**m* (1<=≤<=*s**i*<=≤<=1000). | In the only line of the output print a single integer — the minimum time required for The Old Peykan to reach city *c**n* from city *c*1. | [
"4 6\n1 2 5 2\n2 3 3 4\n",
"2 3\n5 6\n5 5\n"
] | [
"10\n",
"14\n"
] | In the second sample above, the Old Peykan stays in *c*<sub class="lower-index">1</sub> for 3 hours. | 0 | [
{
"input": "4 6\n1 2 5 2\n2 3 3 4",
"output": "10"
},
{
"input": "2 3\n5 6\n5 5",
"output": "14"
},
{
"input": "24 3\n11 8 8 12 17 4 4 25 39 37 31 32 38 34 29 29 34 39 39 39 17 9 24 6\n3 5 4 3 3 3 4 3 4 3 3 3 3 4 3 3 4 3 4 3 3 3 3 3",
"output": "862"
},
{
"input": "43 5\n6 7 15 12 15 7 22 33 38 15 7 23 31 21 26 41 25 14 26 33 5 28 22 6 35 17 19 32 41 27 20 25 5 32 37 19 40 9 25 22 10 24 9\n3 5 3 6 5 4 5 3 3 3 3 6 6 3 3 3 3 3 3 3 3 6 3 3 4 3 4 3 6 4 3 6 3 4 6 3 4 5 4 4 3 3 5",
"output": "1566"
},
{
"input": "62 5\n12 12 10 7 27 7 32 15 33 3 23 13 24 30 32 22 21 31 27 27 37 7 5 31 19 16 10 20 24 32 36 42 33 14 41 8 13 3 8 8 12 27 36 15 24 17 23 33 31 5 32 17 14 41 37 31 23 31 41 23 36 12\n4 5 4 3 4 3 5 3 4 3 3 3 3 3 3 3 3 3 5 3 4 3 6 4 4 5 3 4 3 3 3 4 3 5 5 3 4 3 3 3 3 5 3 3 5 3 6 3 3 3 3 4 3 3 4 3 5 3 3 3 4 3",
"output": "2406"
},
{
"input": "81 4\n15 20 14 10 39 4 26 8 8 30 13 43 7 7 4 6 23 42 24 35 12 19 21 31 5 20 8 17 25 31 8 31 9 14 29 35 39 35 19 13 35 11 24 3 22 3 22 41 26 32 17 42 21 16 15 44 12 5 16 20 19 38 15 11 36 14 6 21 5 27 15 40 6 9 32 33 35 4 10 15 26\n3 5 4 3 4 6 4 7 5 4 3 4 3 3 4 3 4 3 3 4 6 5 5 3 3 6 6 5 3 3 5 3 3 6 4 4 3 6 4 3 3 5 6 6 7 3 3 3 3 3 7 3 3 5 3 3 3 4 6 4 6 4 5 3 3 6 4 3 3 3 7 5 4 5 3 5 4 3 3 4 3",
"output": "2419"
},
{
"input": "100 6\n15 20 32 8 29 10 33 15 9 26 28 21 34 7 41 23 9 17 16 15 14 29 25 31 24 26 13 18 19 40 9 16 36 32 39 11 4 31 37 28 32 40 7 18 45 21 15 45 6 15 27 22 27 41 28 7 22 43 25 40 6 7 32 31 36 14 5 27 31 28 23 9 13 14 7 25 28 33 40 22 44 9 29 26 41 30 16 15 31 42 13 40 36 44 17 29 32 29 38 13\n4 4 3 4 3 4 3 3 4 3 4 4 5 6 5 3 3 5 3 5 3 3 5 6 3 4 4 5 4 3 4 3 3 4 4 4 3 5 4 4 4 4 3 3 4 4 6 4 4 5 6 6 4 4 3 5 3 4 3 6 5 3 5 4 4 4 4 3 5 4 3 5 3 3 3 4 3 4 5 4 3 6 5 3 7 3 5 4 5 4 3 5 5 3 5 4 3 5 3 4",
"output": "4491"
}
] | 1,600,931,416 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 278 | 1,228,800 | a,b=map(int,input().split())
d=list(map(int,input().split()))
p=list(map(int,input().split()));k=int(1e9)
for i in range(a):
if sum(d[:i+1])>sum(p[:i+1]):k=min(k,b*(sum(p[:i+1])+max(d[:i+1])-1-sum(p[:i+1]))//max(p[:i+1]))
print(sum(d)+[k,0][k==int(1e9)]) | Title: Old Peykan
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities in the country where the Old Peykan lives. These cities are located on a straight line, we'll denote them from left to right as *c*1,<=*c*2,<=...,<=*c**n*. The Old Peykan wants to travel from city *c*1 to *c**n* using roads. There are (*n*<=-<=1) one way roads, the *i*-th road goes from city *c**i* to city *c**i*<=+<=1 and is *d**i* kilometers long.
The Old Peykan travels 1 kilometer in 1 hour and consumes 1 liter of fuel during this time.
Each city *c**i* (except for the last city *c**n*) has a supply of *s**i* liters of fuel which immediately transfers to the Old Peykan if it passes the city or stays in it. This supply refreshes instantly *k* hours after it transfers. The Old Peykan can stay in a city for a while and fill its fuel tank many times.
Initially (at time zero) the Old Peykan is at city *c*1 and *s*1 liters of fuel is transferred to it's empty tank from *c*1's supply. The Old Peykan's fuel tank capacity is unlimited. Old Peykan can not continue its travel if its tank is emptied strictly between two cities.
Find the minimum time the Old Peykan needs to reach city *c**n*.
Input Specification:
The first line of the input contains two space-separated integers *m* and *k* (1<=≤<=*m*,<=*k*<=≤<=1000). The value *m* specifies the number of roads between cities which is equal to *n*<=-<=1.
The next line contains *m* space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=1000) and the following line contains *m* space-separated integers *s*1,<=*s*2,<=...,<=*s**m* (1<=≤<=*s**i*<=≤<=1000).
Output Specification:
In the only line of the output print a single integer — the minimum time required for The Old Peykan to reach city *c**n* from city *c*1.
Demo Input:
['4 6\n1 2 5 2\n2 3 3 4\n', '2 3\n5 6\n5 5\n']
Demo Output:
['10\n', '14\n']
Note:
In the second sample above, the Old Peykan stays in *c*<sub class="lower-index">1</sub> for 3 hours. | ```python
a,b=map(int,input().split())
d=list(map(int,input().split()))
p=list(map(int,input().split()));k=int(1e9)
for i in range(a):
if sum(d[:i+1])>sum(p[:i+1]):k=min(k,b*(sum(p[:i+1])+max(d[:i+1])-1-sum(p[:i+1]))//max(p[:i+1]))
print(sum(d)+[k,0][k==int(1e9)])
``` | 0 | |
424 | A | Squats | PROGRAMMING | 900 | [
"implementation"
] | null | null | Pasha has many hamsters and he makes them work out. Today, *n* hamsters (*n* is even) came to work out. The hamsters lined up and each hamster either sat down or stood up.
For another exercise, Pasha needs exactly hamsters to stand up and the other hamsters to sit down. In one minute, Pasha can make some hamster ether sit down or stand up. How many minutes will he need to get what he wants if he acts optimally well? | The first line contains integer *n* (2<=≤<=*n*<=≤<=200; *n* is even). The next line contains *n* characters without spaces. These characters describe the hamsters' position: the *i*-th character equals 'X', if the *i*-th hamster in the row is standing, and 'x', if he is sitting. | In the first line, print a single integer — the minimum required number of minutes. In the second line, print a string that describes the hamsters' position after Pasha makes the required changes. If there are multiple optimal positions, print any of them. | [
"4\nxxXx\n",
"2\nXX\n",
"6\nxXXxXx\n"
] | [
"1\nXxXx\n",
"1\nxX\n",
"0\nxXXxXx\n"
] | none | 500 | [
{
"input": "4\nxxXx",
"output": "1\nXxXx"
},
{
"input": "2\nXX",
"output": "1\nxX"
},
{
"input": "6\nxXXxXx",
"output": "0\nxXXxXx"
},
{
"input": "4\nxXXX",
"output": "1\nxxXX"
},
{
"input": "2\nXx",
"output": "0\nXx"
},
{
"input": "22\nXXxXXxxXxXxXXXXXXXXXxx",
"output": "4\nxxxxxxxXxXxXXXXXXXXXxx"
},
{
"input": "30\nXXxXxxXXXXxxXXxxXXxxxxXxxXXXxx",
"output": "0\nXXxXxxXXXXxxXXxxXXxxxxXxxXXXxx"
},
{
"input": "104\nxxXxXxxXXXxxXxXxxXXXxxxXxxXXXxxXXXxXxXxXXxxXxxxxxXXXXxXXXXxXXXxxxXxxxxxxxXxxXxXXxxXXXXxXXXxxXXXXXXXXXxXX",
"output": "4\nxxxxxxxxxXxxXxXxxXXXxxxXxxXXXxxXXXxXxXxXXxxXxxxxxXXXXxXXXXxXXXxxxXxxxxxxxXxxXxXXxxXXXXxXXXxxXXXXXXXXXxXX"
},
{
"input": "78\nxxxXxxXxXxxXxxxxxXxXXXxXXXXxxxxxXxXXXxxXxXXXxxxxXxxXXXxxxxxxxxXXXXxXxXXxXXXxXX",
"output": "3\nXXXXxxXxXxxXxxxxxXxXXXxXXXXxxxxxXxXXXxxXxXXXxxxxXxxXXXxxxxxxxxXXXXxXxXXxXXXxXX"
},
{
"input": "200\nxxXXxxXXxXxxXxxXxXxxXxXxXxXxxxxxXXxXXxxXXXXxXXXxXXxXxXxxxxXxxXXXxxxXxXxxxXxxXXxXxXxxxxxxxXxxXxXxxXxXXXxxXxXXXXxxXxxxXxXXXXXXxXxXXxxxxXxxxXxxxXxXXXxXxXXXXxXXxxxXxXXxxXXxxxXxXxXXxXXXxXxXxxxXXxxxxXXxXXXX",
"output": "4\nXXXXXXXXxXxxXxxXxXxxXxXxXxXxxxxxXXxXXxxXXXXxXXXxXXxXxXxxxxXxxXXXxxxXxXxxxXxxXXxXxXxxxxxxxXxxXxXxxXxXXXxxXxXXXXxxXxxxXxXXXXXXxXxXXxxxxXxxxXxxxXxXXXxXxXXXXxXXxxxXxXXxxXXxxxXxXxXXxXXXxXxXxxxXXxxxxXXxXXXX"
},
{
"input": "198\nxXxxXxxXxxXXxXxXxXxxXXXxxXxxxxXXXXxxXxxxxXXXXxXxXXxxxXXXXXXXxXXXxxxxXXxXXxXxXXxxxxXxXXXXXXxXxxXxXxxxXxXXXXxxXXxxXxxxXXxXxXXxXxXXxXXXXxxxxxXxXXxxxXxXXXXxXxXXxxXxXXxXxXXxxxXxXXXXxXxxXxXXXxxxxXxXXXXxXx",
"output": "5\nxxxxxxxxxxxxxXxXxXxxXXXxxXxxxxXXXXxxXxxxxXXXXxXxXXxxxXXXXXXXxXXXxxxxXXxXXxXxXXxxxxXxXXXXXXxXxxXxXxxxXxXXXXxxXXxxXxxxXXxXxXXxXxXXxXXXXxxxxxXxXXxxxXxXXXXxXxXXxxXxXXxXxXXxxxXxXXXXxXxxXxXXXxxxxXxXXXXxXx"
},
{
"input": "200\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "100\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx"
},
{
"input": "198\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "99\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx"
},
{
"input": "200\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX",
"output": "100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX"
},
{
"input": "198\nXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX",
"output": "99\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX"
},
{
"input": "2\nxx",
"output": "1\nXx"
},
{
"input": "2\nXx",
"output": "0\nXx"
},
{
"input": "2\nxX",
"output": "0\nxX"
},
{
"input": "4\nXXXX",
"output": "2\nxxXX"
},
{
"input": "4\nxxxx",
"output": "2\nXXxx"
},
{
"input": "4\nxxXX",
"output": "0\nxxXX"
},
{
"input": "4\nXXxx",
"output": "0\nXXxx"
},
{
"input": "4\nxXxx",
"output": "1\nXXxx"
},
{
"input": "4\nXxxx",
"output": "1\nXXxx"
},
{
"input": "4\nxxxX",
"output": "1\nXxxX"
},
{
"input": "4\nxxXx",
"output": "1\nXxXx"
},
{
"input": "4\nXXXx",
"output": "1\nxXXx"
},
{
"input": "4\nxXXX",
"output": "1\nxxXX"
},
{
"input": "4\nXxXX",
"output": "1\nxxXX"
},
{
"input": "4\nXXxX",
"output": "1\nxXxX"
},
{
"input": "4\nXxXx",
"output": "0\nXxXx"
},
{
"input": "6\nxXXxXX",
"output": "1\nxxXxXX"
}
] | 1,410,813,174 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 46 | 0 | import math
a=int(input())
y=input()
smallxc=0
result=""
for i in range(0,a):
if(y[i:i+1]=="x"):
smallxc+=1
if smallxc==a//2:
print(0)
print(y)
else:
counter=0
if smallxc>a//2:
for j in range(0,a):
if(y[j:j+1]=="x"):
result+="X"
counter+=1
if counter==smallxc-(a//2):
break
else:
result+="X"
result+=y[j+1:]
else:
for j in range(0,a):
if(y[j:j+1]=="X"):
result+="x"
counter+=1
if counter==a//2-(smallxc):
break
else:
result+="x"
result+=y[j+1:]
print(abs(smallxc-(a//2)))
print(result) | Title: Squats
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has many hamsters and he makes them work out. Today, *n* hamsters (*n* is even) came to work out. The hamsters lined up and each hamster either sat down or stood up.
For another exercise, Pasha needs exactly hamsters to stand up and the other hamsters to sit down. In one minute, Pasha can make some hamster ether sit down or stand up. How many minutes will he need to get what he wants if he acts optimally well?
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=200; *n* is even). The next line contains *n* characters without spaces. These characters describe the hamsters' position: the *i*-th character equals 'X', if the *i*-th hamster in the row is standing, and 'x', if he is sitting.
Output Specification:
In the first line, print a single integer — the minimum required number of minutes. In the second line, print a string that describes the hamsters' position after Pasha makes the required changes. If there are multiple optimal positions, print any of them.
Demo Input:
['4\nxxXx\n', '2\nXX\n', '6\nxXXxXx\n']
Demo Output:
['1\nXxXx\n', '1\nxX\n', '0\nxXXxXx\n']
Note:
none | ```python
import math
a=int(input())
y=input()
smallxc=0
result=""
for i in range(0,a):
if(y[i:i+1]=="x"):
smallxc+=1
if smallxc==a//2:
print(0)
print(y)
else:
counter=0
if smallxc>a//2:
for j in range(0,a):
if(y[j:j+1]=="x"):
result+="X"
counter+=1
if counter==smallxc-(a//2):
break
else:
result+="X"
result+=y[j+1:]
else:
for j in range(0,a):
if(y[j:j+1]=="X"):
result+="x"
counter+=1
if counter==a//2-(smallxc):
break
else:
result+="x"
result+=y[j+1:]
print(abs(smallxc-(a//2)))
print(result)
``` | 3 | |
20 | A | BerOS file system | PROGRAMMING | 1,700 | [
"implementation"
] | A. BerOS file system | 2 | 64 | The new operating system BerOS has a nice feature. It is possible to use any number of characters '/' as a delimiter in path instead of one traditional '/'. For example, strings //usr///local//nginx/sbin// and /usr/local/nginx///sbin are equivalent. The character '/' (or some sequence of such characters) at the end of the path is required only in case of the path to the root directory, which can be represented as single character '/'.
A path called normalized if it contains the smallest possible number of characters '/'.
Your task is to transform a given path to the normalized form. | The first line of the input contains only lowercase Latin letters and character '/' — the path to some directory. All paths start with at least one character '/'. The length of the given line is no more than 100 characters, it is not empty. | The path in normalized form. | [
"//usr///local//nginx/sbin\n"
] | [
"/usr/local/nginx/sbin\n"
] | none | 500 | [
{
"input": "//usr///local//nginx/sbin",
"output": "/usr/local/nginx/sbin"
},
{
"input": "////a//b/////g",
"output": "/a/b/g"
},
{
"input": "/a/b/c",
"output": "/a/b/c"
},
{
"input": "/",
"output": "/"
},
{
"input": "////",
"output": "/"
},
{
"input": "/a//aa/a//",
"output": "/a/aa/a"
},
{
"input": "/aa//b/aa",
"output": "/aa/b/aa"
},
{
"input": "////////////////////////////////////////////////////////////////////////////////////////////////////",
"output": "/"
},
{
"input": "/opt///pokerband///srvb/opt///pokerband///srvb////pokerband///srvb/",
"output": "/opt/pokerband/srvb/opt/pokerband/srvb/pokerband/srvb"
},
{
"input": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game/",
"output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game"
},
{
"input": "/root//pokerband/trunk/server/game/code/src///main/java/com/uosipa/pokerband//gameserver/game//",
"output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game"
},
{
"input": "/root//pokerband/trunk/server/game/code/src///main/java/com/uosipa/pokerband//gameserver/game//test/",
"output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game/test"
},
{
"input": "/root//pokerband/trunk/server/game/code/src///main/java/com/uosipa/pokerband//gameserver/game//testt",
"output": "/root/pokerband/trunk/server/game/code/src/main/java/com/uosipa/pokerband/gameserver/game/testt"
},
{
"input": "///a//a////a/a//a//a//a/////",
"output": "/a/a/a/a/a/a/a"
},
{
"input": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz"
},
{
"input": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz/",
"output": "/zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz"
},
{
"input": "/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a",
"output": "/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a/a"
},
{
"input": "///////////////////////////////////////////////////////////////////////////////////////////////////z",
"output": "/z"
},
{
"input": "/z//////////////////////////////////////////////////////////////////////////////////////////////////",
"output": "/z"
}
] | 1,630,032,453 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 5 | 184 | 20,172,800 | path = input()
for i in range(len(path)):
if path[i] == "/" and (path[i] == path[i - 1]) and i > 0:
continue
print(path[i], end="") | Title: BerOS file system
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
The new operating system BerOS has a nice feature. It is possible to use any number of characters '/' as a delimiter in path instead of one traditional '/'. For example, strings //usr///local//nginx/sbin// and /usr/local/nginx///sbin are equivalent. The character '/' (or some sequence of such characters) at the end of the path is required only in case of the path to the root directory, which can be represented as single character '/'.
A path called normalized if it contains the smallest possible number of characters '/'.
Your task is to transform a given path to the normalized form.
Input Specification:
The first line of the input contains only lowercase Latin letters and character '/' — the path to some directory. All paths start with at least one character '/'. The length of the given line is no more than 100 characters, it is not empty.
Output Specification:
The path in normalized form.
Demo Input:
['//usr///local//nginx/sbin\n']
Demo Output:
['/usr/local/nginx/sbin\n']
Note:
none | ```python
path = input()
for i in range(len(path)):
if path[i] == "/" and (path[i] == path[i - 1]) and i > 0:
continue
print(path[i], end="")
``` | 0 |
322 | B | Ciel and Flowers | PROGRAMMING | 1,600 | [
"combinatorics",
"math"
] | null | null | Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make. | The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers. | Print the maximal number of bouquets Fox Ciel can make. | [
"3 6 9\n",
"4 4 4\n",
"0 0 0\n"
] | [
"6\n",
"4\n",
"0\n"
] | In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet. | 1,000 | [
{
"input": "3 6 9",
"output": "6"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "0 3 6",
"output": "3"
},
{
"input": "7 8 9",
"output": "7"
},
{
"input": "8 8 9",
"output": "8"
},
{
"input": "15 3 999",
"output": "339"
},
{
"input": "32 62 92",
"output": "62"
},
{
"input": "123456789 123456789 123456789",
"output": "123456789"
},
{
"input": "3 5 5",
"output": "4"
},
{
"input": "666806767 385540591 357848286",
"output": "470065214"
},
{
"input": "80010646 727118126 817880463",
"output": "541669744"
},
{
"input": "829651016 732259171 572879931",
"output": "711596705"
},
{
"input": "242854896 442432924 180395753",
"output": "288561190"
},
{
"input": "139978911 5123031 935395222",
"output": "360165721"
},
{
"input": "553182792 10264076 395427398",
"output": "319624755"
},
{
"input": "597790453 720437830 855459575",
"output": "724562619"
},
{
"input": "494914467 356982656 757942689",
"output": "536613270"
},
{
"input": "908118348 67156409 217974865",
"output": "397749873"
},
{
"input": "952726009 629846517 972974334",
"output": "851848953"
},
{
"input": "775140200 616574841 630329230",
"output": "674014756"
},
{
"input": "524780569 326748594 90361407",
"output": "313963523"
},
{
"input": "937984449 184405994 992844522",
"output": "705078321"
},
{
"input": "835108464 525983528 452876698",
"output": "604656229"
},
{
"input": "879716125 531124573 207876166",
"output": "539572288"
},
{
"input": "292920005 241298326 667908343",
"output": "400708891"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 999999999 999999998",
"output": "999999998"
},
{
"input": "999999998 999999998 999999999",
"output": "999999998"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "0 1000000000 0",
"output": "333333333"
},
{
"input": "0 1 0",
"output": "0"
},
{
"input": "1 0 0",
"output": "0"
},
{
"input": "0 2 2",
"output": "0"
},
{
"input": "3 3 5",
"output": "3"
},
{
"input": "2 2 0",
"output": "0"
},
{
"input": "0 5 5",
"output": "2"
},
{
"input": "2 0 11",
"output": "3"
},
{
"input": "9 9 7",
"output": "8"
},
{
"input": "65 30 74",
"output": "56"
}
] | 1,372,623,498 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 9 | 78 | 102,400 | string = input()
m = string.index(' ')
n = string[(m+1):].index(' ') + m+1
r = int(string[:m])
g = int(string[m:n])
b = int(string[n:])
m = min(r, g, b)
print(m + (r-m)//3 + (g-m)//3 + (b-m)//3) | Title: Ciel and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers.
Output Specification:
Print the maximal number of bouquets Fox Ciel can make.
Demo Input:
['3 6 9\n', '4 4 4\n', '0 0 0\n']
Demo Output:
['6\n', '4\n', '0\n']
Note:
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet. | ```python
string = input()
m = string.index(' ')
n = string[(m+1):].index(' ') + m+1
r = int(string[:m])
g = int(string[m:n])
b = int(string[n:])
m = min(r, g, b)
print(m + (r-m)//3 + (g-m)//3 + (b-m)//3)
``` | 0 | |
393 | A | Nineteen | PROGRAMMING | 0 | [] | null | null | Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string. | The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100. | Print a single integer — the maximum number of "nineteen"s that she can get in her string. | [
"nniinneetteeeenn\n",
"nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n",
"nineteenineteen\n"
] | [
"2",
"2",
"2"
] | none | 500 | [
{
"input": "nniinneetteeeenn",
"output": "2"
},
{
"input": "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii",
"output": "2"
},
{
"input": "nineteenineteen",
"output": "2"
},
{
"input": "nssemsnnsitjtihtthij",
"output": "0"
},
{
"input": "eehihnttehtherjsihihnrhimihrjinjiehmtjimnrss",
"output": "1"
},
{
"input": "rrrteiehtesisntnjirtitijnjjjthrsmhtneirjimniemmnrhirssjnhetmnmjejjnjjritjttnnrhnjs",
"output": "2"
},
{
"input": "mmrehtretseihsrjmtsenemniehssnisijmsnntesismmtmthnsieijjjnsnhisi",
"output": "2"
},
{
"input": "hshretttnntmmiertrrnjihnrmshnthirnnirrheinnnrjiirshthsrsijtrrtrmnjrrjnresnintnmtrhsnjrinsseimn",
"output": "1"
},
{
"input": "snmmensntritetnmmmerhhrmhnehehtesmhthseemjhmnrti",
"output": "2"
},
{
"input": "rmeetriiitijmrenmeiijt",
"output": "0"
},
{
"input": "ihimeitimrmhriemsjhrtjtijtesmhemnmmrsetmjttthtjhnnmirtimne",
"output": "1"
},
{
"input": "rhtsnmnesieernhstjnmmirthhieejsjttsiierhihhrrijhrrnejsjer",
"output": "2"
},
{
"input": "emmtjsjhretehmiiiestmtmnmissjrstnsnjmhimjmststsitemtttjrnhsrmsenjtjim",
"output": "2"
},
{
"input": "nmehhjrhirniitshjtrrtitsjsntjhrstjehhhrrerhemehjeermhmhjejjesnhsiirheijjrnrjmminneeehtm",
"output": "3"
},
{
"input": "hsntijjetmehejtsitnthietssmeenjrhhetsnjrsethisjrtrhrierjtmimeenjnhnijeesjttrmn",
"output": "3"
},
{
"input": "jnirirhmirmhisemittnnsmsttesjhmjnsjsmntisheneiinsrjsjirnrmnjmjhmistntersimrjni",
"output": "1"
},
{
"input": "neithjhhhtmejjnmieishethmtetthrienrhjmjenrmtejerernmthmsnrthhtrimmtmshm",
"output": "2"
},
{
"input": "sithnrsnemhijsnjitmijjhejjrinejhjinhtisttteermrjjrtsirmessejireihjnnhhemiirmhhjeet",
"output": "3"
},
{
"input": "jrjshtjstteh",
"output": "0"
},
{
"input": "jsihrimrjnnmhttmrtrenetimemjnshnimeiitmnmjishjjneisesrjemeshjsijithtn",
"output": "2"
},
{
"input": "hhtjnnmsemermhhtsstejehsssmnesereehnnsnnremjmmieethmirjjhn",
"output": "2"
},
{
"input": "tmnersmrtsehhntsietttrehrhneiireijnijjejmjhei",
"output": "1"
},
{
"input": "mtstiresrtmesritnjriirehtermtrtseirtjrhsejhhmnsineinsjsin",
"output": "2"
},
{
"input": "ssitrhtmmhtnmtreijteinimjemsiiirhrttinsnneshintjnin",
"output": "1"
},
{
"input": "rnsrsmretjiitrjthhritniijhjmm",
"output": "0"
},
{
"input": "hntrteieimrimteemenserntrejhhmijmtjjhnsrsrmrnsjseihnjmehtthnnithirnhj",
"output": "3"
},
{
"input": "nmmtsmjrntrhhtmimeresnrinstjnhiinjtnjjjnthsintmtrhijnrnmtjihtinmni",
"output": "0"
},
{
"input": "eihstiirnmteejeehimttrijittjsntjejmessstsemmtristjrhenithrrsssihnthheehhrnmimssjmejjreimjiemrmiis",
"output": "2"
},
{
"input": "srthnimimnemtnmhsjmmmjmmrsrisehjseinemienntetmitjtnnneseimhnrmiinsismhinjjnreehseh",
"output": "3"
},
{
"input": "etrsmrjehntjjimjnmsresjnrthjhehhtreiijjminnheeiinseenmmethiemmistsei",
"output": "3"
},
{
"input": "msjeshtthsieshejsjhsnhejsihisijsertenrshhrthjhiirijjneinjrtrmrs",
"output": "1"
},
{
"input": "mehsmstmeejrhhsjihntjmrjrihssmtnensttmirtieehimj",
"output": "1"
},
{
"input": "mmmsermimjmrhrhejhrrejermsneheihhjemnehrhihesnjsehthjsmmjeiejmmnhinsemjrntrhrhsmjtttsrhjjmejj",
"output": "2"
},
{
"input": "rhsmrmesijmmsnsmmhertnrhsetmisshriirhetmjihsmiinimtrnitrseii",
"output": "1"
},
{
"input": "iihienhirmnihh",
"output": "0"
},
{
"input": "ismtthhshjmhisssnmnhe",
"output": "0"
},
{
"input": "rhsmnrmhejshinnjrtmtsssijimimethnm",
"output": "0"
},
{
"input": "eehnshtiriejhiirntminrirnjihmrnittnmmnjejjhjtennremrnssnejtntrtsiejjijisermj",
"output": "3"
},
{
"input": "rnhmeesnhttrjintnhnrhristjrthhrmehrhjmjhjehmstrijemjmmistes",
"output": "2"
},
{
"input": "ssrmjmjeeetrnimemrhimes",
"output": "0"
},
{
"input": "n",
"output": "0"
},
{
"input": "ni",
"output": "0"
},
{
"input": "nine",
"output": "0"
},
{
"input": "nineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteen",
"output": "13"
},
{
"input": "ninetee",
"output": "0"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwynd",
"output": "0"
},
{
"input": "zenudggmyopddhszhrbmftgzmjorabhgojdtfnzxjkayjlkgczsyshczutkdch",
"output": "0"
},
{
"input": "rtzxovxqfapkdmelxiyjroohufhbakpmmvaxq",
"output": "0"
},
{
"input": "zninetneeineteeniwnteeennieteenineteenineteenineteenineteenineteenineteenineteenineteeninetzeenz",
"output": "13"
},
{
"input": "nnnnnnniiiiiiiiiiiitttttttttteeeeeeeeeeeeeeeeee",
"output": "3"
},
{
"input": "ttttiiiieeeeeeeeeeeennnnnnnnn",
"output": "4"
},
{
"input": "ttttttttteeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiinnnnnnn",
"output": "3"
},
{
"input": "nnnnnnnnnneeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiiiiitttttttttttttttttttt",
"output": "4"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiittttttttttttttttnnnnnnn",
"output": "3"
},
{
"input": "nineeen",
"output": "0"
},
{
"input": "nineteeeeeeeeeeeeeeeeettttttttttttttttttiiiiiiiiiiiiiiiiii",
"output": "0"
},
{
"input": "nineteenieteenieteenieteenieteenieteenieteen",
"output": "4"
},
{
"input": "nineteenineteenineteenineteenineteen",
"output": "5"
}
] | 1,582,254,941 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 2 | 124 | 0 | s = input()
def count(s,char):
return len([x for x in list(s) if x == char])
n = count(s,'n')
i = count(s,'i')
e = count(s,'e')
t = count(s,'t')
print(min(n // 3, e // 3, i, t)) | Title: Nineteen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
Input Specification:
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
Output Specification:
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
Demo Input:
['nniinneetteeeenn\n', 'nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n', 'nineteenineteen\n']
Demo Output:
['2', '2', '2']
Note:
none | ```python
s = input()
def count(s,char):
return len([x for x in list(s) if x == char])
n = count(s,'n')
i = count(s,'i')
e = count(s,'e')
t = count(s,'t')
print(min(n // 3, e // 3, i, t))
``` | 0 | |
20 | C | Dijkstra? | PROGRAMMING | 1,900 | [
"graphs",
"shortest paths"
] | C. Dijkstra? | 1 | 64 | You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*. | The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge.
It is possible that the graph has loops and multiple edges between pair of vertices. | Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them. | [
"5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n",
"5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n"
] | [
"1 4 3 5 ",
"1 4 3 5 "
] | none | 1,500 | [
{
"input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1",
"output": "1 4 3 5 "
},
{
"input": "5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1",
"output": "1 4 3 5 "
},
{
"input": "2 1\n1 2 1",
"output": "1 2 "
},
{
"input": "3 1\n1 2 1",
"output": "-1"
},
{
"input": "3 3\n1 2 1\n1 3 2\n2 3 1",
"output": "1 3 "
},
{
"input": "10 10\n1 5 12\n2 4 140\n2 10 149\n3 6 154\n3 7 9\n3 8 226\n3 10 132\n4 10 55\n5 8 33\n7 8 173",
"output": "1 5 8 7 3 10 "
},
{
"input": "10 10\n1 5 178\n1 8 221\n2 7 92\n2 8 159\n3 5 55\n3 6 179\n3 10 237\n4 8 205\n5 6 191\n8 10 157",
"output": "1 8 10 "
},
{
"input": "10 10\n1 4 200\n1 9 197\n3 4 79\n3 5 213\n3 6 149\n5 8 3\n5 9 189\n6 7 130\n6 9 51\n8 10 135",
"output": "1 9 5 8 10 "
},
{
"input": "10 10\n1 4 201\n2 3 238\n3 4 40\n3 6 231\n3 8 45\n4 5 227\n4 6 58\n4 9 55\n5 7 14\n6 10 242",
"output": "1 4 6 10 "
}
] | 1,598,200,146 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 140 | 7,475,200 | import heapq as hq
import sys
import re
inf =sys.maxsize
def dijkstra(G, s):
n = len(G)
Q = [(0, s)]
d = [inf for i in range(n)]
d[s]=0
tmp=[0 for i in range(n)]
while len(Q)!=0:
(cost, u) = hq.heappop(Q)
for v in range(n):
if d[v] > d[u] + G[u][v]:
d[v] = d[u] + G[u][v]
tmp[v]=u+1
hq.heappush(Q, (d[v], v))
return d,tmp
def main():
ras, yal = re.split(" ", input())
ras = int(ras)
yal = int(yal)
adj = [([inf] * ras) for i in range(ras)]
for i in range(yal):
a, b, c = re.split(" ", input())
adj[int(a) - 1][int(b) - 1] = int(c)
d,tmp= dijkstra(adj, 0)
result = []
result.append(ras)
i = (tmp[ras - 1])
while (True):
result.append((i))
i = tmp[i - 1]
if i == 0:
break
s=""
n=len(result)
for i in range(n):
s+=str(result[n-i-1])
s+=" "
#print (d[ras-1],s)
print (s)
if __name__ == '__main__':
main() | Title: Dijkstra?
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
You are given a weighted undirected graph. The vertices are enumerated from 1 to *n*. Your task is to find the shortest path between the vertex 1 and the vertex *n*.
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105), where *n* is the number of vertices and *m* is the number of edges. Following *m* lines contain one edge each in form *a**i*, *b**i* and *w**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=1<=≤<=*w**i*<=≤<=106), where *a**i*,<=*b**i* are edge endpoints and *w**i* is the length of the edge.
It is possible that the graph has loops and multiple edges between pair of vertices.
Output Specification:
Write the only integer -1 in case of no path. Write the shortest path in opposite case. If there are many solutions, print any of them.
Demo Input:
['5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n', '5 6\n1 2 2\n2 5 5\n2 3 4\n1 4 1\n4 3 3\n3 5 1\n']
Demo Output:
['1 4 3 5 ', '1 4 3 5 ']
Note:
none | ```python
import heapq as hq
import sys
import re
inf =sys.maxsize
def dijkstra(G, s):
n = len(G)
Q = [(0, s)]
d = [inf for i in range(n)]
d[s]=0
tmp=[0 for i in range(n)]
while len(Q)!=0:
(cost, u) = hq.heappop(Q)
for v in range(n):
if d[v] > d[u] + G[u][v]:
d[v] = d[u] + G[u][v]
tmp[v]=u+1
hq.heappush(Q, (d[v], v))
return d,tmp
def main():
ras, yal = re.split(" ", input())
ras = int(ras)
yal = int(yal)
adj = [([inf] * ras) for i in range(ras)]
for i in range(yal):
a, b, c = re.split(" ", input())
adj[int(a) - 1][int(b) - 1] = int(c)
d,tmp= dijkstra(adj, 0)
result = []
result.append(ras)
i = (tmp[ras - 1])
while (True):
result.append((i))
i = tmp[i - 1]
if i == 0:
break
s=""
n=len(result)
for i in range(n):
s+=str(result[n-i-1])
s+=" "
#print (d[ras-1],s)
print (s)
if __name__ == '__main__':
main()
``` | 0 |
248 | A | Cupboards | PROGRAMMING | 800 | [
"implementation"
] | null | null | One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*. | The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces. | In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs. | [
"5\n0 1\n1 0\n0 1\n1 1\n0 1\n"
] | [
"3\n"
] | none | 500 | [
{
"input": "5\n0 1\n1 0\n0 1\n1 1\n0 1",
"output": "3"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1\n1 1\n1 1",
"output": "1"
},
{
"input": "8\n0 1\n1 0\n0 1\n1 1\n0 1\n1 0\n0 1\n1 0",
"output": "7"
},
{
"input": "8\n1 0\n1 0\n1 0\n0 1\n0 1\n1 1\n1 1\n0 1",
"output": "6"
},
{
"input": "15\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "5\n1 0\n1 0\n1 0\n0 1\n0 1",
"output": "4"
}
] | 1,680,812,091 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 57 | 312 | 5,222,400 | t = int(input())
l = 0
r = 0
for _ in range(t):
a = [int(x) for x in input().split()]
l += a[0]
r += a[1]
print(min(t-l, l) + min(t-r,r)) | Title: Cupboards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One foggy Stockholm morning, Karlsson decided to snack on some jam in his friend Lillebror Svantenson's house. Fortunately for Karlsson, there wasn't anybody in his friend's house. Karlsson was not going to be hungry any longer, so he decided to get some food in the house.
Karlsson's gaze immediately fell on *n* wooden cupboards, standing in the kitchen. He immediately realized that these cupboards have hidden jam stocks. Karlsson began to fly greedily around the kitchen, opening and closing the cupboards' doors, grab and empty all the jars of jam that he could find.
And now all jars of jam are empty, Karlsson has had enough and does not want to leave traces of his stay, so as not to let down his friend. Each of the cupboards has two doors: the left one and the right one. Karlsson remembers that when he rushed to the kitchen, all the cupboards' left doors were in the same position (open or closed), similarly, all the cupboards' right doors were in the same position (open or closed). Karlsson wants the doors to meet this condition as well by the time the family returns. Karlsson does not remember the position of all the left doors, also, he cannot remember the position of all the right doors. Therefore, it does not matter to him in what position will be all left or right doors. It is important to leave all the left doors in the same position, and all the right doors in the same position. For example, all the left doors may be closed, and all the right ones may be open.
Karlsson needs one second to open or close a door of a cupboard. He understands that he has very little time before the family returns, so he wants to know the minimum number of seconds *t*, in which he is able to bring all the cupboard doors in the required position.
Your task is to write a program that will determine the required number of seconds *t*.
Input Specification:
The first input line contains a single integer *n* — the number of cupboards in the kitchen (2<=≤<=*n*<=≤<=104). Then follow *n* lines, each containing two integers *l**i* and *r**i* (0<=≤<=*l**i*,<=*r**i*<=≤<=1). Number *l**i* equals one, if the left door of the *i*-th cupboard is opened, otherwise number *l**i* equals zero. Similarly, number *r**i* equals one, if the right door of the *i*-th cupboard is opened, otherwise number *r**i* equals zero.
The numbers in the lines are separated by single spaces.
Output Specification:
In the only output line print a single integer *t* — the minimum number of seconds Karlsson needs to change the doors of all cupboards to the position he needs.
Demo Input:
['5\n0 1\n1 0\n0 1\n1 1\n0 1\n']
Demo Output:
['3\n']
Note:
none | ```python
t = int(input())
l = 0
r = 0
for _ in range(t):
a = [int(x) for x in input().split()]
l += a[0]
r += a[1]
print(min(t-l, l) + min(t-r,r))
``` | 3 | |
677 | A | Vanya and Fence | PROGRAMMING | 800 | [
"implementation"
] | null | null | Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard? | The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person. | Print a single integer — the minimum possible valid width of the road. | [
"3 7\n4 5 14\n",
"6 1\n1 1 1 1 1 1\n",
"6 5\n7 6 8 9 10 5\n"
] | [
"4\n",
"6\n",
"11\n"
] | In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11. | 500 | [
{
"input": "3 7\n4 5 14",
"output": "4"
},
{
"input": "6 1\n1 1 1 1 1 1",
"output": "6"
},
{
"input": "6 5\n7 6 8 9 10 5",
"output": "11"
},
{
"input": "10 420\n214 614 297 675 82 740 174 23 255 15",
"output": "13"
},
{
"input": "10 561\n657 23 1096 487 785 66 481 554 1000 821",
"output": "15"
},
{
"input": "100 342\n478 143 359 336 162 333 385 515 117 496 310 538 469 539 258 676 466 677 1 296 150 560 26 213 627 221 255 126 617 174 279 178 24 435 70 145 619 46 669 566 300 67 576 251 58 176 441 564 569 194 24 669 73 262 457 259 619 78 400 579 222 626 269 47 80 315 160 194 455 186 315 424 197 246 683 220 68 682 83 233 290 664 273 598 362 305 674 614 321 575 362 120 14 534 62 436 294 351 485 396",
"output": "144"
},
{
"input": "100 290\n244 49 276 77 449 261 468 458 201 424 9 131 300 88 432 394 104 77 13 289 435 259 111 453 168 394 156 412 351 576 178 530 81 271 228 564 125 328 42 372 205 61 180 471 33 360 567 331 222 318 241 117 529 169 188 484 202 202 299 268 246 343 44 364 333 494 59 236 84 485 50 8 428 8 571 227 205 310 210 9 324 472 368 490 114 84 296 305 411 351 569 393 283 120 510 171 232 151 134 366",
"output": "145"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "46 71\n30 26 56 138 123 77 60 122 73 45 79 10 130 3 14 1 38 46 128 50 82 16 32 68 28 98 62 106 2 49 131 11 114 39 139 70 40 50 45 137 33 30 35 136 135 19",
"output": "63"
},
{
"input": "20 723\n212 602 293 591 754 91 1135 640 80 495 845 928 1399 498 926 1431 1226 869 814 1386",
"output": "31"
},
{
"input": "48 864\n843 1020 751 1694 18 1429 1395 1174 272 1158 1628 1233 1710 441 765 561 778 748 1501 1200 563 1263 1398 1687 1518 1640 1591 839 500 466 1603 1587 1201 1209 432 868 1159 639 649 628 9 91 1036 147 896 1557 941 518",
"output": "75"
},
{
"input": "26 708\n549 241 821 734 945 1161 566 1268 216 30 1142 730 529 1014 255 168 796 1148 89 113 1328 286 743 871 1259 1397",
"output": "41"
},
{
"input": "75 940\n1620 1745 1599 441 64 1466 1496 1239 1716 1475 778 106 1136 1212 1261 444 781 257 1071 747 626 232 609 1544 682 1326 469 1361 1460 1450 1207 1319 922 625 1737 1057 1698 592 692 80 1016 541 1254 201 682 1007 847 206 1066 809 259 109 240 1611 219 1455 1326 1377 1827 786 42 1002 1382 1592 543 1866 1198 334 1524 1760 340 1566 955 257 1118",
"output": "116"
}
] | 1,695,026,622 | 2,147,483,647 | Python 3 | OK | TESTS | 29 | 46 | 0 | n,h = map(int,input().split())
l = input().split()
res = 0
for p in l:
if int(p)<=h:
res+=1
else:
res+=2
print(res)
| Title: Vanya and Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya and his friends are walking along the fence of height *h* and they do not want the guard to notice them. In order to achieve this the height of each of the friends should not exceed *h*. If the height of some person is greater than *h* he can bend down and then he surely won't be noticed by the guard. The height of the *i*-th person is equal to *a**i*.
Consider the width of the person walking as usual to be equal to 1, while the width of the bent person is equal to 2. Friends want to talk to each other while walking, so they would like to walk in a single row. What is the minimum width of the road, such that friends can walk in a row and remain unattended by the guard?
Input Specification:
The first line of the input contains two integers *n* and *h* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*h*<=≤<=1000) — the number of friends and the height of the fence, respectively.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2*h*), the *i*-th of them is equal to the height of the *i*-th person.
Output Specification:
Print a single integer — the minimum possible valid width of the road.
Demo Input:
['3 7\n4 5 14\n', '6 1\n1 1 1 1 1 1\n', '6 5\n7 6 8 9 10 5\n']
Demo Output:
['4\n', '6\n', '11\n']
Note:
In the first sample, only person number 3 must bend down, so the required width is equal to 1 + 1 + 2 = 4.
In the second sample, all friends are short enough and no one has to bend, so the width 1 + 1 + 1 + 1 + 1 + 1 = 6 is enough.
In the third sample, all the persons have to bend, except the last one. The required minimum width of the road is equal to 2 + 2 + 2 + 2 + 2 + 1 = 11. | ```python
n,h = map(int,input().split())
l = input().split()
res = 0
for p in l:
if int(p)<=h:
res+=1
else:
res+=2
print(res)
``` | 3 | |
41 | A | Translation | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Translation | 2 | 256 | The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly. | The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols. | If the word *t* is a word *s*, written reversely, print YES, otherwise print NO. | [
"code\nedoc\n",
"abb\naba\n",
"code\ncode\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "code\nedoc",
"output": "YES"
},
{
"input": "abb\naba",
"output": "NO"
},
{
"input": "code\ncode",
"output": "NO"
},
{
"input": "abacaba\nabacaba",
"output": "YES"
},
{
"input": "q\nq",
"output": "YES"
},
{
"input": "asrgdfngfnmfgnhweratgjkk\nasrgdfngfnmfgnhweratgjkk",
"output": "NO"
},
{
"input": "z\na",
"output": "NO"
},
{
"input": "asd\ndsa",
"output": "YES"
},
{
"input": "abcdef\nfecdba",
"output": "NO"
},
{
"input": "ywjjbirapvskozubvxoemscfwl\ngnduubaogtfaiowjizlvjcu",
"output": "NO"
},
{
"input": "mfrmqxtzvgaeuleubcmcxcfqyruwzenguhgrmkuhdgnhgtgkdszwqyd\nmfxufheiperjnhyczclkmzyhcxntdfskzkzdwzzujdinf",
"output": "NO"
},
{
"input": "bnbnemvybqizywlnghlykniaxxxlkhftppbdeqpesrtgkcpoeqowjwhrylpsziiwcldodcoonpimudvrxejjo\ntiynnekmlalogyvrgptbinkoqdwzuiyjlrldxhzjmmp",
"output": "NO"
},
{
"input": "pwlpubwyhzqvcitemnhvvwkmwcaawjvdiwtoxyhbhbxerlypelevasmelpfqwjk\nstruuzebbcenziscuoecywugxncdwzyfozhljjyizpqcgkyonyetarcpwkqhuugsqjuixsxptmbnlfupdcfigacdhhrzb",
"output": "NO"
},
{
"input": "gdvqjoyxnkypfvdxssgrihnwxkeojmnpdeobpecytkbdwujqfjtxsqspxvxpqioyfagzjxupqqzpgnpnpxcuipweunqch\nkkqkiwwasbhezqcfeceyngcyuogrkhqecwsyerdniqiocjehrpkljiljophqhyaiefjpavoom",
"output": "NO"
},
{
"input": "umeszdawsvgkjhlqwzents\nhxqhdungbylhnikwviuh",
"output": "NO"
},
{
"input": "juotpscvyfmgntshcealgbsrwwksgrwnrrbyaqqsxdlzhkbugdyx\nibqvffmfktyipgiopznsqtrtxiijntdbgyy",
"output": "NO"
},
{
"input": "zbwueheveouatecaglziqmudxemhrsozmaujrwlqmppzoumxhamwugedikvkblvmxwuofmpafdprbcftew\nulczwrqhctbtbxrhhodwbcxwimncnexosksujlisgclllxokrsbnozthajnnlilyffmsyko",
"output": "NO"
},
{
"input": "nkgwuugukzcv\nqktnpxedwxpxkrxdvgmfgoxkdfpbzvwsduyiybynbkouonhvmzakeiruhfmvrktghadbfkmwxduoqv",
"output": "NO"
},
{
"input": "incenvizhqpcenhjhehvjvgbsnfixbatrrjstxjzhlmdmxijztphxbrldlqwdfimweepkggzcxsrwelodpnryntepioqpvk\ndhjbjjftlvnxibkklxquwmzhjfvnmwpapdrslioxisbyhhfymyiaqhlgecpxamqnocizwxniubrmpyubvpenoukhcobkdojlybxd",
"output": "NO"
},
{
"input": "w\nw",
"output": "YES"
},
{
"input": "vz\nzv",
"output": "YES"
},
{
"input": "ry\nyr",
"output": "YES"
},
{
"input": "xou\nuox",
"output": "YES"
},
{
"input": "axg\ngax",
"output": "NO"
},
{
"input": "zdsl\nlsdz",
"output": "YES"
},
{
"input": "kudl\nldku",
"output": "NO"
},
{
"input": "zzlzwnqlcl\nlclqnwzlzz",
"output": "YES"
},
{
"input": "vzzgicnzqooejpjzads\nsdazjpjeooqzncigzzv",
"output": "YES"
},
{
"input": "raqhmvmzuwaykjpyxsykr\nxkysrypjkyawuzmvmhqar",
"output": "NO"
},
{
"input": "ngedczubzdcqbxksnxuavdjaqtmdwncjnoaicvmodcqvhfezew\nwezefhvqcdomvciaonjcnwdmtqajdvauxnskxbqcdzbuzcdegn",
"output": "YES"
},
{
"input": "muooqttvrrljcxbroizkymuidvfmhhsjtumksdkcbwwpfqdyvxtrlymofendqvznzlmim\nmimlznzvqdnefomylrtxvydqfpwwbckdskmutjshhmfvdiumykziorbxcjlrrvttqooum",
"output": "YES"
},
{
"input": "vxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaivg\ngviayyikkitmuomcpiakhbxszgbnhvwyzkftwoagzixaearxpjacrnvpvbuzenvovehkmmxvblqyxvctroddksdsgebcmlluqpxv",
"output": "YES"
},
{
"input": "mnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfdc\ncdfmkdgrdptkpewbsqvszipgxvgvuiuzbkkwuowbafkikgvnqdkxnayzdjygvezmtsgywnupocdntipiyiorblqkrzjpzatxahnm",
"output": "NO"
},
{
"input": "dgxmzbqofstzcdgthbaewbwocowvhqpinehpjatnnbrijcolvsatbblsrxabzrpszoiecpwhfjmwuhqrapvtcgvikuxtzbftydkw\nwkdytfbztxukivgctvparqhuwmjfhwpceiozsprzbaxrslbbqasvlocjirbnntajphenipthvwocowbweabhtgdcztsfoqbzmxgd",
"output": "NO"
},
{
"input": "gxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwgeh\nhegwxvocotmzstqfbmpjvijgkcyodlxyjawrpkczpmdspsuhoiruavnnnuwvtwohglkdxjetshkboalvzqbgjgthoteceixioxg",
"output": "YES"
},
{
"input": "sihxuwvmaambplxvjfoskinghzicyfqebjtkysotattkahssumfcgrkheotdxwjckpvapbkaepqrxseyfrwtyaycmrzsrsngkh\nhkgnsrszrmcyaytwrfyesxrqpeakbpavpkcjwxdtoehkrgcfmusshakttatosyktjbeqfycizhgniksofjvxlpbmaamvwuxhis",
"output": "YES"
},
{
"input": "ycnahksbughnonldzrhkysujmylcgcfuludjvjiahtkyzqvkopzqcnwhltbzfugzojqkjjlggmvnultascmygelkiktmfieok\nkoeifmtkiklegkmcsatlunvmggkjjlqjozgufzbtlhwncqzpokvqzykthaijvjdulufcgclymjusyyhrzdlnonhgubskhancy",
"output": "NO"
},
{
"input": "wbqasaehtkfojruzyhrlgwmtyiovmzyfifslvlemhqheyaelzwnthrenjsbmntwaoryzwfbxmscmypvxlfmzpnkkjlvwvmtz\nztmvwvljkknpzmflxvpymcsmxbfwzyroawtnmbsjnerhtnwzleayehqhmelvlsfifyzmvoiytmwglrhyzurjofktheasaqbw",
"output": "YES"
},
{
"input": "imippqurprbhfugngtgifelytadegwrgaefnfhbjjnmzikvjaccotqzemufqieqldgnbmviisgkynzeldlhqxuqphjfmyij\njiymfjhpquxqhldleznykgsiivmbngdlqeiqfumezqtoccajvkizmnjjbhfnfeagrwgedatylefigtgngufhbrpruqppimi",
"output": "YES"
},
{
"input": "bikydffiuisckpvzqlteqfhegsagimodb\nbdomigasgehfqetlqzvpkcsiuiffdykib",
"output": "YES"
}
] | 1,655,724,911 | 2,147,483,647 | Python 3 | OK | TESTS | 40 | 92 | 0 | text1 = input()
text2 = input()
if text1 == text2[::- 1]:
print("YES")
else:
print("NO")
# this worked the first time
| Title: Translation
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The translation from the Berland language into the Birland language is not an easy task. Those languages are very similar: a berlandish word differs from a birlandish word with the same meaning a little: it is spelled (and pronounced) reversely. For example, a Berlandish word code corresponds to a Birlandish word edoc. However, it's easy to make a mistake during the «translation». Vasya translated word *s* from Berlandish into Birlandish as *t*. Help him: find out if he translated the word correctly.
Input Specification:
The first line contains word *s*, the second line contains word *t*. The words consist of lowercase Latin letters. The input data do not consist unnecessary spaces. The words are not empty and their lengths do not exceed 100 symbols.
Output Specification:
If the word *t* is a word *s*, written reversely, print YES, otherwise print NO.
Demo Input:
['code\nedoc\n', 'abb\naba\n', 'code\ncode\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
text1 = input()
text2 = input()
if text1 == text2[::- 1]:
print("YES")
else:
print("NO")
# this worked the first time
``` | 3.977 |
384 | A | Coder | PROGRAMMING | 800 | [
"implementation"
] | null | null | Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). | On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any. | [
"2\n"
] | [
"2\nC.\n.C\n"
] | none | 500 | [
{
"input": "2",
"output": "2\nC.\n.C"
},
{
"input": "3",
"output": "5\nC.C\n.C.\nC.C"
},
{
"input": "4",
"output": "8\nC.C.\n.C.C\nC.C.\n.C.C"
},
{
"input": "10",
"output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C"
},
{
"input": "15",
"output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C"
},
{
"input": "100",
"output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "101",
"output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "500",
"output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...."
},
{
"input": "501",
"output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..."
},
{
"input": "755",
"output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "888",
"output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "998",
"output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "999",
"output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1000",
"output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1",
"output": "1\nC"
}
] | 1,556,971,186 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 78 | 0 | x=int(input())
s=[]
for n in range(x):
s.append([])
for k in range(x):
if n%2==0:
if k%2==0:
s[n].append('C')
else:
s[n].append('.')
else:
if k%2==0:
s[n].append('.')
else:
s[n].append('C')
for n in range(x):
for k in range(x):
print(s[n][k],end='')
print()
| Title: Coder
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
Demo Input:
['2\n']
Demo Output:
['2\nC.\n.C\n']
Note:
none | ```python
x=int(input())
s=[]
for n in range(x):
s.append([])
for k in range(x):
if n%2==0:
if k%2==0:
s[n].append('C')
else:
s[n].append('.')
else:
if k%2==0:
s[n].append('.')
else:
s[n].append('C')
for n in range(x):
for k in range(x):
print(s[n][k],end='')
print()
``` | 0 | |
51 | B | bHTML Tables Analisys | PROGRAMMING | 1,700 | [
"expression parsing"
] | B. bHTML Tables Analisys | 2 | 256 | In this problem is used an extremely simplified version of HTML table markup. Please use the statement as a formal document and read it carefully.
A string is a bHTML table, if it satisfies the grammar:
Blanks in the grammar are only for purposes of illustration, in the given data there will be no spaces. The bHTML table is very similar to a simple regular HTML table in which meet only the following tags : "table", "tr", "td", all the tags are paired and the table contains at least one row and at least one cell in each row. Have a look at the sample tests as examples of tables.
As can be seen, the tables may be nested. You are given a table (which may contain other(s)). You need to write a program that analyzes all the tables and finds the number of cells in each of them. The tables are not required to be rectangular. | For convenience, input data can be separated into non-empty lines in an arbitrary manner. The input data consist of no more than 10 lines. Combine (concatenate) all the input lines into one, to get a text representation *s* of the specified table. String *s* corresponds to the given grammar (the root element of grammar is TABLE), its length does not exceed 5000. Only lower case letters are used to write tags. There are no spaces in the given string *s*. | Print the sizes of all the tables in the non-decreasing order. | [
"<table><tr><td></td></tr></table>\n",
"<table>\n<tr>\n<td>\n<table><tr><td></td></tr><tr><td></\ntd\n></tr><tr\n><td></td></tr><tr><td></td></tr></table>\n</td>\n</tr>\n</table>\n",
"<table><tr><td>\n<table><tr><td>\n<table><tr><td>\n<table><tr><td></td><td></td>\n</tr><tr><td></td></tr></table>\n</td></tr></table>\n</td></tr></table>\n</td></tr></table>\n"
] | [
"1 ",
"1 4 ",
"1 1 1 3 "
] | none | 1,000 | [
{
"input": "<table><tr><td></td></tr></table>",
"output": "1 "
},
{
"input": "<table>\n<tr>\n<td>\n<table><tr><td></td></tr><tr><td></\ntd\n></tr><tr\n><td></td></tr><tr><td></td></tr></table>\n</td>\n</tr>\n</table>",
"output": "1 4 "
},
{
"input": "<table><tr><td>\n<table><tr><td>\n<table><tr><td>\n<table><tr><td></td><td></td>\n</tr><tr><td></td></tr></table>\n</td></tr></table>\n</td></tr></table>\n</td></tr></table>",
"output": "1 1 1 3 "
},
{
"input": "<\nt\na\nble><tr><td></td>\n</\ntr>\n</\nt\nab\nle>",
"output": "1 "
},
{
"input": "<table><tr><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 1 "
},
{
"input": "<table><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 "
},
{
"input": "<table><tr><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 1 "
},
{
"input": "<table><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 "
},
{
"input": "<table><tr><td><table><tr><td></td><td></td></tr></table></td><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 2 2 "
},
{
"input": "<table><tr><td><table><tr><td></td><td></td></tr></table></td><td><table><tr><td></td></tr></table></td></tr></table>",
"output": "1 2 2 "
},
{
"input": "<table><tr><td><table><tr><td></td></tr></table></td></tr><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 2 "
},
{
"input": "<table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td><table><tr><td></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table>",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
}
] | 1,689,668,145 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 122 | 0 | open_tag_count = -1
close_tag_count = -2
text = ''
while open_tag_count != close_tag_count:
text += input()
open_tag_count = text.count('<table>')
close_tag_count = text.count('</table>')
print(text) | Title: bHTML Tables Analisys
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In this problem is used an extremely simplified version of HTML table markup. Please use the statement as a formal document and read it carefully.
A string is a bHTML table, if it satisfies the grammar:
Blanks in the grammar are only for purposes of illustration, in the given data there will be no spaces. The bHTML table is very similar to a simple regular HTML table in which meet only the following tags : "table", "tr", "td", all the tags are paired and the table contains at least one row and at least one cell in each row. Have a look at the sample tests as examples of tables.
As can be seen, the tables may be nested. You are given a table (which may contain other(s)). You need to write a program that analyzes all the tables and finds the number of cells in each of them. The tables are not required to be rectangular.
Input Specification:
For convenience, input data can be separated into non-empty lines in an arbitrary manner. The input data consist of no more than 10 lines. Combine (concatenate) all the input lines into one, to get a text representation *s* of the specified table. String *s* corresponds to the given grammar (the root element of grammar is TABLE), its length does not exceed 5000. Only lower case letters are used to write tags. There are no spaces in the given string *s*.
Output Specification:
Print the sizes of all the tables in the non-decreasing order.
Demo Input:
['<table><tr><td></td></tr></table>\n', '<table>\n<tr>\n<td>\n<table><tr><td></td></tr><tr><td></\ntd\n></tr><tr\n><td></td></tr><tr><td></td></tr></table>\n</td>\n</tr>\n</table>\n', '<table><tr><td>\n<table><tr><td>\n<table><tr><td>\n<table><tr><td></td><td></td>\n</tr><tr><td></td></tr></table>\n</td></tr></table>\n</td></tr></table>\n</td></tr></table>\n']
Demo Output:
['1 ', '1 4 ', '1 1 1 3 ']
Note:
none | ```python
open_tag_count = -1
close_tag_count = -2
text = ''
while open_tag_count != close_tag_count:
text += input()
open_tag_count = text.count('<table>')
close_tag_count = text.count('</table>')
print(text)
``` | 0 |
870 | A | Search for Pretty Integers | PROGRAMMING | 900 | [
"brute force",
"implementation"
] | null | null | You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer? | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list. | Print the smallest pretty integer. | [
"2 3\n4 2\n5 7 6\n",
"8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n"
] | [
"25\n",
"1\n"
] | In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer. | 500 | [
{
"input": "2 3\n4 2\n5 7 6",
"output": "25"
},
{
"input": "8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n9\n1",
"output": "19"
},
{
"input": "9 1\n5 4 2 3 6 1 7 9 8\n9",
"output": "9"
},
{
"input": "5 3\n7 2 5 8 6\n3 1 9",
"output": "12"
},
{
"input": "4 5\n5 2 6 4\n8 9 1 3 7",
"output": "12"
},
{
"input": "5 9\n4 2 1 6 7\n2 3 4 5 6 7 8 9 1",
"output": "1"
},
{
"input": "9 9\n5 4 3 2 1 6 7 8 9\n3 2 1 5 4 7 8 9 6",
"output": "1"
},
{
"input": "9 5\n2 3 4 5 6 7 8 9 1\n4 2 1 6 7",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n1 2 3 4 5 6 7 8 9\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "9 9\n9 8 7 6 5 4 3 2 1\n9 8 7 6 5 4 3 2 1",
"output": "1"
},
{
"input": "1 1\n8\n9",
"output": "89"
},
{
"input": "1 1\n9\n8",
"output": "89"
},
{
"input": "1 1\n1\n2",
"output": "12"
},
{
"input": "1 1\n2\n1",
"output": "12"
},
{
"input": "1 1\n9\n9",
"output": "9"
},
{
"input": "1 1\n1\n1",
"output": "1"
},
{
"input": "4 5\n3 2 4 5\n1 6 5 9 8",
"output": "5"
},
{
"input": "3 2\n4 5 6\n1 5",
"output": "5"
},
{
"input": "5 4\n1 3 5 6 7\n2 4 3 9",
"output": "3"
},
{
"input": "5 5\n1 3 5 7 9\n2 4 6 8 9",
"output": "9"
},
{
"input": "2 2\n1 8\n2 8",
"output": "8"
},
{
"input": "5 5\n5 6 7 8 9\n1 2 3 4 5",
"output": "5"
},
{
"input": "5 5\n1 2 3 4 5\n1 2 3 4 5",
"output": "1"
},
{
"input": "5 5\n1 2 3 4 5\n2 3 4 5 6",
"output": "2"
},
{
"input": "2 2\n1 5\n2 5",
"output": "5"
},
{
"input": "4 4\n1 3 5 8\n2 4 6 8",
"output": "8"
},
{
"input": "3 3\n1 5 3\n2 5 7",
"output": "5"
},
{
"input": "3 3\n3 6 8\n2 6 9",
"output": "6"
},
{
"input": "2 2\n1 4\n2 4",
"output": "4"
},
{
"input": "5 3\n3 4 5 6 7\n1 5 9",
"output": "5"
},
{
"input": "4 4\n1 2 3 4\n2 5 6 7",
"output": "2"
},
{
"input": "5 5\n1 2 3 4 5\n9 2 1 7 5",
"output": "1"
},
{
"input": "2 2\n1 3\n2 3",
"output": "3"
},
{
"input": "3 3\n3 2 1\n3 2 1",
"output": "1"
},
{
"input": "3 3\n1 3 5\n2 3 6",
"output": "3"
},
{
"input": "3 3\n5 6 7\n5 6 7",
"output": "5"
},
{
"input": "1 2\n5\n2 5",
"output": "5"
},
{
"input": "3 3\n2 4 9\n7 8 9",
"output": "9"
},
{
"input": "3 3\n1 2 4\n3 4 5",
"output": "4"
},
{
"input": "3 2\n1 4 9\n2 4",
"output": "4"
},
{
"input": "3 3\n3 5 6\n1 5 9",
"output": "5"
},
{
"input": "3 2\n1 2 4\n3 4",
"output": "4"
},
{
"input": "2 4\n8 9\n1 2 3 9",
"output": "9"
},
{
"input": "1 2\n9\n8 9",
"output": "9"
},
{
"input": "3 2\n1 2 4\n4 2",
"output": "2"
},
{
"input": "2 3\n4 5\n1 3 5",
"output": "5"
},
{
"input": "3 2\n1 2 3\n2 3",
"output": "2"
},
{
"input": "4 3\n1 3 5 9\n2 8 9",
"output": "9"
},
{
"input": "2 2\n1 9\n9 2",
"output": "9"
}
] | 1,552,957,816 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 108 | 0 | n,m = input().split()
n,m = int(n),int(m)
a = input().split()
b = input().split()
a = [int(c) for c in a]
b = [int(d) for d in b]
a.sort();b.sort()
c,d = a[0],b[0]
if c==d:
print(c)
elif c>d:
print("%i%i" % (d,c))
else:
print("%i%i" % (c,d)) | Title: Search for Pretty Integers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two lists of non-zero digits.
Let's call an integer pretty if its (base 10) representation has at least one digit from the first list and at least one digit from the second list. What is the smallest positive pretty integer?
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=9) — the lengths of the first and the second lists, respectively.
The second line contains *n* distinct digits *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=9) — the elements of the first list.
The third line contains *m* distinct digits *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=9) — the elements of the second list.
Output Specification:
Print the smallest pretty integer.
Demo Input:
['2 3\n4 2\n5 7 6\n', '8 8\n1 2 3 4 5 6 7 8\n8 7 6 5 4 3 2 1\n']
Demo Output:
['25\n', '1\n']
Note:
In the first example 25, 46, 24567 are pretty, as well as many other integers. The smallest among them is 25. 42 and 24 are not pretty because they don't have digits from the second list.
In the second example all integers that have at least one digit different from 9 are pretty. It's obvious that the smallest among them is 1, because it's the smallest positive integer. | ```python
n,m = input().split()
n,m = int(n),int(m)
a = input().split()
b = input().split()
a = [int(c) for c in a]
b = [int(d) for d in b]
a.sort();b.sort()
c,d = a[0],b[0]
if c==d:
print(c)
elif c>d:
print("%i%i" % (d,c))
else:
print("%i%i" % (c,d))
``` | 0 | |
107 | B | Basketball Team | PROGRAMMING | 1,600 | [
"combinatorics",
"dp",
"math",
"probabilities"
] | B. Basketball Team | 1 | 256 | As a German University in Cairo (GUC) student and a basketball player, Herr Wafa was delighted once he heard the news. GUC is finally participating in the Annual Basketball Competition (ABC).
A team is to be formed of *n* players, all of which are GUC students. However, the team might have players belonging to different departments. There are *m* departments in GUC, numbered from 1 to *m*. Herr Wafa's department has number *h*. For each department *i*, Herr Wafa knows number *s**i* — how many students who play basketball belong to this department.
Herr Wafa was also able to guarantee a spot on the team, using his special powers. But since he hates floating-point numbers, he needs your help at finding the probability that he will have at least one teammate belonging to his department.
Note that every possible team containing Herr Wafa is equally probable. Consider all the students different from each other. | The first line contains three integers *n*, *m* and *h* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=1000,<=1<=≤<=*h*<=≤<=*m*) — the number of players on the team, the number of departments in GUC and Herr Wafa's department, correspondingly.
The second line contains a single-space-separated list of *m* integers *s**i* (1<=≤<=*s**i*<=≤<=100), denoting the number of students in the *i*-th department. Note that *s**h* includes Herr Wafa. | Print the probability that Herr Wafa will have at least one teammate from his department. If there is not enough basketball players in GUC to participate in ABC, print -1. The answer will be accepted if it has absolute or relative error not exceeding 10<=-<=6. | [
"3 2 1\n2 1\n",
"3 2 1\n1 1\n",
"3 2 1\n2 2\n"
] | [
"1\n",
"-1\n",
"0.666667\n"
] | In the first example all 3 players (2 from department 1 and 1 from department 2) must be chosen for the team. Both players from Wafa's departments will be chosen, so he's guaranteed to have a teammate from his department.
In the second example, there are not enough players.
In the third example, there are three possibilities to compose the team containing Herr Wafa. In two of them the other player from Herr Wafa's department is part of the team. | 1,000 | [
{
"input": "3 2 1\n2 1",
"output": "1"
},
{
"input": "3 2 1\n1 1",
"output": "-1"
},
{
"input": "3 2 1\n2 2",
"output": "0.666667"
},
{
"input": "3 2 1\n1 2",
"output": "0.000000"
},
{
"input": "6 5 3\n5 2 3 10 5",
"output": "0.380435"
},
{
"input": "7 10 6\n9 10 2 3 3 6 9 9 3 7",
"output": "0.420946"
},
{
"input": "17 5 1\n10 4 9 6 2",
"output": "0.999860"
},
{
"input": "5 8 3\n9 7 2 5 2 10 3 4",
"output": "0.097561"
},
{
"input": "14 8 4\n6 2 10 6 2 8 4 2",
"output": "0.885750"
},
{
"input": "14 9 9\n9 4 7 2 1 2 4 3 9",
"output": "0.971132"
},
{
"input": "46 73 68\n4 2 6 4 1 9 8 10 7 8 7 2 6 4 7 9 7 9 9 1 5 1 5 1 8 2 10 2 1 7 10 2 8 3 5 3 8 9 10 5 3 4 10 4 9 6 8 1 1 6 3 1 9 6 9 4 4 3 4 5 8 1 6 2 4 10 5 7 2 6 7 4 2",
"output": "0.525158"
},
{
"input": "24 55 54\n8 3 6 4 8 9 10 2 2 6 6 8 3 4 5 6 6 6 10 4 8 2 3 2 2 2 10 7 10 1 6 1 6 8 10 9 2 8 9 6 6 4 1 2 7 2 2 9 3 7 3 7 6 8 4",
"output": "0.433479"
},
{
"input": "63 25 24\n6 7 7 1 2 5 5 9 9 1 9 8 1 2 10 10 5 10 2 9 5 4 9 5 7",
"output": "0.891560"
},
{
"input": "44 94 2\n2 4 10 9 5 1 9 8 1 3 6 5 5 9 4 6 6 2 6 2 4 5 7 3 8 6 5 10 2 1 1 9 1 9 3 1 9 6 2 4 9 7 4 6 1 4 5 2 7 8 2 1 1 1 4 2 5 5 5 8 2 8 2 1 1 8 1 7 7 7 1 2 5 3 8 9 8 7 2 10 5 2 2 8 9 1 4 7 7 2 6 2 8 5",
"output": "0.259627"
},
{
"input": "44 35 7\n10 2 2 6 4 2 8 3 10 1 9 9 7 9 10 6 6 1 4 5 7 4 9 7 10 10 7 9 6 1 7 7 2 10 7",
"output": "0.793743"
},
{
"input": "27 47 44\n8 5 2 5 10 6 7 9 5 10 8 5 9 5 10 5 10 8 5 1 1 2 2 10 3 2 5 9 6 3 3 1 5 4 10 5 2 2 4 4 4 4 4 1 1 3 7",
"output": "0.000000"
},
{
"input": "21 67 49\n4 4 3 5 7 5 10 2 8 5 2 2 6 3 6 2 8 6 2 6 2 9 3 3 4 1 9 9 3 3 6 3 6 7 8 9 10 6 10 5 1 5 2 3 3 9 10 5 10 7 1 6 4 5 4 7 8 5 4 2 9 3 3 5 7 1 10",
"output": "0.414860"
},
{
"input": "42 71 67\n2 1 4 1 10 5 1 8 8 5 2 1 1 7 2 2 8 10 8 2 10 8 2 2 9 6 5 10 7 1 7 2 10 3 5 6 10 10 4 6 10 5 6 6 9 4 1 6 1 8 10 6 1 5 3 2 4 1 8 5 10 10 9 3 10 7 5 9 1 9 3",
"output": "0.362240"
},
{
"input": "50 93 28\n2 5 9 5 5 8 1 3 9 2 7 10 3 1 10 10 8 5 2 7 5 4 3 9 5 2 8 9 10 8 2 7 8 9 8 1 9 8 4 3 3 6 10 10 1 2 10 1 8 10 5 8 5 2 4 1 5 6 9 8 6 7 4 6 6 1 5 1 4 6 8 4 1 7 2 8 7 5 1 3 3 7 4 2 1 5 7 5 8 3 8 7 2",
"output": "0.563739"
},
{
"input": "33 90 4\n5 10 2 3 9 6 9 3 3 8 6 4 8 4 9 3 5 9 5 6 4 1 10 6 4 5 4 5 9 5 7 1 3 9 6 6 5 6 2 4 8 7 8 5 4 5 10 9 3 1 1 8 6 9 5 1 5 9 4 6 6 4 9 4 5 7 3 7 9 1 5 6 4 1 1 4 2 4 4 2 6 4 5 5 4 9 1 10 2 2",
"output": "0.132213"
},
{
"input": "65 173 136\n26 18 8 11 1 22 44 6 15 22 13 49 30 36 37 41 25 27 9 36 36 1 45 20 7 47 28 30 30 21 33 32 9 11 16 5 19 12 44 40 25 40 32 36 15 34 4 43 28 19 29 33 7 11 18 13 40 18 10 26 1 48 20 38 1 20 34 8 46 8 32 35 16 49 26 36 11 16 4 29 35 44 14 21 22 42 10 1 3 12 35 30 14 45 2 24 32 15 2 28 35 17 48 31 7 26 44 43 37 4 14 26 25 41 18 40 15 32 16 7 40 22 43 8 25 21 35 21 47 45 7 21 50 38 23 13 4 49 10 27 31 38 43 40 10 24 39 35 31 33 9 6 15 18 2 14 20 14 12 12 29 47 9 49 25 17 41 35 9 40 19 50 34",
"output": "0.165731"
},
{
"input": "77 155 26\n15 18 38 46 13 15 43 37 36 28 22 26 9 46 14 32 20 11 8 28 20 42 38 40 31 20 2 43 1 42 25 28 40 47 6 50 42 45 36 28 38 43 31 14 9 22 49 4 41 9 24 35 38 40 19 31 4 9 13 19 15 48 2 34 46 49 41 15 13 29 15 24 15 50 8 26 10 23 24 15 2 46 47 46 25 36 41 29 44 36 24 22 41 7 48 17 42 41 4 46 15 26 48 27 35 19 35 22 47 7 40 1 15 46 6 34 44 6 9 5 29 24 5 25 12 38 46 10 35 12 8 15 1 9 1 16 2 12 24 31 37 49 27 41 33 5 26 48 42 37 20 18 49 40 16",
"output": "0.299854"
},
{
"input": "67 108 14\n33 40 13 10 26 31 27 24 48 1 42 28 38 29 9 28 48 41 12 19 27 50 6 45 46 7 34 47 8 18 40 27 42 4 33 3 10 25 10 29 39 3 5 39 1 17 40 10 6 8 41 50 27 43 40 42 43 25 18 34 6 15 5 9 11 37 13 4 16 25 49 33 14 40 13 16 50 24 4 43 45 12 31 38 40 36 3 4 4 19 18 12 20 44 4 44 8 50 21 5 44 34 9 9 6 39 43 21",
"output": "0.504558"
},
{
"input": "82 135 73\n22 18 8 45 35 8 19 46 40 6 30 40 10 41 43 38 41 40 1 43 19 23 5 13 29 16 30 9 4 42 42 3 24 16 21 26 5 4 24 24 31 30 1 10 45 50 33 21 21 47 42 37 47 15 30 23 4 2 28 15 38 33 45 30 31 32 6 14 6 4 39 12 50 29 26 45 19 12 40 4 33 9 16 12 44 36 47 42 43 17 18 12 12 42 45 38 6 10 19 10 14 31 6 21 2 15 21 26 5 3 3 6 6 22 44 48 9 11 33 31 34 43 39 40 48 26 1 29 48 11 22 38 23 11 20",
"output": "0.706768"
},
{
"input": "73 121 102\n11 21 12 1 48 30 22 42 42 35 33 12 23 11 27 15 50 49 24 2 48 2 21 32 16 48 36 26 32 13 38 46 36 15 27 24 7 21 43 49 19 13 3 41 35 17 5 22 42 19 37 20 40 42 11 31 48 16 21 5 42 23 29 44 9 30 46 21 44 27 9 17 39 24 30 33 48 3 43 18 16 18 17 46 19 26 37 5 24 36 42 12 18 29 7 49 1 9 27 12 21 29 19 38 6 19 43 46 33 42 9 30 19 38 25 10 44 23 50 25 46",
"output": "0.470538"
},
{
"input": "50 113 86\n2 17 43 22 48 40 42 47 32 29 10 4 9 14 20 50 8 29 12 11 50 41 3 22 30 4 48 37 27 19 50 50 23 34 13 21 3 36 31 39 22 27 7 21 31 21 14 18 36 19 27 42 19 8 5 41 7 8 22 40 38 32 44 25 21 48 4 12 10 16 23 30 25 41 16 45 3 26 19 34 34 25 26 6 9 21 46 33 36 45 3 13 28 44 30 29 22 41 20 1 20 38 4 33 36 15 41 18 13 11 13 18 6",
"output": "0.298885"
},
{
"input": "74 146 112\n10 31 40 32 9 17 31 26 32 7 20 18 50 10 15 28 6 41 21 27 11 5 14 36 48 45 10 42 45 40 4 11 41 23 47 31 34 4 42 49 48 9 37 34 25 27 30 27 44 33 30 25 22 13 25 41 8 34 32 22 11 12 32 9 37 9 42 7 37 13 20 40 28 26 2 6 2 49 41 46 11 9 32 18 43 28 39 48 45 36 18 10 28 35 26 5 20 12 16 2 34 28 31 13 18 39 40 1 39 12 33 31 1 31 46 1 47 38 39 49 32 12 2 8 16 27 48 41 16 27 38 42 21 27 26 8 31 41 20 43 47 5 39 25 47 34",
"output": "0.437111"
},
{
"input": "78 124 41\n5 28 46 46 13 48 36 2 28 31 31 12 9 28 40 35 34 50 50 30 17 11 6 36 16 30 29 8 18 16 21 8 15 30 29 20 12 5 29 20 11 44 12 42 49 10 11 7 25 15 2 38 30 29 17 34 4 5 44 49 25 15 16 33 26 8 8 34 21 9 33 16 14 8 43 50 45 17 15 43 44 22 37 36 22 47 6 13 49 48 37 44 50 9 35 13 38 31 15 6 35 48 22 14 18 8 40 18 4 23 2 26 41 41 27 40 43 33 2 17 11 40 42 32",
"output": "0.218709"
},
{
"input": "51 153 26\n19 32 28 7 25 50 22 31 29 39 5 4 28 26 24 1 19 23 36 2 50 50 33 28 15 17 31 35 10 40 16 7 6 43 50 29 20 25 31 37 10 18 38 38 44 30 36 47 37 6 16 48 41 49 14 16 30 7 29 42 36 8 31 37 26 15 43 42 32 3 46 12 16 37 33 12 18 16 15 14 46 11 2 50 34 34 34 32 28 24 44 12 9 38 35 12 11 15 2 6 28 35 14 46 25 30 9 1 26 5 35 26 4 32 2 30 36 29 22 4 5 1 44 38 6 48 48 6 43 45 24 19 44 18 37 18 40 45 25 35 20 27 21 29 43 18 26 46 22 39 29 41 1",
"output": "0.183488"
},
{
"input": "100 10 5\n10 8 7 5 8 1 2 4 3 10",
"output": "-1"
},
{
"input": "100 10 8\n1 8 9 7 6 4 4 6 8 5",
"output": "-1"
},
{
"input": "1 1 1\n1",
"output": "0.000000"
},
{
"input": "1 1 1\n2",
"output": "0.000000"
},
{
"input": "1 1 1\n100",
"output": "0.000000"
},
{
"input": "100 1 1\n100",
"output": "1"
},
{
"input": "99 1 1\n100",
"output": "1"
},
{
"input": "100 2 1\n100 1",
"output": "1"
}
] | 1,617,103,572 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 10 | 108 | 2,355,200 | n,m,h=map(int,input().split())
s=list(map(int,input().split()))
h-=1
s[h]-=1
total=sum(s)
if total < n - 1:
print(-1)
exit(0)
fac=[1 for i in range(total+1)]
for i in range(1,total+1):
fac[i] = i * fac[i-1]
def nck(n,k):
if n < k: return 0
return fac[n] / fac[k] / fac[n-k]
print(1 - nck(total - s[h], n - 1) / nck(total, n - 1))
| Title: Basketball Team
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
As a German University in Cairo (GUC) student and a basketball player, Herr Wafa was delighted once he heard the news. GUC is finally participating in the Annual Basketball Competition (ABC).
A team is to be formed of *n* players, all of which are GUC students. However, the team might have players belonging to different departments. There are *m* departments in GUC, numbered from 1 to *m*. Herr Wafa's department has number *h*. For each department *i*, Herr Wafa knows number *s**i* — how many students who play basketball belong to this department.
Herr Wafa was also able to guarantee a spot on the team, using his special powers. But since he hates floating-point numbers, he needs your help at finding the probability that he will have at least one teammate belonging to his department.
Note that every possible team containing Herr Wafa is equally probable. Consider all the students different from each other.
Input Specification:
The first line contains three integers *n*, *m* and *h* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=1000,<=1<=≤<=*h*<=≤<=*m*) — the number of players on the team, the number of departments in GUC and Herr Wafa's department, correspondingly.
The second line contains a single-space-separated list of *m* integers *s**i* (1<=≤<=*s**i*<=≤<=100), denoting the number of students in the *i*-th department. Note that *s**h* includes Herr Wafa.
Output Specification:
Print the probability that Herr Wafa will have at least one teammate from his department. If there is not enough basketball players in GUC to participate in ABC, print -1. The answer will be accepted if it has absolute or relative error not exceeding 10<=-<=6.
Demo Input:
['3 2 1\n2 1\n', '3 2 1\n1 1\n', '3 2 1\n2 2\n']
Demo Output:
['1\n', '-1\n', '0.666667\n']
Note:
In the first example all 3 players (2 from department 1 and 1 from department 2) must be chosen for the team. Both players from Wafa's departments will be chosen, so he's guaranteed to have a teammate from his department.
In the second example, there are not enough players.
In the third example, there are three possibilities to compose the team containing Herr Wafa. In two of them the other player from Herr Wafa's department is part of the team. | ```python
n,m,h=map(int,input().split())
s=list(map(int,input().split()))
h-=1
s[h]-=1
total=sum(s)
if total < n - 1:
print(-1)
exit(0)
fac=[1 for i in range(total+1)]
for i in range(1,total+1):
fac[i] = i * fac[i-1]
def nck(n,k):
if n < k: return 0
return fac[n] / fac[k] / fac[n-k]
print(1 - nck(total - s[h], n - 1) / nck(total, n - 1))
``` | -1 |
155 | A | I_love_\%username\% | PROGRAMMING | 800 | [
"brute force"
] | null | null | Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him. | The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000. | Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests. | [
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] | [
"2\n",
"4\n"
] | In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing. | 500 | [
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,688,516,521 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 62 | 0 | import sys
def read_input():
return sys.stdin.readline().rstrip()
def read_ints():
return map(int, read_input().split())
num1 = int(read_input())
list1 = list(read_ints())
num2 = 0
num3 = 0
for x in range(num1):
if x == num1 - 1:
break
elif list1[x] < list1[x+1]:
num2 += 1
else:
num3 += 1
if num2 == 0:
print(num3)
else:
print(num2) | Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing. | ```python
import sys
def read_input():
return sys.stdin.readline().rstrip()
def read_ints():
return map(int, read_input().split())
num1 = int(read_input())
list1 = list(read_ints())
num2 = 0
num3 = 0
for x in range(num1):
if x == num1 - 1:
break
elif list1[x] < list1[x+1]:
num2 += 1
else:
num3 += 1
if num2 == 0:
print(num3)
else:
print(num2)
``` | 0 | |
431 | A | Black Square | PROGRAMMING | 800 | [
"implementation"
] | null | null | Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares? | The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104).
The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip. | Print a single integer — the total number of calories that Jury wastes. | [
"1 2 3 4\n123214\n",
"1 5 3 2\n11221\n"
] | [
"13\n",
"13\n"
] | none | 500 | [
{
"input": "1 2 3 4\n123214",
"output": "13"
},
{
"input": "1 5 3 2\n11221",
"output": "13"
},
{
"input": "5 5 5 1\n3422",
"output": "16"
},
{
"input": "4 3 2 1\n2",
"output": "3"
},
{
"input": "5651 6882 6954 4733\n2442313421",
"output": "60055"
},
{
"input": "0 0 0 0\n4132",
"output": "0"
},
{
"input": "3163 5778 83 7640\n11141442444",
"output": "64270"
},
{
"input": "1809 1302 7164 6122\n3144121413113111223311232232114144321414421243443243422322144324121433444342231344234443332241322442",
"output": "420780"
},
{
"input": "0 0 0 0\n1",
"output": "0"
},
{
"input": "1 2 3 4\n4",
"output": "4"
},
{
"input": "2343 7653 1242 5432\n1",
"output": "2343"
},
{
"input": "2343 7653 1242 5432\n2",
"output": "7653"
},
{
"input": "2343 7653 1242 5432\n3",
"output": "1242"
},
{
"input": "2343 7653 1242 5432\n4",
"output": "5432"
},
{
"input": "1 2 3 4\n123412",
"output": "13"
},
{
"input": "50 50 50 50\n11111111111111111111111111111111111111111111111111111",
"output": "2650"
},
{
"input": "1 2 3 4\n11111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "1 2 3 4\n23123231321231231231231231221232123121312321",
"output": "87"
},
{
"input": "1 2 3 4\n1111111111111222222222233333333333444444444444444",
"output": "126"
},
{
"input": "2 3 1 4\n121321232412342112312313213123123412131231231232",
"output": "105"
}
] | 1,663,525,684 | 2,147,483,647 | Python 3 | OK | TESTS | 49 | 78 | 0 | caloriesPerStrip = list(map(int,input().split(" ")))
strips = input()
calories = 0
for i in strips:
index = int(i) - 1
calories += caloriesPerStrip[index]
print(calories) | Title: Black Square
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Quite recently, a very smart student named Jury decided that lectures are boring, so he downloaded a game called "Black Square" on his super cool touchscreen phone.
In this game, the phone's screen is divided into four vertical strips. Each second, a black square appears on some of the strips. According to the rules of the game, Jury must use this second to touch the corresponding strip to make the square go away. As Jury is both smart and lazy, he counted that he wastes exactly *a**i* calories on touching the *i*-th strip.
You've got a string *s*, describing the process of the game and numbers *a*1,<=*a*2,<=*a*3,<=*a*4. Calculate how many calories Jury needs to destroy all the squares?
Input Specification:
The first line contains four space-separated integers *a*1, *a*2, *a*3, *a*4 (0<=≤<=*a*1,<=*a*2,<=*a*3,<=*a*4<=≤<=104).
The second line contains string *s* (1<=≤<=|*s*|<=≤<=105), where the *і*-th character of the string equals "1", if on the *i*-th second of the game the square appears on the first strip, "2", if it appears on the second strip, "3", if it appears on the third strip, "4", if it appears on the fourth strip.
Output Specification:
Print a single integer — the total number of calories that Jury wastes.
Demo Input:
['1 2 3 4\n123214\n', '1 5 3 2\n11221\n']
Demo Output:
['13\n', '13\n']
Note:
none | ```python
caloriesPerStrip = list(map(int,input().split(" ")))
strips = input()
calories = 0
for i in strips:
index = int(i) - 1
calories += caloriesPerStrip[index]
print(calories)
``` | 3 | |
26 | B | Regular Bracket Sequence | PROGRAMMING | 1,400 | [
"greedy"
] | B. Regular Bracket Sequence | 5 | 256 | A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained? | Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106. | Output the maximum possible length of a regular bracket sequence. | [
"(()))(\n",
"((()())\n"
] | [
"4\n",
"6\n"
] | none | 1,000 | [
{
"input": "(()))(",
"output": "4"
},
{
"input": "((()())",
"output": "6"
},
{
"input": "(",
"output": "0"
},
{
"input": ")",
"output": "0"
},
{
"input": ")(()(",
"output": "2"
},
{
"input": "))))))(",
"output": "0"
},
{
"input": "()()(()(((",
"output": "6"
},
{
"input": "()))(()((((()(())",
"output": "10"
},
{
"input": "())))((()())())))))())",
"output": "14"
},
{
"input": ")))((((())(()((()((((()()())((",
"output": "16"
},
{
"input": "))()()((()()))())()(((((((())((((((((())()()((())(",
"output": "32"
},
{
"input": "))())))))))())))))()()))()()))))())))))()))))))))))))(()))())(()))))(()))))())))((((()()))))()))()))",
"output": "48"
}
] | 1,671,243,915 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 38 | 654 | 97,484,800 | a = list(input())
ans = 0
stack = []
for x in a:
if x == "(":
stack.append("(")
else:
if len(stack) == 0:
pass
else:
stack.pop()
ans += 1
print(ans*2) | Title: Regular Bracket Sequence
Time Limit: 5 seconds
Memory Limit: 256 megabytes
Problem Description:
A bracket sequence is called regular if it is possible to obtain correct arithmetic expression by inserting characters «+» and «1» into this sequence. For example, sequences «(())()», «()» and «(()(()))» are regular, while «)(», «(()» and «(()))(» are not.
One day Johnny got bracket sequence. He decided to remove some of the brackets from it in order to obtain a regular bracket sequence. What is the maximum length of a regular bracket sequence which can be obtained?
Input Specification:
Input consists of a single line with non-empty string of «(» and «)» characters. Its length does not exceed 106.
Output Specification:
Output the maximum possible length of a regular bracket sequence.
Demo Input:
['(()))(\n', '((()())\n']
Demo Output:
['4\n', '6\n']
Note:
none | ```python
a = list(input())
ans = 0
stack = []
for x in a:
if x == "(":
stack.append("(")
else:
if len(stack) == 0:
pass
else:
stack.pop()
ans += 1
print(ans*2)
``` | 3.75302 |
701 | A | Cards | PROGRAMMING | 800 | [
"greedy",
"implementation"
] | null | null | There are *n* cards (*n* is even) in the deck. Each card has a positive integer written on it. *n*<=/<=2 people will play new card game. At the beginning of the game each player gets two cards, each card is given to exactly one player.
Find the way to distribute cards such that the sum of values written of the cards will be equal for each player. It is guaranteed that it is always possible. | The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100) — the number of cards in the deck. It is guaranteed that *n* is even.
The second line contains the sequence of *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is equal to the number written on the *i*-th card. | Print *n*<=/<=2 pairs of integers, the *i*-th pair denote the cards that should be given to the *i*-th player. Each card should be given to exactly one player. Cards are numbered in the order they appear in the input.
It is guaranteed that solution exists. If there are several correct answers, you are allowed to print any of them. | [
"6\n1 5 7 4 4 3\n",
"4\n10 10 10 10\n"
] | [
"1 3\n6 2\n4 5\n",
"1 2\n3 4\n"
] | In the first sample, cards are distributed in such a way that each player has the sum of numbers written on his cards equal to 8.
In the second sample, all values *a*<sub class="lower-index">*i*</sub> are equal. Thus, any distribution is acceptable. | 500 | [
{
"input": "6\n1 5 7 4 4 3",
"output": "1 3\n6 2\n4 5"
},
{
"input": "4\n10 10 10 10",
"output": "1 4\n2 3"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51"
},
{
"input": "4\n82 46 8 44",
"output": "3 1\n4 2"
},
{
"input": "2\n35 50",
"output": "1 2"
},
{
"input": "8\n24 39 49 38 44 64 44 50",
"output": "1 6\n4 8\n2 3\n5 7"
},
{
"input": "100\n23 44 35 88 10 78 8 84 46 19 69 36 81 60 46 12 53 22 83 73 6 18 80 14 54 39 74 42 34 20 91 70 32 11 80 53 70 21 24 12 87 68 35 39 8 84 81 70 8 54 73 2 60 71 4 33 65 48 69 58 55 57 78 61 45 50 55 72 86 37 5 11 12 81 32 19 22 11 22 82 23 56 61 84 47 59 31 38 31 90 57 1 24 38 68 27 80 9 37 14",
"output": "92 31\n52 90\n55 4\n71 41\n21 69\n7 84\n45 46\n49 8\n98 19\n5 80\n34 74\n72 47\n78 13\n16 97\n40 35\n73 23\n24 63\n100 6\n22 27\n10 51\n76 20\n30 68\n38 54\n18 48\n77 37\n79 32\n1 59\n81 11\n39 95\n93 42\n96 57\n87 83\n89 64\n33 53\n75 14\n56 86\n29 60\n3 91\n43 62\n12 82\n70 67\n99 61\n88 50\n94 25\n26 36\n44 17\n28 66\n2 58\n65 85\n9 15"
},
{
"input": "12\n22 83 2 67 55 12 40 93 83 73 12 28",
"output": "3 8\n6 9\n11 2\n1 10\n12 4\n7 5"
},
{
"input": "16\n10 33 36 32 48 25 31 27 45 13 37 26 22 21 15 43",
"output": "1 5\n10 9\n15 16\n14 11\n13 3\n6 2\n12 4\n8 7"
},
{
"input": "20\n18 13 71 60 28 10 20 65 65 12 13 14 64 68 6 50 72 7 66 58",
"output": "15 17\n18 3\n6 14\n10 19\n2 9\n11 8\n12 13\n1 4\n7 20\n5 16"
},
{
"input": "24\n59 39 25 22 46 21 24 70 60 11 46 42 44 37 13 37 41 58 72 23 25 61 58 62",
"output": "10 19\n15 8\n6 24\n4 22\n20 9\n7 1\n3 23\n21 18\n14 11\n16 5\n2 13\n17 12"
},
{
"input": "28\n22 1 51 31 83 35 3 64 59 10 61 25 19 53 55 80 78 8 82 22 67 4 27 64 33 6 85 76",
"output": "2 27\n7 5\n22 19\n26 16\n18 17\n10 28\n13 21\n1 24\n20 8\n12 11\n23 9\n4 15\n25 14\n6 3"
},
{
"input": "32\n41 42 22 68 40 52 66 16 73 25 41 21 36 60 46 30 24 55 35 10 54 52 70 24 20 56 3 34 35 6 51 8",
"output": "27 9\n30 23\n32 4\n20 7\n8 14\n25 26\n12 18\n3 21\n17 22\n24 6\n10 31\n16 15\n28 2\n19 11\n29 1\n13 5"
},
{
"input": "36\n1 10 61 43 27 49 55 33 7 30 45 78 69 34 38 19 36 49 55 11 30 63 46 24 16 68 71 18 11 52 72 24 60 68 8 41",
"output": "1 12\n9 31\n35 27\n2 13\n20 34\n29 26\n25 22\n28 3\n16 33\n24 19\n32 7\n5 30\n10 18\n21 6\n8 23\n14 11\n17 4\n15 36"
},
{
"input": "40\n7 30 13 37 37 56 45 28 61 28 23 33 44 63 58 52 21 2 42 19 10 32 9 7 61 15 58 20 45 4 46 24 35 17 50 4 20 48 41 55",
"output": "18 14\n30 25\n36 9\n1 27\n24 15\n23 6\n21 40\n3 16\n26 35\n34 38\n20 31\n28 29\n37 7\n17 13\n11 19\n32 39\n8 5\n10 4\n2 33\n22 12"
},
{
"input": "44\n7 12 46 78 24 68 86 22 71 79 85 14 58 72 26 46 54 39 35 13 31 45 81 21 15 8 47 64 69 87 57 6 18 80 47 29 36 62 34 67 59 48 75 25",
"output": "32 30\n1 7\n26 11\n2 23\n20 34\n12 10\n25 4\n33 43\n24 14\n8 9\n5 29\n44 6\n15 40\n36 28\n21 38\n39 41\n19 13\n37 31\n18 17\n22 42\n3 35\n16 27"
},
{
"input": "48\n57 38 16 25 34 57 29 38 60 51 72 78 22 39 10 33 20 16 12 3 51 74 9 88 4 70 56 65 86 18 33 12 77 78 52 87 68 85 81 5 61 2 52 39 80 13 74 30",
"output": "42 24\n20 36\n25 29\n40 38\n23 39\n15 45\n19 34\n32 12\n46 33\n3 47\n18 22\n30 11\n17 26\n13 37\n4 28\n7 41\n48 9\n16 6\n31 1\n5 27\n2 43\n8 35\n14 21\n44 10"
},
{
"input": "52\n57 12 13 40 68 31 18 4 31 18 65 3 62 32 6 3 49 48 51 33 53 40 9 32 47 53 58 19 14 23 32 38 39 69 19 20 62 52 68 17 39 22 54 59 3 2 52 9 67 68 24 39",
"output": "46 34\n12 50\n16 39\n45 5\n8 49\n15 11\n23 37\n48 13\n2 44\n3 27\n29 1\n40 43\n7 26\n10 21\n28 47\n35 38\n36 19\n42 17\n30 18\n51 25\n6 22\n9 4\n14 52\n24 41\n31 33\n20 32"
},
{
"input": "56\n53 59 66 68 71 25 48 32 12 61 72 69 30 6 56 55 25 49 60 47 46 46 66 19 31 9 23 15 10 12 71 53 51 32 39 31 66 66 17 52 12 7 7 22 49 12 71 29 63 7 47 29 18 39 27 26",
"output": "14 11\n42 47\n43 31\n50 5\n26 12\n29 4\n9 38\n30 37\n41 23\n46 3\n28 49\n39 10\n53 19\n24 2\n44 15\n27 16\n6 32\n17 1\n56 40\n55 33\n48 45\n52 18\n13 7\n25 51\n36 20\n8 22\n34 21\n35 54"
},
{
"input": "60\n47 63 20 68 46 12 45 44 14 38 28 73 60 5 20 18 70 64 37 47 26 47 37 61 29 61 23 28 30 68 55 22 25 60 38 7 63 12 38 15 14 30 11 5 70 15 53 52 7 57 49 45 55 37 45 28 50 2 31 30",
"output": "58 12\n14 45\n44 17\n36 30\n49 4\n43 18\n6 37\n38 2\n9 26\n41 24\n40 34\n46 13\n16 50\n3 53\n15 31\n32 47\n27 48\n33 57\n21 51\n11 22\n28 20\n56 1\n25 5\n29 55\n42 52\n60 7\n59 8\n19 39\n23 35\n54 10"
},
{
"input": "64\n63 39 19 5 48 56 49 45 29 68 25 59 37 69 62 26 60 44 60 6 67 68 2 40 56 6 19 12 17 70 23 11 59 37 41 55 30 68 72 14 38 34 3 71 2 4 55 15 31 66 15 51 36 72 18 7 6 14 43 33 8 35 57 18",
"output": "23 54\n45 39\n43 44\n46 30\n4 14\n20 38\n26 22\n57 10\n56 21\n61 50\n32 1\n28 15\n40 19\n58 17\n48 33\n51 12\n29 63\n55 25\n64 6\n3 47\n27 36\n31 52\n11 7\n16 5\n9 8\n37 18\n49 59\n60 35\n42 24\n62 2\n53 41\n13 34"
},
{
"input": "68\n58 68 40 55 62 15 10 54 19 18 69 27 15 53 8 18 8 33 15 49 20 9 70 8 18 64 14 59 9 64 3 35 46 11 5 65 58 55 28 58 4 55 64 5 68 24 4 58 23 45 58 50 38 68 5 15 20 9 5 53 20 63 69 68 15 53 65 65",
"output": "31 23\n41 63\n47 11\n35 64\n44 54\n55 45\n59 2\n15 68\n17 67\n24 36\n22 43\n29 30\n58 26\n7 62\n34 5\n27 28\n6 51\n13 48\n19 40\n56 37\n65 1\n10 42\n16 38\n25 4\n9 8\n21 66\n57 60\n61 14\n49 52\n46 20\n12 33\n39 50\n18 3\n32 53"
},
{
"input": "72\n61 13 55 23 24 55 44 33 59 19 14 17 66 40 27 33 29 37 28 74 50 56 59 65 64 17 42 56 73 51 64 23 22 26 38 22 36 47 60 14 52 28 14 12 6 41 73 5 64 67 61 74 54 34 45 34 44 4 34 49 18 72 44 47 31 19 11 31 5 4 45 50",
"output": "58 52\n70 20\n48 47\n69 29\n45 62\n67 50\n44 13\n2 24\n11 49\n40 31\n43 25\n12 51\n26 1\n61 39\n10 23\n66 9\n33 28\n36 22\n4 6\n32 3\n5 53\n34 41\n15 30\n19 72\n42 21\n17 60\n65 64\n68 38\n8 71\n16 55\n54 63\n56 57\n59 7\n37 27\n18 46\n35 14"
},
{
"input": "76\n73 37 73 67 26 45 43 74 47 31 43 81 4 3 39 79 48 81 67 39 67 66 43 67 80 51 34 79 5 58 45 10 39 50 9 78 6 18 75 17 45 17 51 71 34 53 33 11 17 15 11 69 50 41 13 74 10 33 77 41 11 64 36 74 17 32 3 10 27 20 5 73 52 41 7 57",
"output": "14 18\n67 12\n13 25\n29 28\n71 16\n37 36\n75 59\n35 39\n32 64\n57 56\n68 8\n48 72\n51 3\n61 1\n55 44\n50 52\n40 24\n42 21\n49 19\n65 4\n38 22\n70 62\n5 30\n69 76\n10 46\n66 73\n47 43\n58 26\n27 53\n45 34\n63 17\n2 9\n15 41\n20 31\n33 6\n54 23\n60 11\n74 7"
},
{
"input": "80\n18 38 65 1 20 9 57 2 36 26 15 17 33 61 65 27 10 35 49 42 40 32 19 33 12 36 56 31 10 41 8 54 56 60 5 47 61 43 23 19 20 30 7 6 38 60 29 58 35 64 30 51 6 17 30 24 47 1 37 47 34 36 48 28 5 25 47 19 30 39 36 23 31 28 46 46 59 43 19 49",
"output": "4 15\n58 3\n8 50\n35 37\n65 14\n44 46\n53 34\n43 77\n31 48\n6 7\n17 33\n29 27\n25 32\n11 52\n12 80\n54 19\n1 63\n23 67\n40 60\n68 57\n79 36\n5 76\n41 75\n39 78\n72 38\n56 20\n66 30\n10 21\n16 70\n64 45\n74 2\n47 59\n42 71\n51 62\n55 26\n69 9\n28 49\n73 18\n22 61\n13 24"
},
{
"input": "84\n59 41 54 14 42 55 29 28 41 73 40 15 1 1 66 49 76 59 68 60 42 81 19 23 33 12 80 81 42 22 54 54 2 22 22 28 27 60 36 57 17 76 38 20 40 65 23 9 81 50 25 13 46 36 59 53 6 35 47 40 59 19 67 46 63 49 12 33 23 49 33 23 32 62 60 70 44 1 6 63 28 16 70 69",
"output": "13 49\n14 28\n78 22\n33 27\n57 42\n79 17\n48 10\n26 83\n67 76\n52 84\n4 19\n12 63\n82 15\n41 46\n23 80\n62 65\n44 74\n30 75\n34 38\n35 20\n24 61\n47 55\n69 18\n72 1\n51 40\n37 6\n8 32\n36 31\n81 3\n7 56\n73 50\n25 70\n68 66\n71 16\n58 59\n39 64\n54 53\n43 77\n11 29\n45 21\n60 5\n2 9"
},
{
"input": "88\n10 28 71 6 58 66 45 52 13 71 39 1 10 29 30 70 14 17 15 38 4 60 5 46 66 41 40 58 2 57 32 44 21 26 13 40 64 63 56 33 46 8 30 43 67 55 44 28 32 62 14 58 42 67 45 59 32 68 10 31 51 6 42 34 9 12 51 27 20 14 62 42 16 5 1 14 30 62 40 59 58 26 25 15 27 47 21 57",
"output": "12 10\n75 3\n29 16\n21 58\n23 54\n74 45\n4 25\n62 6\n42 37\n65 38\n1 78\n13 71\n59 50\n66 22\n9 80\n35 56\n17 81\n51 52\n70 28\n76 5\n19 88\n84 30\n73 39\n18 46\n69 8\n33 67\n87 61\n83 86\n34 41\n82 24\n68 55\n85 7\n2 47\n48 32\n14 44\n15 72\n43 63\n77 53\n60 26\n31 79\n49 36\n57 27\n40 11\n64 20"
},
{
"input": "92\n17 37 81 15 29 70 73 42 49 23 44 77 27 44 74 11 43 66 15 41 60 36 33 11 2 76 16 51 45 21 46 16 85 29 76 79 16 6 60 13 25 44 62 28 43 35 63 24 76 71 62 15 57 72 45 10 71 59 74 14 53 13 58 72 14 72 73 11 25 1 57 42 86 63 50 30 64 38 10 77 75 24 58 8 54 12 43 30 27 71 52 34",
"output": "70 73\n25 33\n38 3\n84 36\n56 80\n79 12\n16 49\n24 35\n68 26\n86 81\n40 59\n62 15\n60 67\n65 7\n4 66\n19 64\n52 54\n27 90\n32 57\n37 50\n1 6\n30 18\n10 77\n48 74\n82 47\n41 51\n69 43\n13 39\n89 21\n44 58\n5 83\n34 63\n76 71\n88 53\n23 85\n92 61\n46 91\n22 28\n2 75\n78 9\n20 31\n8 55\n72 29\n17 42\n45 14\n87 11"
},
{
"input": "96\n77 7 47 19 73 31 46 13 89 69 52 9 26 77 6 87 55 45 71 2 79 1 80 20 4 82 64 20 75 86 84 24 77 56 16 54 53 35 74 73 40 29 63 20 83 39 58 16 31 41 40 16 11 90 30 48 62 39 55 8 50 3 77 73 75 66 14 90 18 54 38 10 53 22 67 38 27 91 62 37 85 13 92 7 18 83 10 3 86 54 80 59 34 16 39 43",
"output": "22 83\n20 78\n62 68\n88 54\n25 9\n15 16\n2 89\n84 30\n60 81\n12 31\n72 86\n87 45\n53 26\n8 91\n82 23\n67 21\n35 63\n48 33\n52 14\n94 1\n69 65\n85 29\n4 39\n24 64\n28 40\n44 5\n74 19\n32 10\n13 75\n77 66\n42 27\n55 43\n6 79\n49 57\n93 92\n38 47\n80 34\n71 59\n76 17\n46 90\n58 70\n95 36\n41 73\n51 37\n50 11\n96 61\n18 56\n7 3"
},
{
"input": "4\n100 100 1 1",
"output": "3 2\n4 1"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1 100\n2 99\n3 98\n4 97\n5 96\n6 95\n7 94\n8 93\n9 92\n10 91\n11 90\n12 89\n13 88\n14 87\n15 86\n16 85\n17 84\n18 83\n19 82\n20 81\n21 80\n22 79\n23 78\n24 77\n25 76\n26 75\n27 74\n28 73\n29 72\n30 71\n31 70\n32 69\n33 68\n34 67\n35 66\n36 65\n37 64\n38 63\n39 62\n40 61\n41 60\n42 59\n43 58\n44 57\n45 56\n46 55\n47 54\n48 53\n49 52\n50 51"
},
{
"input": "4\n3 4 4 5",
"output": "1 4\n2 3"
},
{
"input": "4\n1 1 2 2",
"output": "1 4\n2 3"
},
{
"input": "4\n1 2 3 4",
"output": "1 4\n2 3"
}
] | 1,598,981,813 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 108 | 307,200 | n = int(input())
a = [int(s) for s in input().split(' ')]
taken = []
for i in range(n):
if i + 1 not in taken:
for j in range(i + 1, n):
if j + 1 not in taken and a[i] + a[j] == 2 * sum(a) // n:
taken.append(i + 1)
taken.append(j + 1)
for i in range(n // 2):
print(taken[2 * i], taken[2*i + 1])
| Title: Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cards (*n* is even) in the deck. Each card has a positive integer written on it. *n*<=/<=2 people will play new card game. At the beginning of the game each player gets two cards, each card is given to exactly one player.
Find the way to distribute cards such that the sum of values written of the cards will be equal for each player. It is guaranteed that it is always possible.
Input Specification:
The first line of the input contains integer *n* (2<=≤<=*n*<=≤<=100) — the number of cards in the deck. It is guaranteed that *n* is even.
The second line contains the sequence of *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100), where *a**i* is equal to the number written on the *i*-th card.
Output Specification:
Print *n*<=/<=2 pairs of integers, the *i*-th pair denote the cards that should be given to the *i*-th player. Each card should be given to exactly one player. Cards are numbered in the order they appear in the input.
It is guaranteed that solution exists. If there are several correct answers, you are allowed to print any of them.
Demo Input:
['6\n1 5 7 4 4 3\n', '4\n10 10 10 10\n']
Demo Output:
['1 3\n6 2\n4 5\n', '1 2\n3 4\n']
Note:
In the first sample, cards are distributed in such a way that each player has the sum of numbers written on his cards equal to 8.
In the second sample, all values *a*<sub class="lower-index">*i*</sub> are equal. Thus, any distribution is acceptable. | ```python
n = int(input())
a = [int(s) for s in input().split(' ')]
taken = []
for i in range(n):
if i + 1 not in taken:
for j in range(i + 1, n):
if j + 1 not in taken and a[i] + a[j] == 2 * sum(a) // n:
taken.append(i + 1)
taken.append(j + 1)
for i in range(n // 2):
print(taken[2 * i], taken[2*i + 1])
``` | 0 | |
707 | A | Brain's Photos | PROGRAMMING | 800 | [
"implementation"
] | null | null | Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead.
As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such).
Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour!
As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white.
Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors:
- 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black)
The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored. | The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively.
Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'. | Print the "#Black&White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line. | [
"2 2\nC M\nY Y\n",
"3 2\nW W\nW W\nB B\n",
"1 1\nW\n"
] | [
"#Color",
"#Black&White",
"#Black&White"
] | none | 500 | [
{
"input": "2 2\nC M\nY Y",
"output": "#Color"
},
{
"input": "3 2\nW W\nW W\nB B",
"output": "#Black&White"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "2 3\nW W W\nB G Y",
"output": "#Color"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B",
"output": "#Color"
},
{
"input": "1 6\nC M Y W G B",
"output": "#Color"
},
{
"input": "1 3\nW G B",
"output": "#Black&White"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B",
"output": "#Black&White"
},
{
"input": "2 3\nW W W\nB G C",
"output": "#Color"
},
{
"input": "2 3\nW W W\nB G M",
"output": "#Color"
},
{
"input": "3 3\nC B W\nB Y M\nB B W",
"output": "#Color"
},
{
"input": "1 3\nW C W",
"output": "#Color"
},
{
"input": "3 3\nB W B\nB C W\nB W W",
"output": "#Color"
},
{
"input": "1 2\nW Y",
"output": "#Color"
},
{
"input": "1 1\nG",
"output": "#Black&White"
},
{
"input": "1 3\nB G W",
"output": "#Black&White"
},
{
"input": "2 2\nW W\nB C",
"output": "#Color"
},
{
"input": "1 1\nM",
"output": "#Color"
},
{
"input": "1 2\nW C",
"output": "#Color"
},
{
"input": "2 3\nW W M\nW W M",
"output": "#Color"
},
{
"input": "3 2\nW W\nW W\nB C",
"output": "#Color"
},
{
"input": "2 3\nW W C\nW W W",
"output": "#Color"
},
{
"input": "1 3\nG G G",
"output": "#Black&White"
},
{
"input": "1 1\nC",
"output": "#Color"
},
{
"input": "1 2\nC W",
"output": "#Color"
},
{
"input": "1 3\nW W C",
"output": "#Color"
},
{
"input": "2 2\nW B\nB G",
"output": "#Black&White"
},
{
"input": "2 2\nB B\nY Y",
"output": "#Color"
},
{
"input": "2 2\nG G\nC C",
"output": "#Color"
},
{
"input": "1 2\nB C",
"output": "#Color"
},
{
"input": "1 4\nG G G C",
"output": "#Color"
},
{
"input": "1 1\nB",
"output": "#Black&White"
},
{
"input": "2 1\nY\nB",
"output": "#Color"
}
] | 1,660,363,569 | 2,147,483,647 | Python 3 | OK | TESTS | 50 | 46 | 0 | n,m=map(int,input().split())
ans='#Black&White'
for i in range(n):
l=input().split()
if 'C' in l or 'M' in l or 'Y' in l:
ans='#Color'
print(ans) | Title: Brain's Photos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead.
As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such).
Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour!
As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white.
Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors:
- 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black)
The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively.
Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Output Specification:
Print the "#Black&White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
Demo Input:
['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n']
Demo Output:
['#Color', '#Black&White', '#Black&White']
Note:
none | ```python
n,m=map(int,input().split())
ans='#Black&White'
for i in range(n):
l=input().split()
if 'C' in l or 'M' in l or 'Y' in l:
ans='#Color'
print(ans)
``` | 3 | |
559 | B | Equivalent Strings | PROGRAMMING | 1,700 | [
"divide and conquer",
"hashing",
"sortings",
"strings"
] | null | null | Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn! | The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length. | Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise. | [
"aaba\nabaa\n",
"aabb\nabab\n"
] | [
"YES\n",
"NO\n"
] | In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa". | 1,000 | [
{
"input": "aaba\nabaa",
"output": "YES"
},
{
"input": "aabb\nabab",
"output": "NO"
},
{
"input": "a\na",
"output": "YES"
},
{
"input": "a\nb",
"output": "NO"
},
{
"input": "ab\nab",
"output": "YES"
},
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "ab\nbb",
"output": "NO"
},
{
"input": "zzaa\naazz",
"output": "YES"
},
{
"input": "azza\nzaaz",
"output": "YES"
},
{
"input": "abc\nabc",
"output": "YES"
},
{
"input": "abc\nacb",
"output": "NO"
},
{
"input": "azzz\nzzaz",
"output": "YES"
},
{
"input": "abcd\ndcab",
"output": "YES"
},
{
"input": "abcd\ncdab",
"output": "YES"
},
{
"input": "abcd\ndcba",
"output": "YES"
},
{
"input": "abcd\nacbd",
"output": "NO"
},
{
"input": "oloaxgddgujq\noloaxgujqddg",
"output": "YES"
},
{
"input": "uwzwdxfmosmqatyv\ndxfmzwwusomqvyta",
"output": "YES"
},
{
"input": "hagnzomowtledfdotnll\nledfdotnllomowthagnz",
"output": "YES"
},
{
"input": "snyaydaeobufdg\nsnyaydaeobufdg",
"output": "YES"
},
{
"input": "baaaaa\nabaaaa",
"output": "NO"
},
{
"input": "hhiisug\nmzdjwju",
"output": "NO"
},
{
"input": "bbbabbabaaab\naaaabbabbbbb",
"output": "NO"
},
{
"input": "bbaaab\naababb",
"output": "NO"
},
{
"input": "aabbaaaa\naaaaabab",
"output": "NO"
},
{
"input": "aab\naba",
"output": "NO"
},
{
"input": "abcddd\nbacddd",
"output": "NO"
},
{
"input": "qgiufelsfhanx\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "aabaababaaba\naababaaababa",
"output": "NO"
},
{
"input": "nocdqzdriyyil\naaaaaaaaaaaaa",
"output": "NO"
},
{
"input": "zdmctxl\nkojqhgw",
"output": "NO"
},
{
"input": "yhwepqwyhwepqwyhwepqweahnqtueahnqtueahnqtuyhwepqwyhwepqwyhwepqwyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtueahnqtueahnqtueahnqtueahnqtu\neahnqtueahnqtueahnqtuyhwepqweahnqtuyhwepqwyhwepqweahnqtuyhwepqweahnqtuyhwepqweahnqtueahnqtuyhwepqweahnqtueahnqtuyhwepqwyhwepqwyhwepqw",
"output": "NO"
},
{
"input": "abc\nbac",
"output": "NO"
},
{
"input": "ottceez\npcstdvz",
"output": "NO"
}
] | 1,595,084,931 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 22 | 436 | 47,411,200 | from sys import stdin, setrecursionlimit, stdout
#setrecursionlimit(1000000) #use "python" instead of "pypy" to avoid MLE
from collections import deque
from math import sqrt, floor, ceil, log, log2, log10, pi, gcd, sin, cos, asin
from heapq import heapify, heappop, heappush, heapreplace, heappushpop
def ii(): return int(stdin.readline())
def fi(): return float(stdin.readline())
def mi(): return map(int, stdin.readline().split())
def fmi(): return map(float, stdin.readline().split())
def li(): return list(mi())
def si(): return stdin.readline().rstrip()
def lsi(): return list(si())
mod=1000000007
res=['YES', 'NO']
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
########################### M Y F U N C T I O N S ###########################
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
def solve(a, b):
if a==b:
return True
l=len(a)//2
if not l:
return False
x, y=a[:l], a[l:]
w, z=b[:l], b[l:]
return (solve(x, w) and solve(y, z)) or (solve(x, z) and solve(y, w))
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
########################### M A I N P R O G R A M ###########################
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
test=1
test_case=1
while test<=test_case:
test+=1
a=lsi()
b=lsi()
print('YES' if solve(a, b) else 'NO') | Title: Equivalent Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today on a lecture about strings Gerald learned a new definition of string equivalency. Two strings *a* and *b* of equal length are called equivalent in one of the two cases:
1. They are equal. 1. If we split string *a* into two halves of the same size *a*1 and *a*2, and string *b* into two halves of the same size *b*1 and *b*2, then one of the following is correct: *a*1 is equivalent to *b*1, and *a*2 is equivalent to *b*2 1. *a*1 is equivalent to *b*2, and *a*2 is equivalent to *b*1
As a home task, the teacher gave two strings to his students and asked to determine if they are equivalent.
Gerald has already completed this home task. Now it's your turn!
Input Specification:
The first two lines of the input contain two strings given by the teacher. Each of them has the length from 1 to 200<=000 and consists of lowercase English letters. The strings have the same length.
Output Specification:
Print "YES" (without the quotes), if these two strings are equivalent, and "NO" (without the quotes) otherwise.
Demo Input:
['aaba\nabaa\n', 'aabb\nabab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you should split the first string into strings "aa" and "ba", the second one — into strings "ab" and "aa". "aa" is equivalent to "aa"; "ab" is equivalent to "ba" as "ab" = "a" + "b", "ba" = "b" + "a".
In the second sample the first string can be splitted into strings "aa" and "bb", that are equivalent only to themselves. That's why string "aabb" is equivalent only to itself and to string "bbaa". | ```python
from sys import stdin, setrecursionlimit, stdout
#setrecursionlimit(1000000) #use "python" instead of "pypy" to avoid MLE
from collections import deque
from math import sqrt, floor, ceil, log, log2, log10, pi, gcd, sin, cos, asin
from heapq import heapify, heappop, heappush, heapreplace, heappushpop
def ii(): return int(stdin.readline())
def fi(): return float(stdin.readline())
def mi(): return map(int, stdin.readline().split())
def fmi(): return map(float, stdin.readline().split())
def li(): return list(mi())
def si(): return stdin.readline().rstrip()
def lsi(): return list(si())
mod=1000000007
res=['YES', 'NO']
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
########################### M Y F U N C T I O N S ###########################
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
def solve(a, b):
if a==b:
return True
l=len(a)//2
if not l:
return False
x, y=a[:l], a[l:]
w, z=b[:l], b[l:]
return (solve(x, w) and solve(y, z)) or (solve(x, z) and solve(y, w))
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
########################### M A I N P R O G R A M ###########################
"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""
test=1
test_case=1
while test<=test_case:
test+=1
a=lsi()
b=lsi()
print('YES' if solve(a, b) else 'NO')
``` | 0 | |
612 | A | The Text Splitting | PROGRAMMING | 1,300 | [
"brute force",
"implementation",
"strings"
] | null | null | You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test). | The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits. | If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* — the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right.
If there are several solutions print any of them. | [
"5 2 3\nHello\n",
"10 9 5\nCodeforces\n",
"6 4 5\nPrivet\n",
"8 1 1\nabacabac\n"
] | [
"2\nHe\nllo\n",
"2\nCodef\norces\n",
"-1\n",
"8\na\nb\na\nc\na\nb\na\nc\n"
] | none | 0 | [
{
"input": "5 2 3\nHello",
"output": "2\nHe\nllo"
},
{
"input": "10 9 5\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "6 4 5\nPrivet",
"output": "-1"
},
{
"input": "8 1 1\nabacabac",
"output": "8\na\nb\na\nc\na\nb\na\nc"
},
{
"input": "1 1 1\n1",
"output": "1\n1"
},
{
"input": "10 8 1\nuTl9w4lcdo",
"output": "10\nu\nT\nl\n9\nw\n4\nl\nc\nd\no"
},
{
"input": "20 6 4\nfmFRpk2NrzSvnQC9gB61",
"output": "5\nfmFR\npk2N\nrzSv\nnQC9\ngB61"
},
{
"input": "30 23 6\nWXDjl9kitaDTY673R5xyTlbL9gqeQ6",
"output": "5\nWXDjl9\nkitaDT\nY673R5\nxyTlbL\n9gqeQ6"
},
{
"input": "40 14 3\nSOHBIkWEv7ScrkHgMtFFxP9G7JQLYXFoH1sJDAde",
"output": "6\nSOHBIkWEv7Scrk\nHgMtFFxP9G7JQL\nYXF\noH1\nsJD\nAde"
},
{
"input": "50 16 3\nXCgVJUu4aMQ7HMxZjNxe3XARNiahK303g9y7NV8oN6tWdyXrlu",
"output": "8\nXCgVJUu4aMQ7HMxZ\njNxe3XARNiahK303\ng9y\n7NV\n8oN\n6tW\ndyX\nrlu"
},
{
"input": "60 52 8\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4hCKogONj",
"output": "2\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4\nhCKogONj"
},
{
"input": "70 50 5\n1BH1ECq7hjzooQOZdbiYHTAgATcP5mxI7kLI9rqA9AriWc9kE5KoLa1zmuTDFsd2ClAPPY",
"output": "14\n1BH1E\nCq7hj\nzooQO\nZdbiY\nHTAgA\nTcP5m\nxI7kL\nI9rqA\n9AriW\nc9kE5\nKoLa1\nzmuTD\nFsd2C\nlAPPY"
},
{
"input": "80 51 8\no2mpu1FCofuiLQb472qczCNHfVzz5TfJtVMrzgN3ff7FwlAY0fQ0ROhWmIX2bggodORNA76bHMjA5yyc",
"output": "10\no2mpu1FC\nofuiLQb4\n72qczCNH\nfVzz5TfJ\ntVMrzgN3\nff7FwlAY\n0fQ0ROhW\nmIX2bggo\ndORNA76b\nHMjA5yyc"
},
{
"input": "90 12 7\nclcImtsw176FFOA6OHGFxtEfEyhFh5bH4iktV0Y8onIcn0soTwiiHUFRWC6Ow36tT5bsQjgrVSTcB8fAVoe7dJIWkE",
"output": "10\nclcImtsw176F\nFOA6OHGFxtEf\nEyhFh5bH4ikt\nV0Y8onIcn0so\nTwiiHUF\nRWC6Ow3\n6tT5bsQ\njgrVSTc\nB8fAVoe\n7dJIWkE"
},
{
"input": "100 25 5\n2SRB9mRpXMRND5zQjeRxc4GhUBlEQSmLgnUtB9xTKoC5QM9uptc8dKwB88XRJy02r7edEtN2C6D60EjzK1EHPJcWNj6fbF8kECeB",
"output": "20\n2SRB9\nmRpXM\nRND5z\nQjeRx\nc4GhU\nBlEQS\nmLgnU\ntB9xT\nKoC5Q\nM9upt\nc8dKw\nB88XR\nJy02r\n7edEt\nN2C6D\n60Ejz\nK1EHP\nJcWNj\n6fbF8\nkECeB"
},
{
"input": "100 97 74\nxL8yd8lENYnXZs28xleyci4SxqsjZqkYzkEbQXfLQ4l4gKf9QQ9xjBjeZ0f9xQySf5psDUDkJEtPLsa62n4CLc6lF6E2yEqvt4EJ",
"output": "-1"
},
{
"input": "51 25 11\nwpk5wqrB6d3qE1slUrzJwMFafnnOu8aESlvTEb7Pp42FDG2iGQn",
"output": "-1"
},
{
"input": "70 13 37\nfzL91QIJvNoZRP4A9aNRT2GTksd8jEb1713pnWFaCGKHQ1oYvlTHXIl95lqyZRKJ1UPYvT",
"output": "-1"
},
{
"input": "10 3 1\nXQ2vXLPShy",
"output": "10\nX\nQ\n2\nv\nX\nL\nP\nS\nh\ny"
},
{
"input": "4 2 3\naaaa",
"output": "2\naa\naa"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb"
},
{
"input": "99 2 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 2 3\nhavanahavan",
"output": "4\nha\nvan\naha\nvan"
},
{
"input": "100 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "50\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa"
},
{
"input": "17 3 5\ngopstopmipodoshli",
"output": "5\ngop\nsto\npmi\npod\noshli"
},
{
"input": "5 4 3\nfoyku",
"output": "-1"
},
{
"input": "99 2 2\n123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789",
"output": "-1"
},
{
"input": "99 2 2\nrecursionishellrecursionishellrecursionishellrecursionishellrecursionishellrecursionishelldontuseit",
"output": "-1"
},
{
"input": "11 2 3\nqibwnnvqqgo",
"output": "4\nqi\nbwn\nnvq\nqgo"
},
{
"input": "4 4 3\nhhhh",
"output": "1\nhhhh"
},
{
"input": "99 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "99 2 5\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "21\nhh\nhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh"
},
{
"input": "10 5 9\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "10 5 9\naaaaaaaaaa",
"output": "2\naaaaa\naaaaa"
},
{
"input": "11 3 2\nmlmqpohwtsf",
"output": "5\nmlm\nqp\noh\nwt\nsf"
},
{
"input": "3 3 2\nzyx",
"output": "1\nzyx"
},
{
"input": "100 3 3\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "4 2 3\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "3 2 3\nejt",
"output": "1\nejt"
},
{
"input": "5 2 4\nzyxwv",
"output": "-1"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na"
},
{
"input": "100 5 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa"
},
{
"input": "3 2 2\nzyx",
"output": "-1"
},
{
"input": "99 2 2\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "-1"
},
{
"input": "26 8 9\nabcabcabcabcabcabcabcabcab",
"output": "3\nabcabcab\ncabcabcab\ncabcabcab"
},
{
"input": "6 3 5\naaaaaa",
"output": "2\naaa\naaa"
},
{
"input": "3 2 3\nzyx",
"output": "1\nzyx"
},
{
"input": "5 5 2\naaaaa",
"output": "1\naaaaa"
},
{
"input": "4 3 2\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "5 4 3\nzyxwv",
"output": "-1"
},
{
"input": "95 3 29\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "23\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabcabcabcabcabcabcabcabcabcab"
},
{
"input": "3 2 2\naaa",
"output": "-1"
},
{
"input": "91 62 3\nfjzhkfwzoabaauvbkuzaahkozofaophaafhfpuhobufawkzbavaazwavwppfwapkapaofbfjwaavajojgjguahphofj",
"output": "-1"
},
{
"input": "99 2 2\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc",
"output": "-1"
},
{
"input": "56 13 5\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "8\nabcabcabcabca\nbcabcabcabcab\ncabca\nbcabc\nabcab\ncabca\nbcabc\nabcab"
},
{
"input": "79 7 31\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca",
"output": "-1"
},
{
"input": "92 79 6\nxlvplpckwnhmctoethhslkcyashqtsoeltriddglfwtgkfvkvgytygbcyohrvcxvosdioqvackxiuifmkgdngvbbudcb",
"output": "-1"
},
{
"input": "48 16 13\nibhfinipihcbsqnvtgsbkobepmwymlyfmlfgblvhlfhyojsy",
"output": "3\nibhfinipihcbsqnv\ntgsbkobepmwymlyf\nmlfgblvhlfhyojsy"
},
{
"input": "16 3 7\naaaaaaaaaaaaaaaa",
"output": "4\naaa\naaa\naaa\naaaaaaa"
},
{
"input": "11 10 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 8 8\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 7 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "41 3 4\nabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "11\nabc\nabc\nabc\nabca\nbcab\ncabc\nabca\nbcab\ncabc\nabca\nbcab"
},
{
"input": "11 3 2\naaaaaaaaaaa",
"output": "5\naaa\naa\naa\naa\naa"
},
{
"input": "14 9 4\nabcdefghijklmn",
"output": "-1"
},
{
"input": "9 9 5\n123456789",
"output": "1\n123456789"
},
{
"input": "92 10 41\nmeotryyfneonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlgeftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw",
"output": "3\nmeotryyfne\nonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlg\neftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw"
},
{
"input": "17 16 3\ndxyhgtsxtuyljmclj",
"output": "-1"
},
{
"input": "82 13 30\nfmtwumakkejtolxqxrnydhqoufwtdwldfxcfjrndauqcarhbwmdwxsxfbqjsfspuxobywhcrvlndsdmkqd",
"output": "5\nfmtwumakkejto\nlxqxrnydhqouf\nwtdwldfxcfjrn\ndauqcarhbwmdw\nxsxfbqjsfspuxobywhcrvlndsdmkqd"
},
{
"input": "95 3 3\nihnfqcswushyoirjxlxxnwqtwtaowounkumxukwpacxwatimhhhoggqwkkspcplvyndfukbxickcixidgxkjtnpkoeiwlor",
"output": "-1"
},
{
"input": "7 5 3\nzyxwvut",
"output": "-1"
},
{
"input": "17 16 4\nctvfhkiakagcilrdw",
"output": "-1"
}
] | 1,552,200,528 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 77 | 0 | def gcd(a,b):
if b==0:
return a
return gcd(b,a%b)
n,a,b=map(int,input().split())
s=input()
if n%gcd(a,b):
print(-1)
exit()
for i in range(0,101):
for j in range(0,100):
if a*i+b*j==n:
ansa=i
ansb=j
break
ans=[a]*ansa+[b]*ansb
prev=0
for i in ans:
print(s[prev:prev+i])
prev+=i | Title: The Text Splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test).
Input Specification:
The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits.
Output Specification:
If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* — the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right.
If there are several solutions print any of them.
Demo Input:
['5 2 3\nHello\n', '10 9 5\nCodeforces\n', '6 4 5\nPrivet\n', '8 1 1\nabacabac\n']
Demo Output:
['2\nHe\nllo\n', '2\nCodef\norces\n', '-1\n', '8\na\nb\na\nc\na\nb\na\nc\n']
Note:
none | ```python
def gcd(a,b):
if b==0:
return a
return gcd(b,a%b)
n,a,b=map(int,input().split())
s=input()
if n%gcd(a,b):
print(-1)
exit()
for i in range(0,101):
for j in range(0,100):
if a*i+b*j==n:
ansa=i
ansb=j
break
ans=[a]*ansa+[b]*ansb
prev=0
for i in ans:
print(s[prev:prev+i])
prev+=i
``` | 0 | |
38 | A | Army | PROGRAMMING | 800 | [
"implementation"
] | A. Army | 2 | 256 | The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream. | The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated. | Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*. | [
"3\n5 6\n1 2\n",
"3\n5 6\n1 3\n"
] | [
"5\n",
"11\n"
] | none | 0 | [
{
"input": "3\n5 6\n1 2",
"output": "5"
},
{
"input": "3\n5 6\n1 3",
"output": "11"
},
{
"input": "2\n55\n1 2",
"output": "55"
},
{
"input": "3\n85 78\n1 3",
"output": "163"
},
{
"input": "4\n63 4 49\n2 3",
"output": "4"
},
{
"input": "5\n93 83 42 56\n2 5",
"output": "181"
},
{
"input": "6\n22 9 87 89 57\n1 6",
"output": "264"
},
{
"input": "7\n52 36 31 23 74 78\n2 7",
"output": "242"
},
{
"input": "8\n82 14 24 5 91 49 94\n3 8",
"output": "263"
},
{
"input": "9\n12 40 69 39 59 21 59 5\n4 6",
"output": "98"
},
{
"input": "10\n95 81 32 59 71 30 50 61 100\n1 6",
"output": "338"
},
{
"input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14",
"output": "617"
},
{
"input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17",
"output": "399"
},
{
"input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23",
"output": "846"
},
{
"input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16",
"output": "730"
},
{
"input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35",
"output": "1663"
},
{
"input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26",
"output": "862"
},
{
"input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40",
"output": "1061"
},
{
"input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28",
"output": "344"
},
{
"input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60",
"output": "1502"
},
{
"input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41",
"output": "1767"
},
{
"input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24",
"output": "219"
},
{
"input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44",
"output": "1713"
},
{
"input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15",
"output": "570"
},
{
"input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26",
"output": "328"
},
{
"input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68",
"output": "3385"
},
{
"input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77",
"output": "3319"
},
{
"input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36",
"output": "514"
},
{
"input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92",
"output": "2599"
},
{
"input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27",
"output": "618"
},
{
"input": "2\n3\n1 2",
"output": "3"
},
{
"input": "5\n6 8 22 22\n2 3",
"output": "8"
},
{
"input": "6\n3 12 27 28 28\n3 4",
"output": "27"
},
{
"input": "9\n1 2 2 2 2 3 3 5\n3 7",
"output": "9"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1\n6 8",
"output": "2"
},
{
"input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17",
"output": "23"
},
{
"input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8",
"output": "23"
},
{
"input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31",
"output": "2"
},
{
"input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45",
"output": "30"
},
{
"input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17",
"output": "285"
},
{
"input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58",
"output": "173"
},
{
"input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65",
"output": "126"
},
{
"input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65",
"output": "326"
},
{
"input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48",
"output": "784"
},
{
"input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93",
"output": "1636"
},
{
"input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96",
"output": "898"
},
{
"input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90",
"output": "3016"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95",
"output": "29"
},
{
"input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52",
"output": "82"
},
{
"input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44",
"output": "2268"
}
] | 1,530,825,314 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 186 | 0 | n = int(input())
d = [int(_) for _ in input().split()]
a, b = map(int, input().split())
ans = 0
for i in range(1,b):
ans+=d[i-1]
print (ans) | Title: Army
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
Input Specification:
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Output Specification:
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
Demo Input:
['3\n5 6\n1 2\n', '3\n5 6\n1 3\n']
Demo Output:
['5\n', '11\n']
Note:
none | ```python
n = int(input())
d = [int(_) for _ in input().split()]
a, b = map(int, input().split())
ans = 0
for i in range(1,b):
ans+=d[i-1]
print (ans)
``` | 0 |
799 | A | Carrot Cakes | PROGRAMMING | 1,100 | [
"brute force",
"implementation"
] | null | null | In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable. | The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven. | If it is reasonable to build the second oven, print "YES". Otherwise print "NO". | [
"8 6 4 5\n",
"8 6 4 6\n",
"10 3 11 4\n",
"4 2 1 4\n"
] | [
"YES\n",
"NO\n",
"NO\n",
"YES\n"
] | In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven. | 500 | [
{
"input": "8 6 4 5",
"output": "YES"
},
{
"input": "8 6 4 6",
"output": "NO"
},
{
"input": "10 3 11 4",
"output": "NO"
},
{
"input": "4 2 1 4",
"output": "YES"
},
{
"input": "28 17 16 26",
"output": "NO"
},
{
"input": "60 69 9 438",
"output": "NO"
},
{
"input": "599 97 54 992",
"output": "YES"
},
{
"input": "11 22 18 17",
"output": "NO"
},
{
"input": "1 13 22 11",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "NO"
},
{
"input": "3 1 1 1",
"output": "YES"
},
{
"input": "1000 1000 1000 1000",
"output": "NO"
},
{
"input": "1000 1000 1 1",
"output": "YES"
},
{
"input": "1000 1000 1 400",
"output": "YES"
},
{
"input": "1000 1000 1 1000",
"output": "YES"
},
{
"input": "1000 1000 1 999",
"output": "YES"
},
{
"input": "53 11 3 166",
"output": "YES"
},
{
"input": "313 2 3 385",
"output": "NO"
},
{
"input": "214 9 9 412",
"output": "NO"
},
{
"input": "349 9 5 268",
"output": "YES"
},
{
"input": "611 16 8 153",
"output": "YES"
},
{
"input": "877 13 3 191",
"output": "YES"
},
{
"input": "340 9 9 10",
"output": "YES"
},
{
"input": "31 8 2 205",
"output": "NO"
},
{
"input": "519 3 2 148",
"output": "YES"
},
{
"input": "882 2 21 219",
"output": "NO"
},
{
"input": "982 13 5 198",
"output": "YES"
},
{
"input": "428 13 6 272",
"output": "YES"
},
{
"input": "436 16 14 26",
"output": "YES"
},
{
"input": "628 10 9 386",
"output": "YES"
},
{
"input": "77 33 18 31",
"output": "YES"
},
{
"input": "527 36 4 8",
"output": "YES"
},
{
"input": "128 18 2 169",
"output": "YES"
},
{
"input": "904 4 2 288",
"output": "YES"
},
{
"input": "986 4 3 25",
"output": "YES"
},
{
"input": "134 8 22 162",
"output": "NO"
},
{
"input": "942 42 3 69",
"output": "YES"
},
{
"input": "894 4 9 4",
"output": "YES"
},
{
"input": "953 8 10 312",
"output": "YES"
},
{
"input": "43 8 1 121",
"output": "YES"
},
{
"input": "12 13 19 273",
"output": "NO"
},
{
"input": "204 45 10 871",
"output": "YES"
},
{
"input": "342 69 50 425",
"output": "NO"
},
{
"input": "982 93 99 875",
"output": "NO"
},
{
"input": "283 21 39 132",
"output": "YES"
},
{
"input": "1000 45 83 686",
"output": "NO"
},
{
"input": "246 69 36 432",
"output": "NO"
},
{
"input": "607 93 76 689",
"output": "NO"
},
{
"input": "503 21 24 435",
"output": "NO"
},
{
"input": "1000 45 65 989",
"output": "NO"
},
{
"input": "30 21 2 250",
"output": "YES"
},
{
"input": "1000 49 50 995",
"output": "NO"
},
{
"input": "383 69 95 253",
"output": "YES"
},
{
"input": "393 98 35 999",
"output": "YES"
},
{
"input": "1000 22 79 552",
"output": "NO"
},
{
"input": "268 294 268 154",
"output": "NO"
},
{
"input": "963 465 706 146",
"output": "YES"
},
{
"input": "304 635 304 257",
"output": "NO"
},
{
"input": "4 2 1 6",
"output": "NO"
},
{
"input": "1 51 10 50",
"output": "NO"
},
{
"input": "5 5 4 4",
"output": "YES"
},
{
"input": "3 2 1 1",
"output": "YES"
},
{
"input": "3 4 3 3",
"output": "NO"
},
{
"input": "7 3 4 1",
"output": "YES"
},
{
"input": "101 10 1 1000",
"output": "NO"
},
{
"input": "5 1 1 1",
"output": "YES"
},
{
"input": "5 10 5 5",
"output": "NO"
},
{
"input": "19 1 7 1",
"output": "YES"
},
{
"input": "763 572 745 262",
"output": "YES"
},
{
"input": "1 2 1 1",
"output": "NO"
},
{
"input": "5 1 1 3",
"output": "YES"
},
{
"input": "170 725 479 359",
"output": "NO"
},
{
"input": "6 2 1 7",
"output": "YES"
},
{
"input": "6 2 5 1",
"output": "YES"
},
{
"input": "1 2 2 1",
"output": "NO"
},
{
"input": "24 2 8 3",
"output": "YES"
},
{
"input": "7 3 3 3",
"output": "YES"
},
{
"input": "5 2 2 2",
"output": "YES"
},
{
"input": "3 2 1 2",
"output": "YES"
},
{
"input": "1000 2 200 8",
"output": "NO"
},
{
"input": "3 100 2 100",
"output": "NO"
},
{
"input": "2 999 1 1000",
"output": "NO"
},
{
"input": "2 1 1 1",
"output": "NO"
},
{
"input": "2 3 5 1",
"output": "NO"
},
{
"input": "100 1 5 1",
"output": "YES"
},
{
"input": "7 2 3 3",
"output": "YES"
},
{
"input": "4 1 1 3",
"output": "NO"
},
{
"input": "3 2 2 1",
"output": "YES"
},
{
"input": "1 1 1 2",
"output": "NO"
},
{
"input": "91 8 7 13",
"output": "YES"
},
{
"input": "3 1 2 1",
"output": "NO"
},
{
"input": "5 3 2 3",
"output": "YES"
},
{
"input": "9 6 6 3",
"output": "YES"
}
] | 1,675,896,444 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 6 | 46 | 0 | x=[int(i) for i in input().split()]
if x[1]+x[3]<(x[0]/x[2])*x[1]:
print("YES")
elif x[2]>x[0]:
print("NO")
else:
print("NO") | Title: Carrot Cakes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
Input Specification:
The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
Output Specification:
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
Demo Input:
['8 6 4 5\n', '8 6 4 6\n', '10 3 11 4\n', '4 2 1 4\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n', 'YES\n']
Note:
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven. | ```python
x=[int(i) for i in input().split()]
if x[1]+x[3]<(x[0]/x[2])*x[1]:
print("YES")
elif x[2]>x[0]:
print("NO")
else:
print("NO")
``` | 0 | |
27 | B | Tournament | PROGRAMMING | 1,300 | [
"bitmasks",
"brute force",
"dfs and similar",
"greedy"
] | B. Tournament | 2 | 256 | The tournament «Sleepyhead-2010» in the rapid falling asleep has just finished in Berland. *n* best participants from the country have participated in it. The tournament consists of games, each of them is a match between two participants. *n*·(*n*<=-<=1)<=/<=2 games were played during the tournament, and each participant had a match with each other participant.
The rules of the game are quite simple — the participant who falls asleep first wins. The secretary made a record of each game in the form «*x**i* *y**i*», where *x**i* and *y**i* are the numbers of participants. The first number in each pair is a winner (i.e. *x**i* is a winner and *y**i* is a loser). There is no draws.
Recently researches form the «Institute Of Sleep» have found that every person is characterized by a value *p**j* — the speed of falling asleep. The person who has lower speed wins. Every person has its own value *p**j*, constant during the life.
It is known that all participants of the tournament have distinct speeds of falling asleep. Also it was found that the secretary made records about all the games except one. You are to find the result of the missing game. | The first line contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of participants. The following *n*·(*n*<=-<=1)<=/<=2<=-<=1 lines contain the results of the games. Each game is described in a single line by two integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*,<=*x**i*<=≠<=*y**i*), where *x**i* и *y**i* are the numbers of the opponents in this game. It is known that during the tournament each of the *n* participants played *n*<=-<=1 games, one game with each other participant. | Output two integers *x* and *y* — the missing record. If there are several solutions, output any of them. | [
"4\n4 2\n4 1\n2 3\n2 1\n3 1\n"
] | [
"4 3\n"
] | none | 1,000 | [
{
"input": "3\n3 2\n1 2",
"output": "1 3"
},
{
"input": "4\n2 4\n3 4\n1 2\n1 4\n1 3",
"output": "2 3"
},
{
"input": "5\n3 5\n2 5\n1 5\n1 4\n4 3\n1 3\n2 3\n4 5\n4 2",
"output": "1 2"
},
{
"input": "6\n3 4\n3 5\n5 4\n1 2\n5 6\n2 6\n5 2\n3 6\n3 2\n4 6\n2 4\n1 3\n1 5\n1 4",
"output": "1 6"
},
{
"input": "7\n2 4\n6 1\n6 5\n3 4\n6 3\n2 6\n6 4\n3 7\n7 1\n1 4\n7 4\n7 5\n2 7\n2 3\n5 4\n3 5\n3 1\n5 1\n6 7\n2 1",
"output": "2 5"
},
{
"input": "8\n4 3\n6 8\n1 5\n8 3\n1 4\n1 7\n5 6\n5 3\n5 8\n7 3\n7 8\n2 3\n1 3\n2 8\n1 6\n5 4\n1 2\n2 5\n4 8\n1 8\n2 6\n2 7\n4 7\n2 4\n6 4\n6 7\n6 3",
"output": "5 7"
},
{
"input": "9\n4 5\n9 6\n5 6\n8 7\n5 1\n8 5\n9 5\n4 7\n2 6\n7 6\n3 5\n2 1\n8 2\n3 7\n9 1\n2 5\n2 7\n4 2\n8 9\n8 1\n3 6\n7 1\n8 6\n3 2\n3 1\n9 2\n4 6\n5 7\n1 6\n4 8\n4 1\n4 3\n4 9\n9 3\n9 7",
"output": "8 3"
},
{
"input": "3\n3 2\n1 2",
"output": "1 3"
},
{
"input": "3\n1 3\n2 3",
"output": "1 2"
},
{
"input": "3\n2 1\n3 1",
"output": "2 3"
},
{
"input": "4\n3 1\n4 1\n4 2\n3 2\n3 4",
"output": "1 2"
},
{
"input": "4\n3 4\n1 4\n2 3\n2 1\n2 4",
"output": "1 3"
},
{
"input": "4\n2 3\n1 3\n2 1\n4 1\n4 3",
"output": "2 4"
},
{
"input": "5\n5 2\n3 1\n5 3\n5 1\n3 4\n1 4\n3 2\n1 2\n5 4",
"output": "2 4"
},
{
"input": "5\n2 1\n4 1\n5 1\n4 5\n3 5\n2 3\n3 1\n2 5\n2 4",
"output": "3 4"
},
{
"input": "5\n4 5\n4 3\n5 3\n4 1\n3 1\n3 2\n5 2\n4 2\n5 1",
"output": "1 2"
},
{
"input": "5\n4 5\n1 5\n4 3\n2 5\n2 1\n2 4\n3 5\n2 3\n1 3",
"output": "1 4"
},
{
"input": "5\n2 4\n5 3\n5 4\n2 5\n1 4\n2 3\n1 5\n1 3\n1 2",
"output": "3 4"
},
{
"input": "6\n6 1\n5 6\n4 1\n3 1\n3 4\n4 6\n4 5\n3 2\n4 2\n6 2\n5 1\n3 5\n3 6\n5 2",
"output": "1 2"
},
{
"input": "6\n6 2\n6 4\n4 1\n4 3\n5 6\n5 2\n6 3\n5 1\n5 3\n2 1\n2 3\n6 1\n3 1\n5 4",
"output": "2 4"
},
{
"input": "6\n5 3\n6 5\n3 4\n1 5\n2 3\n6 2\n2 5\n5 4\n6 4\n1 4\n6 3\n6 1\n2 4\n1 3",
"output": "1 2"
},
{
"input": "6\n3 1\n5 4\n2 1\n6 2\n5 2\n3 6\n6 4\n3 2\n3 4\n6 1\n6 5\n5 1\n2 4\n3 5",
"output": "1 4"
},
{
"input": "6\n6 1\n1 3\n3 4\n6 3\n2 4\n6 2\n1 5\n5 3\n5 4\n6 4\n1 2\n1 4\n6 5\n5 2",
"output": "2 3"
}
] | 1,624,032,035 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 124 | 0 | # -*- coding: utf-8 -*-
"""Untitled65.ipynb
Automatically generated by Colaboratory.
Original file is located at
https://colab.research.google.com/drive/1kH9gF2Sz0uEW-8MC5Exb7nZuB4f5BTlb
"""
n=int(input())
l1=[]
c=int(((n*(n-1))/2)-1)
for i in range(0,c):
l2=list(map(int,input().split()))
l1.append(l2[0])
l1.append(l2[1])
d1={}
for x in l1:
if x in d1:
d1[x]=d1[x]+1
else:
d1[x]=1
l3=[]
c=0
for x in d1:
if c==2:
break
else:
if d1[x]==n-2:
l3.append(x)
c=c+1
print(str(l3[0])+" "+str(l3[1])) | Title: Tournament
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The tournament «Sleepyhead-2010» in the rapid falling asleep has just finished in Berland. *n* best participants from the country have participated in it. The tournament consists of games, each of them is a match between two participants. *n*·(*n*<=-<=1)<=/<=2 games were played during the tournament, and each participant had a match with each other participant.
The rules of the game are quite simple — the participant who falls asleep first wins. The secretary made a record of each game in the form «*x**i* *y**i*», where *x**i* and *y**i* are the numbers of participants. The first number in each pair is a winner (i.e. *x**i* is a winner and *y**i* is a loser). There is no draws.
Recently researches form the «Institute Of Sleep» have found that every person is characterized by a value *p**j* — the speed of falling asleep. The person who has lower speed wins. Every person has its own value *p**j*, constant during the life.
It is known that all participants of the tournament have distinct speeds of falling asleep. Also it was found that the secretary made records about all the games except one. You are to find the result of the missing game.
Input Specification:
The first line contains one integer *n* (3<=≤<=*n*<=≤<=50) — the number of participants. The following *n*·(*n*<=-<=1)<=/<=2<=-<=1 lines contain the results of the games. Each game is described in a single line by two integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*,<=*x**i*<=≠<=*y**i*), where *x**i* и *y**i* are the numbers of the opponents in this game. It is known that during the tournament each of the *n* participants played *n*<=-<=1 games, one game with each other participant.
Output Specification:
Output two integers *x* and *y* — the missing record. If there are several solutions, output any of them.
Demo Input:
['4\n4 2\n4 1\n2 3\n2 1\n3 1\n']
Demo Output:
['4 3\n']
Note:
none | ```python
# -*- coding: utf-8 -*-
"""Untitled65.ipynb
Automatically generated by Colaboratory.
Original file is located at
https://colab.research.google.com/drive/1kH9gF2Sz0uEW-8MC5Exb7nZuB4f5BTlb
"""
n=int(input())
l1=[]
c=int(((n*(n-1))/2)-1)
for i in range(0,c):
l2=list(map(int,input().split()))
l1.append(l2[0])
l1.append(l2[1])
d1={}
for x in l1:
if x in d1:
d1[x]=d1[x]+1
else:
d1[x]=1
l3=[]
c=0
for x in d1:
if c==2:
break
else:
if d1[x]==n-2:
l3.append(x)
c=c+1
print(str(l3[0])+" "+str(l3[1]))
``` | 0 |
952 | A | Quirky Quantifiers | PROGRAMMING | 800 | [
"math"
] | null | null | The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output 0 or 1. | The input contains a single integer *a* (10<=≤<=*a*<=≤<=999). | Output 0 or 1. | [
"13\n",
"927\n",
"48\n"
] | [
"1\n",
"1\n",
"0\n"
] | none | 0 | [
{
"input": "13",
"output": "1"
},
{
"input": "927",
"output": "1"
},
{
"input": "48",
"output": "0"
},
{
"input": "10",
"output": "0"
},
{
"input": "999",
"output": "1"
},
{
"input": "142",
"output": "0"
},
{
"input": "309",
"output": "1"
},
{
"input": "572",
"output": "0"
},
{
"input": "835",
"output": "1"
},
{
"input": "990",
"output": "0"
},
{
"input": "168",
"output": "0"
},
{
"input": "431",
"output": "1"
},
{
"input": "694",
"output": "0"
},
{
"input": "957",
"output": "1"
},
{
"input": "932",
"output": "0"
}
] | 1,600,865,839 | 2,147,483,647 | PyPy 3 | OK | TESTS | 15 | 202 | 0 | n=int(input())
k=str(bin(n))[-1]
if k=='1':print(1)
else:print(0) | Title: Quirky Quantifiers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output 0 or 1.
Input Specification:
The input contains a single integer *a* (10<=≤<=*a*<=≤<=999).
Output Specification:
Output 0 or 1.
Demo Input:
['13\n', '927\n', '48\n']
Demo Output:
['1\n', '1\n', '0\n']
Note:
none | ```python
n=int(input())
k=str(bin(n))[-1]
if k=='1':print(1)
else:print(0)
``` | 3 | |
611 | B | New Year and Old Property | PROGRAMMING | 1,300 | [
"bitmasks",
"brute force",
"implementation"
] | null | null | The year 2015 is almost over.
Limak is a little polar bear. He has recently learnt about the binary system. He noticed that the passing year has exactly one zero in its representation in the binary system — 201510<==<=111110111112. Note that he doesn't care about the number of zeros in the decimal representation.
Limak chose some interval of years. He is going to count all years from this interval that have exactly one zero in the binary representation. Can you do it faster?
Assume that all positive integers are always written without leading zeros. | The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=1018) — the first year and the last year in Limak's interval respectively. | Print one integer – the number of years Limak will count in his chosen interval. | [
"5 10\n",
"2015 2015\n",
"100 105\n",
"72057594000000000 72057595000000000\n"
] | [
"2\n",
"1\n",
"0\n",
"26\n"
] | In the first sample Limak's interval contains numbers 5<sub class="lower-index">10</sub> = 101<sub class="lower-index">2</sub>, 6<sub class="lower-index">10</sub> = 110<sub class="lower-index">2</sub>, 7<sub class="lower-index">10</sub> = 111<sub class="lower-index">2</sub>, 8<sub class="lower-index">10</sub> = 1000<sub class="lower-index">2</sub>, 9<sub class="lower-index">10</sub> = 1001<sub class="lower-index">2</sub> and 10<sub class="lower-index">10</sub> = 1010<sub class="lower-index">2</sub>. Two of them (101<sub class="lower-index">2</sub> and 110<sub class="lower-index">2</sub>) have the described property. | 750 | [
{
"input": "5 10",
"output": "2"
},
{
"input": "2015 2015",
"output": "1"
},
{
"input": "100 105",
"output": "0"
},
{
"input": "72057594000000000 72057595000000000",
"output": "26"
},
{
"input": "1 100",
"output": "16"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "0"
},
{
"input": "1 1000000000000000000",
"output": "1712"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 7",
"output": "3"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "1"
},
{
"input": "2 4",
"output": "1"
},
{
"input": "2 5",
"output": "2"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "3"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "3 4",
"output": "0"
},
{
"input": "3 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "2"
},
{
"input": "4 4",
"output": "0"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "2"
},
{
"input": "5 7",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "7 7",
"output": "0"
},
{
"input": "1 8",
"output": "3"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "7 8",
"output": "0"
},
{
"input": "8 8",
"output": "0"
},
{
"input": "1 1022",
"output": "45"
},
{
"input": "1 1023",
"output": "45"
},
{
"input": "1 1024",
"output": "45"
},
{
"input": "1 1025",
"output": "45"
},
{
"input": "1 1026",
"output": "45"
},
{
"input": "509 1022",
"output": "11"
},
{
"input": "510 1022",
"output": "10"
},
{
"input": "511 1022",
"output": "9"
},
{
"input": "512 1022",
"output": "9"
},
{
"input": "513 1022",
"output": "9"
},
{
"input": "509 1023",
"output": "11"
},
{
"input": "510 1023",
"output": "10"
},
{
"input": "511 1023",
"output": "9"
},
{
"input": "512 1023",
"output": "9"
},
{
"input": "513 1023",
"output": "9"
},
{
"input": "509 1024",
"output": "11"
},
{
"input": "510 1024",
"output": "10"
},
{
"input": "511 1024",
"output": "9"
},
{
"input": "512 1024",
"output": "9"
},
{
"input": "513 1024",
"output": "9"
},
{
"input": "509 1025",
"output": "11"
},
{
"input": "510 1025",
"output": "10"
},
{
"input": "511 1025",
"output": "9"
},
{
"input": "512 1025",
"output": "9"
},
{
"input": "513 1025",
"output": "9"
},
{
"input": "1 1000000000",
"output": "408"
},
{
"input": "10000000000 70000000000000000",
"output": "961"
},
{
"input": "1 935829385028502935",
"output": "1712"
},
{
"input": "500000000000000000 1000000000000000000",
"output": "58"
},
{
"input": "500000000000000000 576460752303423488",
"output": "57"
},
{
"input": "576460752303423488 1000000000000000000",
"output": "1"
},
{
"input": "999999999999999999 1000000000000000000",
"output": "0"
},
{
"input": "1124800395214847 36011204832919551",
"output": "257"
},
{
"input": "1124800395214847 36011204832919550",
"output": "256"
},
{
"input": "1124800395214847 36011204832919552",
"output": "257"
},
{
"input": "1124800395214846 36011204832919551",
"output": "257"
},
{
"input": "1124800395214848 36011204832919551",
"output": "256"
},
{
"input": "1 287104476244869119",
"output": "1603"
},
{
"input": "1 287104476244869118",
"output": "1602"
},
{
"input": "1 287104476244869120",
"output": "1603"
},
{
"input": "492581209243647 1000000000000000000",
"output": "583"
},
{
"input": "492581209243646 1000000000000000000",
"output": "583"
},
{
"input": "492581209243648 1000000000000000000",
"output": "582"
},
{
"input": "1099444518911 1099444518911",
"output": "1"
},
{
"input": "1099444518910 1099444518911",
"output": "1"
},
{
"input": "1099444518911 1099444518912",
"output": "1"
},
{
"input": "1099444518910 1099444518912",
"output": "1"
},
{
"input": "864691128455135231 864691128455135231",
"output": "1"
},
{
"input": "864691128455135231 864691128455135232",
"output": "1"
},
{
"input": "864691128455135230 864691128455135232",
"output": "1"
},
{
"input": "864691128455135230 864691128455135231",
"output": "1"
},
{
"input": "864691128455135231 1000000000000000000",
"output": "1"
},
{
"input": "864691128455135232 1000000000000000000",
"output": "0"
},
{
"input": "864691128455135230 1000000000000000000",
"output": "1"
},
{
"input": "576460752303423487 576460752303423487",
"output": "0"
},
{
"input": "1 576460752303423487",
"output": "1711"
},
{
"input": "1 576460752303423486",
"output": "1711"
},
{
"input": "2 1000000000000000000",
"output": "1712"
},
{
"input": "3 1000000000000000000",
"output": "1711"
},
{
"input": "4 1000000000000000000",
"output": "1711"
},
{
"input": "5 1000000000000000000",
"output": "1711"
},
{
"input": "6 1000000000000000000",
"output": "1710"
},
{
"input": "5 6",
"output": "2"
},
{
"input": "1 2",
"output": "1"
}
] | 1,565,613,480 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 0 | 186 | 2,457,600 | c = 0
a,b=kk()
for i in range(61):
for j in range(1,i):
v = int("".join([('0' if k == j else '1') for k in range(i)]), 2)
if a <= v <= b: c+=1
print(c) | Title: New Year and Old Property
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The year 2015 is almost over.
Limak is a little polar bear. He has recently learnt about the binary system. He noticed that the passing year has exactly one zero in its representation in the binary system — 201510<==<=111110111112. Note that he doesn't care about the number of zeros in the decimal representation.
Limak chose some interval of years. He is going to count all years from this interval that have exactly one zero in the binary representation. Can you do it faster?
Assume that all positive integers are always written without leading zeros.
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=1018) — the first year and the last year in Limak's interval respectively.
Output Specification:
Print one integer – the number of years Limak will count in his chosen interval.
Demo Input:
['5 10\n', '2015 2015\n', '100 105\n', '72057594000000000 72057595000000000\n']
Demo Output:
['2\n', '1\n', '0\n', '26\n']
Note:
In the first sample Limak's interval contains numbers 5<sub class="lower-index">10</sub> = 101<sub class="lower-index">2</sub>, 6<sub class="lower-index">10</sub> = 110<sub class="lower-index">2</sub>, 7<sub class="lower-index">10</sub> = 111<sub class="lower-index">2</sub>, 8<sub class="lower-index">10</sub> = 1000<sub class="lower-index">2</sub>, 9<sub class="lower-index">10</sub> = 1001<sub class="lower-index">2</sub> and 10<sub class="lower-index">10</sub> = 1010<sub class="lower-index">2</sub>. Two of them (101<sub class="lower-index">2</sub> and 110<sub class="lower-index">2</sub>) have the described property. | ```python
c = 0
a,b=kk()
for i in range(61):
for j in range(1,i):
v = int("".join([('0' if k == j else '1') for k in range(i)]), 2)
if a <= v <= b: c+=1
print(c)
``` | -1 | |
168 | A | Wizards and Demonstration | PROGRAMMING | 900 | [
"implementation",
"math"
] | null | null | Some country is populated by wizards. They want to organize a demonstration.
There are *n* people living in the city, *x* of them are the wizards who will surely go to the demonstration. Other city people (*n*<=-<=*x* people) do not support the wizards and aren't going to go to the demonstration. We know that the city administration will react only to the demonstration involving at least *y* percent of the city people. Having considered the matter, the wizards decided to create clone puppets which can substitute the city people on the demonstration.
So all in all, the demonstration will involve only the wizards and their puppets. The city administration cannot tell the difference between a puppet and a person, so, as they calculate the percentage, the administration will consider the city to be consisting of only *n* people and not containing any clone puppets.
Help the wizards and find the minimum number of clones to create to that the demonstration had no less than *y* percent of the city people. | The first line contains three space-separated integers, *n*, *x*, *y* (1<=≤<=*n*,<=*x*,<=*y*<=≤<=104,<=*x*<=≤<=*n*) — the number of citizens in the city, the number of wizards and the percentage the administration needs, correspondingly.
Please note that *y* can exceed 100 percent, that is, the administration wants to see on a demonstration more people that actually live in the city (<=><=*n*). | Print a single integer — the answer to the problem, the minimum number of clones to create, so that the demonstration involved no less than *y* percent of *n* (the real total city population). | [
"10 1 14\n",
"20 10 50\n",
"1000 352 146\n"
] | [
"1\n",
"0\n",
"1108\n"
] | In the first sample it is necessary that at least 14% of 10 people came to the demonstration. As the number of people should be integer, then at least two people should come. There is only one wizard living in the city and he is going to come. That isn't enough, so he needs to create one clone.
In the second sample 10 people should come to the demonstration. The city has 10 wizards. They will all come to the demonstration, so nobody has to create any clones. | 500 | [
{
"input": "10 1 14",
"output": "1"
},
{
"input": "20 10 50",
"output": "0"
},
{
"input": "1000 352 146",
"output": "1108"
},
{
"input": "68 65 20",
"output": "0"
},
{
"input": "78 28 27",
"output": "0"
},
{
"input": "78 73 58",
"output": "0"
},
{
"input": "70 38 66",
"output": "9"
},
{
"input": "54 4 38",
"output": "17"
},
{
"input": "3 1 69",
"output": "2"
},
{
"input": "11 9 60",
"output": "0"
},
{
"input": "71 49 65",
"output": "0"
},
{
"input": "78 55 96",
"output": "20"
},
{
"input": "2765 768 9020",
"output": "248635"
},
{
"input": "3478 1728 9727",
"output": "336578"
},
{
"input": "9678 6173 5658",
"output": "541409"
},
{
"input": "1138 570 6666",
"output": "75290"
},
{
"input": "7754 204 9038",
"output": "700603"
},
{
"input": "8403 7401 4769",
"output": "393339"
},
{
"input": "4909 2111 8860",
"output": "432827"
},
{
"input": "6571 6449 8965",
"output": "582642"
},
{
"input": "9178 2255 7996",
"output": "731618"
},
{
"input": "6151 6148 3746",
"output": "224269"
},
{
"input": "8890 5449 8734",
"output": "771004"
},
{
"input": "7879 2590 2818",
"output": "219441"
},
{
"input": "8484 6400 547",
"output": "40008"
},
{
"input": "7835 6710 1639",
"output": "121706"
},
{
"input": "2379 1436 9663",
"output": "228447"
},
{
"input": "6487 5670 8",
"output": "0"
},
{
"input": "4470 2543 6",
"output": "0"
},
{
"input": "7261 5328 10",
"output": "0"
},
{
"input": "3871 3795 7",
"output": "0"
},
{
"input": "9620 6557 6",
"output": "0"
},
{
"input": "4890 1112 5",
"output": "0"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "1 1 10000",
"output": "99"
},
{
"input": "10000 1 1",
"output": "99"
},
{
"input": "10000 1 10000",
"output": "999999"
},
{
"input": "10000 10000 1",
"output": "0"
},
{
"input": "10000 10000 10000",
"output": "990000"
},
{
"input": "67 1 3",
"output": "2"
},
{
"input": "7878 4534 9159",
"output": "717013"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "3271 5 50",
"output": "1631"
}
] | 1,684,839,209 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 6 | 92 | 0 | n,x,y = map(int,input().split(' '))
clone = (-(-(n*y)//100))-x
print(clone) if clone>=x else print(0) | Title: Wizards and Demonstration
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some country is populated by wizards. They want to organize a demonstration.
There are *n* people living in the city, *x* of them are the wizards who will surely go to the demonstration. Other city people (*n*<=-<=*x* people) do not support the wizards and aren't going to go to the demonstration. We know that the city administration will react only to the demonstration involving at least *y* percent of the city people. Having considered the matter, the wizards decided to create clone puppets which can substitute the city people on the demonstration.
So all in all, the demonstration will involve only the wizards and their puppets. The city administration cannot tell the difference between a puppet and a person, so, as they calculate the percentage, the administration will consider the city to be consisting of only *n* people and not containing any clone puppets.
Help the wizards and find the minimum number of clones to create to that the demonstration had no less than *y* percent of the city people.
Input Specification:
The first line contains three space-separated integers, *n*, *x*, *y* (1<=≤<=*n*,<=*x*,<=*y*<=≤<=104,<=*x*<=≤<=*n*) — the number of citizens in the city, the number of wizards and the percentage the administration needs, correspondingly.
Please note that *y* can exceed 100 percent, that is, the administration wants to see on a demonstration more people that actually live in the city (<=><=*n*).
Output Specification:
Print a single integer — the answer to the problem, the minimum number of clones to create, so that the demonstration involved no less than *y* percent of *n* (the real total city population).
Demo Input:
['10 1 14\n', '20 10 50\n', '1000 352 146\n']
Demo Output:
['1\n', '0\n', '1108\n']
Note:
In the first sample it is necessary that at least 14% of 10 people came to the demonstration. As the number of people should be integer, then at least two people should come. There is only one wizard living in the city and he is going to come. That isn't enough, so he needs to create one clone.
In the second sample 10 people should come to the demonstration. The city has 10 wizards. They will all come to the demonstration, so nobody has to create any clones. | ```python
n,x,y = map(int,input().split(' '))
clone = (-(-(n*y)//100))-x
print(clone) if clone>=x else print(0)
``` | 0 | |
245 | H | Queries for Number of Palindromes | PROGRAMMING | 1,800 | [
"dp",
"hashing",
"strings"
] | null | null | You've got a string *s*<==<=*s*1*s*2... *s*|*s*| of length |*s*|, consisting of lowercase English letters. There also are *q* queries, each query is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=|*s*|). The answer to the query is the number of substrings of string *s*[*l**i*... *r**i*], which are palindromes.
String *s*[*l*... *r*]<==<=*s**l**s**l*<=+<=1... *s**r* (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) is a substring of string *s*<==<=*s*1*s*2... *s*|*s*|.
String *t* is called a palindrome, if it reads the same from left to right and from right to left. Formally, if *t*<==<=*t*1*t*2... *t*|*t*|<==<=*t*|*t*|*t*|*t*|<=-<=1... *t*1. | The first line contains string *s* (1<=≤<=|*s*|<=≤<=5000). The second line contains a single integer *q* (1<=≤<=*q*<=≤<=106) — the number of queries. Next *q* lines contain the queries. The *i*-th of these lines contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=|*s*|) — the description of the *i*-th query.
It is guaranteed that the given string consists only of lowercase English letters. | Print *q* integers — the answers to the queries. Print the answers in the order, in which the queries are given in the input. Separate the printed numbers by whitespaces. | [
"caaaba\n5\n1 1\n1 4\n2 3\n4 6\n4 5\n"
] | [
"1\n7\n3\n4\n2\n"
] | Consider the fourth query in the first test case. String *s*[4... 6] = «aba». Its palindrome substrings are: «a», «b», «a», «aba». | 0 | [
{
"input": "caaaba\n5\n1 1\n1 4\n2 3\n4 6\n4 5",
"output": "1\n7\n3\n4\n2"
},
{
"input": "a\n100\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1"
},
{
"input": "ab\n100\n1 2\n1 2\n1 1\n1 1\n1 1\n1 1\n1 2\n1 2\n1 2\n1 2\n1 2\n1 1\n1 1\n1 1\n1 2\n1 1\n1 2\n1 2\n2 2\n1 1\n1 1\n2 2\n1 1\n1 2\n1 1\n1 2\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 2\n2 2\n2 2\n2 2\n2 2\n1 2\n2 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 2\n2 2\n1 1\n2 2\n1 1\n1 1\n1 2\n1 1\n2 2\n1 1\n1 2\n1 1\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 1\n1 2\n1 1\n1 2\n1 2\n1 2\n2 2\n1 1\n2 2\n2 2\n2 2\n2 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 1\n2 2\n1 1\n1 2\n2 2\n1 2\n1 1\n2 2\n1 2\n2 2\n2 2\n1 2\n1 1\n1 2\n2 2",
"output": "2\n2\n1\n1\n1\n1\n2\n2\n2\n2\n2\n1\n1\n1\n2\n1\n2\n2\n1\n1\n1\n1\n1\n2\n1\n2\n2\n1\n1\n2\n2\n1\n1\n2\n1\n1\n1\n1\n1\n2\n1\n2\n2\n2\n2\n2\n2\n2\n1\n1\n1\n1\n1\n1\n2\n1\n1\n1\n2\n1\n2\n2\n2\n2\n2\n2\n2\n2\n1\n2\n1\n2\n2\n2\n1\n1\n1\n1\n1\n1\n2\n2\n2\n2\n2\n1\n1\n1\n2\n1\n2\n1\n1\n2\n1\n1\n2\n1\n2\n1"
},
{
"input": "caa\n100\n2 3\n2 3\n1 3\n2 3\n2 2\n2 3\n1 1\n1 3\n1 3\n1 2\n3 3\n1 3\n1 3\n3 3\n1 2\n1 3\n1 3\n2 2\n2 2\n1 2\n1 3\n1 3\n1 3\n1 2\n3 3\n1 1\n2 3\n2 3\n1 2\n2 3\n1 3\n1 2\n1 3\n2 3\n3 3\n1 2\n2 3\n1 2\n1 3\n1 1\n2 2\n2 2\n2 3\n2 2\n2 3\n1 3\n1 1\n1 2\n1 3\n1 3\n2 3\n1 2\n1 3\n1 2\n1 3\n1 2\n1 1\n1 1\n1 2\n2 3\n1 1\n2 3\n3 3\n2 2\n1 2\n1 3\n1 2\n1 2\n1 2\n2 3\n1 2\n1 2\n1 3\n3 3\n1 2\n2 2\n1 2\n2 2\n1 1\n2 3\n1 2\n1 2\n1 2\n1 2\n2 2\n1 1\n1 2\n3 3\n2 3\n1 2\n1 2\n2 3\n1 2\n1 2\n1 3\n2 3\n1 3\n1 1\n2 2\n1 2",
"output": "3\n3\n4\n3\n1\n3\n1\n4\n4\n2\n1\n4\n4\n1\n2\n4\n4\n1\n1\n2\n4\n4\n4\n2\n1\n1\n3\n3\n2\n3\n4\n2\n4\n3\n1\n2\n3\n2\n4\n1\n1\n1\n3\n1\n3\n4\n1\n2\n4\n4\n3\n2\n4\n2\n4\n2\n1\n1\n2\n3\n1\n3\n1\n1\n2\n4\n2\n2\n2\n3\n2\n2\n4\n1\n2\n1\n2\n1\n1\n3\n2\n2\n2\n2\n1\n1\n2\n1\n3\n2\n2\n3\n2\n2\n4\n3\n4\n1\n1\n2"
},
{
"input": "ccca\n100\n2 4\n1 2\n1 1\n2 3\n3 4\n3 4\n2 2\n3 3\n1 2\n1 4\n2 2\n1 3\n1 4\n4 4\n1 2\n2 3\n3 4\n1 3\n3 4\n2 3\n1 1\n2 4\n1 4\n1 2\n2 2\n2 2\n1 1\n3 3\n1 2\n2 3\n2 3\n1 2\n1 4\n4 4\n2 2\n2 2\n4 4\n1 4\n1 1\n1 2\n4 4\n2 3\n2 4\n3 3\n1 4\n2 4\n2 3\n4 4\n4 4\n3 4\n2 2\n1 2\n1 1\n1 2\n3 3\n2 4\n1 3\n2 4\n1 1\n3 3\n3 4\n2 4\n1 4\n2 4\n1 2\n3 3\n1 4\n2 2\n2 4\n1 4\n1 4\n1 3\n3 4\n1 2\n2 3\n2 3\n3 4\n1 4\n4 4\n3 3\n2 4\n2 2\n1 2\n2 3\n1 2\n1 4\n1 3\n2 3\n4 4\n3 3\n1 2\n4 4\n2 4\n1 2\n2 4\n2 2\n3 4\n2 3\n2 3\n2 3",
"output": "4\n3\n1\n3\n2\n2\n1\n1\n3\n7\n1\n6\n7\n1\n3\n3\n2\n6\n2\n3\n1\n4\n7\n3\n1\n1\n1\n1\n3\n3\n3\n3\n7\n1\n1\n1\n1\n7\n1\n3\n1\n3\n4\n1\n7\n4\n3\n1\n1\n2\n1\n3\n1\n3\n1\n4\n6\n4\n1\n1\n2\n4\n7\n4\n3\n1\n7\n1\n4\n7\n7\n6\n2\n3\n3\n3\n2\n7\n1\n1\n4\n1\n3\n3\n3\n7\n6\n3\n1\n1\n3\n1\n4\n3\n4\n1\n2\n3\n3\n3"
}
] | 1,609,386,501 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 184 | 204,800 | s=input()
n=len(s)
aa=[]
for ros in range(n):
bb=[]
aa.append(bb)
for ii in range(n-ros):
cc=s[ii]==s[ii+ros]
if ros>1:
cc=cc and aa[ros-1][ii+1]
bb.append(cc)
print(aa)
bb=[]
for ll in range(n):
cc=[0]*n
bb.append(cc)
cc[ll]=1
for rr in range(ll+1,n):
cc[rr]=aa[rr-ll][ll]+cc[rr-1]
cc=[[0]*n for ii in range(n)]
for rr in range(n):
cc[rr][rr]=1
for ll in reversed(range(n)):
cc[ll][rr]=bb[ll][rr]+cc[ll+1][rr]
for qq in int(input()):
l,r=map(int,input().split())
print(cc[l-1][r-1])
| Title: Queries for Number of Palindromes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a string *s*<==<=*s*1*s*2... *s*|*s*| of length |*s*|, consisting of lowercase English letters. There also are *q* queries, each query is described by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=|*s*|). The answer to the query is the number of substrings of string *s*[*l**i*... *r**i*], which are palindromes.
String *s*[*l*... *r*]<==<=*s**l**s**l*<=+<=1... *s**r* (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) is a substring of string *s*<==<=*s*1*s*2... *s*|*s*|.
String *t* is called a palindrome, if it reads the same from left to right and from right to left. Formally, if *t*<==<=*t*1*t*2... *t*|*t*|<==<=*t*|*t*|*t*|*t*|<=-<=1... *t*1.
Input Specification:
The first line contains string *s* (1<=≤<=|*s*|<=≤<=5000). The second line contains a single integer *q* (1<=≤<=*q*<=≤<=106) — the number of queries. Next *q* lines contain the queries. The *i*-th of these lines contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=|*s*|) — the description of the *i*-th query.
It is guaranteed that the given string consists only of lowercase English letters.
Output Specification:
Print *q* integers — the answers to the queries. Print the answers in the order, in which the queries are given in the input. Separate the printed numbers by whitespaces.
Demo Input:
['caaaba\n5\n1 1\n1 4\n2 3\n4 6\n4 5\n']
Demo Output:
['1\n7\n3\n4\n2\n']
Note:
Consider the fourth query in the first test case. String *s*[4... 6] = «aba». Its palindrome substrings are: «a», «b», «a», «aba». | ```python
s=input()
n=len(s)
aa=[]
for ros in range(n):
bb=[]
aa.append(bb)
for ii in range(n-ros):
cc=s[ii]==s[ii+ros]
if ros>1:
cc=cc and aa[ros-1][ii+1]
bb.append(cc)
print(aa)
bb=[]
for ll in range(n):
cc=[0]*n
bb.append(cc)
cc[ll]=1
for rr in range(ll+1,n):
cc[rr]=aa[rr-ll][ll]+cc[rr-1]
cc=[[0]*n for ii in range(n)]
for rr in range(n):
cc[rr][rr]=1
for ll in reversed(range(n)):
cc[ll][rr]=bb[ll][rr]+cc[ll+1][rr]
for qq in int(input()):
l,r=map(int,input().split())
print(cc[l-1][r-1])
``` | -1 | |
5 | B | Center Alignment | PROGRAMMING | 1,200 | [
"implementation",
"strings"
] | B. Center Alignment | 1 | 64 | Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck! | The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000. | Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better. | [
"This is\n\nCodeforces\nBeta\nRound\n5\n",
"welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n"
] | [
"************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n",
"****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n"
] | none | 0 | [
{
"input": "This is\n\nCodeforces\nBeta\nRound\n5",
"output": "************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************"
},
{
"input": "welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck",
"output": "****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************"
},
{
"input": "0\n2",
"output": "***\n*0*\n*2*\n***"
},
{
"input": "O\no\nd",
"output": "***\n*O*\n*o*\n*d*\n***"
},
{
"input": "0v uO M6Sy",
"output": "************\n*0v uO M6Sy*\n************"
},
{
"input": "fm v\nOL U W",
"output": "**********\n* fm v *\n*OL U W*\n**********"
},
{
"input": "vb\nJ\nyU\nZ",
"output": "****\n*vb*\n*J *\n*yU*\n* Z*\n****"
},
{
"input": "N\nSV\nEh\n6f\nX6\n9e",
"output": "****\n*N *\n*SV*\n*Eh*\n*6f*\n*X6*\n*9e*\n****"
},
{
"input": "Pj\nA\nFA\nP\nVJ\nU\nEb\nW",
"output": "****\n*Pj*\n*A *\n*FA*\n* P*\n*VJ*\n*U *\n*Eb*\n* W*\n****"
},
{
"input": "T\n7j\nS\nb\nq8\nVZ\nn\n4T\niZ\npA",
"output": "****\n*T *\n*7j*\n* S*\n*b *\n*q8*\n*VZ*\n* n*\n*4T*\n*iZ*\n*pA*\n****"
},
{
"input": "8\n\n\n\ny\nW\n\n\n\n3B\n\nw\nV\n\n\n\nL\nSr\n\n\nV\n\n5\n\nAq\n\n\n\nJ\nR\n\n04\nJ\nv\nhU\n\n\n\nY\nG\n4\n\nG\nb\n\n\n9\n\n6\nd\n\n2\n\n\nE\n7\n\nr\n\n\n\n\nKC\ns\nE\n\nab\n4\nx\n\n\n\n\n\nEe\n4\n\nl\n\np\n\nG\nM\n\n\nn\n\n\nm0\n\nw\n\n\nP\n\n\n\n0",
"output": "****\n*8 *\n* *\n* *\n* *\n* y*\n*W *\n* *\n* *\n* *\n*3B*\n* *\n* w*\n*V *\n* *\n* *\n* *\n* L*\n*Sr*\n* *\n* *\n*V *\n* *\n* 5*\n* *\n*Aq*\n* *\n* *\n* *\n*J *\n* R*\n* *\n*04*\n*J *\n* v*\n*hU*\n* *\n* *\n* *\n*Y *\n* G*\n*4 *\n* *\n* G*\n*b *\n* *\n* *\n* 9*\n* *\n*6 *\n* d*\n* *\n*2 *\n* *\n* *\n* E*\n*7 *\n* *\n* r*\n* *\n* *\n* *\n* *\n*KC*\n*s *\n* E*\n* *\n*ab*\n*4 *\n* x*\n* *\n* *\n* *\n* *\n* *\n*Ee*\n*4 *\n* *\n* l*\n* *\n*p *\n* *\n* G*\n*M *\n* *\n*..."
},
{
"input": "U",
"output": "***\n*U*\n***"
}
] | 1,547,432,467 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 154 | 0 | if __name__ == '__main__':
buffer = []
maxm = 0
while 1:
try:
s = input().strip()
maxm = max(maxm, len(s))
except EOFError:
break
print('*' * (maxm + 2))
for item in buffer:
print('*' + item.center(maxm) + '*')
print('*' * (maxm + 2)) | Title: Center Alignment
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck!
Input Specification:
The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000.
Output Specification:
Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better.
Demo Input:
['This is\n\nCodeforces\nBeta\nRound\n5\n', 'welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n']
Demo Output:
['************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n', '****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n']
Note:
none | ```python
if __name__ == '__main__':
buffer = []
maxm = 0
while 1:
try:
s = input().strip()
maxm = max(maxm, len(s))
except EOFError:
break
print('*' * (maxm + 2))
for item in buffer:
print('*' + item.center(maxm) + '*')
print('*' * (maxm + 2))
``` | 0 |
258 | A | Little Elephant and Bits | PROGRAMMING | 1,100 | [
"greedy",
"math"
] | null | null | The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. | The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. | In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. | [
"101\n",
"110010\n"
] | [
"11\n",
"11010\n"
] | In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | 500 | [
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
] | 1,683,601,842 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 92 | 204,800 | x = input()
y=x.find('0')
if y != -1:
ans = x[:y]+x[y+1:]
else:
ans = x[1:]
print(ans)
| Title: Little Elephant and Bits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | ```python
x = input()
y=x.find('0')
if y != -1:
ans = x[:y]+x[y+1:]
else:
ans = x[1:]
print(ans)
``` | 3 | |
658 | A | Bear and Reverse Radewoosh | PROGRAMMING | 800 | [
"implementation"
] | null | null | Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems. | The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem. | Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points. | [
"3 2\n50 85 250\n10 15 25\n",
"3 6\n50 85 250\n10 15 25\n",
"8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n"
] | [
"Limak\n",
"Radewoosh\n",
"Tie\n"
] | In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4. | 500 | [
{
"input": "3 2\n50 85 250\n10 15 25",
"output": "Limak"
},
{
"input": "3 6\n50 85 250\n10 15 25",
"output": "Radewoosh"
},
{
"input": "8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76",
"output": "Tie"
},
{
"input": "4 1\n3 5 6 9\n1 2 4 8",
"output": "Limak"
},
{
"input": "4 1\n1 3 6 10\n1 5 7 8",
"output": "Radewoosh"
},
{
"input": "4 1\n2 4 5 10\n2 3 9 10",
"output": "Tie"
},
{
"input": "18 4\n68 97 121 132 146 277 312 395 407 431 458 461 595 634 751 855 871 994\n1 2 3 4 9 10 13 21 22 29 31 34 37 38 39 41 48 49",
"output": "Radewoosh"
},
{
"input": "50 1\n5 14 18 73 137 187 195 197 212 226 235 251 262 278 287 304 310 322 342 379 393 420 442 444 448 472 483 485 508 515 517 523 559 585 618 627 636 646 666 682 703 707 780 853 937 951 959 989 991 992\n30 84 113 173 199 220 235 261 266 277 300 306 310 312 347 356 394 396 397 409 414 424 446 462 468 487 507 517 537 566 594 643 656 660 662 668 706 708 773 774 779 805 820 827 868 896 929 942 961 995",
"output": "Tie"
},
{
"input": "4 1\n4 6 9 10\n2 3 4 5",
"output": "Radewoosh"
},
{
"input": "4 1\n4 6 9 10\n3 4 5 7",
"output": "Radewoosh"
},
{
"input": "4 1\n1 6 7 10\n2 7 8 10",
"output": "Tie"
},
{
"input": "4 1\n4 5 7 9\n1 4 5 8",
"output": "Limak"
},
{
"input": "50 1\n6 17 44 82 94 127 134 156 187 211 212 252 256 292 294 303 352 355 379 380 398 409 424 434 480 524 584 594 631 714 745 756 777 778 789 793 799 821 841 849 859 878 879 895 925 932 944 952 958 990\n15 16 40 42 45 71 99 100 117 120 174 181 186 204 221 268 289 332 376 394 403 409 411 444 471 487 499 539 541 551 567 589 619 623 639 669 689 722 735 776 794 822 830 840 847 907 917 927 936 988",
"output": "Radewoosh"
},
{
"input": "50 10\n25 49 52 73 104 117 127 136 149 164 171 184 226 251 257 258 286 324 337 341 386 390 428 453 464 470 492 517 543 565 609 634 636 660 678 693 710 714 729 736 739 749 781 836 866 875 956 960 977 979\n2 4 7 10 11 22 24 26 27 28 31 35 37 38 42 44 45 46 52 53 55 56 57 59 60 61 64 66 67 68 69 71 75 76 77 78 79 81 83 85 86 87 89 90 92 93 94 98 99 100",
"output": "Limak"
},
{
"input": "50 10\n11 15 25 71 77 83 95 108 143 150 182 183 198 203 213 223 279 280 346 348 350 355 375 376 412 413 415 432 470 545 553 562 589 595 607 633 635 637 688 719 747 767 771 799 842 883 905 924 942 944\n1 3 5 6 7 10 11 12 13 14 15 16 19 20 21 23 25 32 35 36 37 38 40 41 42 43 47 50 51 54 55 56 57 58 59 60 62 63 64 65 66 68 69 70 71 72 73 75 78 80",
"output": "Radewoosh"
},
{
"input": "32 6\n25 77 141 148 157 159 192 196 198 244 245 255 332 392 414 457 466 524 575 603 629 700 738 782 838 841 845 847 870 945 984 985\n1 2 4 5 8 9 10 12 13 14 15 16 17 18 20 21 22 23 24 26 28 31 38 39 40 41 42 43 45 47 48 49",
"output": "Radewoosh"
},
{
"input": "5 1\n256 275 469 671 842\n7 9 14 17 26",
"output": "Limak"
},
{
"input": "2 1000\n1 2\n1 2",
"output": "Tie"
},
{
"input": "3 1\n1 50 809\n2 8 800",
"output": "Limak"
},
{
"input": "1 13\n866\n10",
"output": "Tie"
},
{
"input": "15 1\n9 11 66 128 199 323 376 386 393 555 585 718 935 960 971\n3 11 14 19 20 21 24 26 32 38 40 42 44 47 50",
"output": "Limak"
},
{
"input": "1 10\n546\n45",
"output": "Tie"
},
{
"input": "50 20\n21 43 51 99 117 119 158 167 175 190 196 244 250 316 335 375 391 403 423 428 451 457 460 480 487 522 539 559 566 584 598 602 604 616 626 666 675 730 771 787 828 841 861 867 886 889 898 970 986 991\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
},
{
"input": "50 21\n13 20 22 38 62 84 118 135 141 152 170 175 194 218 227 229 232 253 260 263 278 313 329 357 396 402 422 452 454 533 575 576 580 594 624 644 653 671 676 759 789 811 816 823 831 833 856 924 933 987\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "1 36\n312\n42",
"output": "Tie"
},
{
"input": "1 1000\n1\n1000",
"output": "Tie"
},
{
"input": "1 1\n1000\n1",
"output": "Tie"
},
{
"input": "50 35\n9 17 28 107 136 152 169 174 186 188 201 262 291 312 324 330 341 358 385 386 393 397 425 431 479 498 502 523 530 540 542 554 578 588 622 623 684 696 709 722 784 819 836 845 850 932 945 969 983 984\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Tie"
},
{
"input": "50 20\n12 113 116 120 138 156 167 183 185 194 211 228 234 261 278 287 310 317 346 361 364 397 424 470 496 522 527 536 611 648 668 704 707 712 717 752 761 766 815 828 832 864 872 885 889 901 904 929 982 993\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "Limak"
}
] | 1,574,836,496 | 2,147,483,647 | PyPy 3 | OK | TESTS | 29 | 155 | 1,228,800 | n, c = (int(x) for x in input().split())
p = [int(x) for x in input().split()]
t = [int(x) for x in input().split()]
l = sum([max(0, p[i] - c * sum(t[0:i + 1])) for i in range(n)])
p.reverse()
t.reverse()
r = sum([max(0, p[i] - c * sum(t[0:i + 1])) for i in range(n)])
if r > l:
print('Radewoosh')
elif r < l:
print('Limak')
else:
print('Tie')
| Title: Bear and Reverse Radewoosh
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak and Radewoosh are going to compete against each other in the upcoming algorithmic contest. They are equally skilled but they won't solve problems in the same order.
There will be *n* problems. The *i*-th problem has initial score *p**i* and it takes exactly *t**i* minutes to solve it. Problems are sorted by difficulty — it's guaranteed that *p**i*<=<<=*p**i*<=+<=1 and *t**i*<=<<=*t**i*<=+<=1.
A constant *c* is given too, representing the speed of loosing points. Then, submitting the *i*-th problem at time *x* (*x* minutes after the start of the contest) gives *max*(0,<= *p**i*<=-<=*c*·*x*) points.
Limak is going to solve problems in order 1,<=2,<=...,<=*n* (sorted increasingly by *p**i*). Radewoosh is going to solve them in order *n*,<=*n*<=-<=1,<=...,<=1 (sorted decreasingly by *p**i*). Your task is to predict the outcome — print the name of the winner (person who gets more points at the end) or a word "Tie" in case of a tie.
You may assume that the duration of the competition is greater or equal than the sum of all *t**i*. That means both Limak and Radewoosh will accept all *n* problems.
Input Specification:
The first line contains two integers *n* and *c* (1<=≤<=*n*<=≤<=50,<=1<=≤<=*c*<=≤<=1000) — the number of problems and the constant representing the speed of loosing points.
The second line contains *n* integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=1000,<=*p**i*<=<<=*p**i*<=+<=1) — initial scores.
The third line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000,<=*t**i*<=<<=*t**i*<=+<=1) where *t**i* denotes the number of minutes one needs to solve the *i*-th problem.
Output Specification:
Print "Limak" (without quotes) if Limak will get more points in total. Print "Radewoosh" (without quotes) if Radewoosh will get more points in total. Print "Tie" (without quotes) if Limak and Radewoosh will get the same total number of points.
Demo Input:
['3 2\n50 85 250\n10 15 25\n', '3 6\n50 85 250\n10 15 25\n', '8 1\n10 20 30 40 50 60 70 80\n8 10 58 63 71 72 75 76\n']
Demo Output:
['Limak\n', 'Radewoosh\n', 'Tie\n']
Note:
In the first sample, there are 3 problems. Limak solves them as follows:
1. Limak spends 10 minutes on the 1-st problem and he gets 50 - *c*·10 = 50 - 2·10 = 30 points. 1. Limak spends 15 minutes on the 2-nd problem so he submits it 10 + 15 = 25 minutes after the start of the contest. For the 2-nd problem he gets 85 - 2·25 = 35 points. 1. He spends 25 minutes on the 3-rd problem so he submits it 10 + 15 + 25 = 50 minutes after the start. For this problem he gets 250 - 2·50 = 150 points.
So, Limak got 30 + 35 + 150 = 215 points.
Radewoosh solves problem in the reversed order:
1. Radewoosh solves 3-rd problem after 25 minutes so he gets 250 - 2·25 = 200 points. 1. He spends 15 minutes on the 2-nd problem so he submits it 25 + 15 = 40 minutes after the start. He gets 85 - 2·40 = 5 points for this problem. 1. He spends 10 minutes on the 1-st problem so he submits it 25 + 15 + 10 = 50 minutes after the start. He gets *max*(0, 50 - 2·50) = *max*(0, - 50) = 0 points.
Radewoosh got 200 + 5 + 0 = 205 points in total. Limak has 215 points so Limak wins.
In the second sample, Limak will get 0 points for each problem and Radewoosh will first solve the hardest problem and he will get 250 - 6·25 = 100 points for that. Radewoosh will get 0 points for other two problems but he is the winner anyway.
In the third sample, Limak will get 2 points for the 1-st problem and 2 points for the 2-nd problem. Radewoosh will get 4 points for the 8-th problem. They won't get points for other problems and thus there is a tie because 2 + 2 = 4. | ```python
n, c = (int(x) for x in input().split())
p = [int(x) for x in input().split()]
t = [int(x) for x in input().split()]
l = sum([max(0, p[i] - c * sum(t[0:i + 1])) for i in range(n)])
p.reverse()
t.reverse()
r = sum([max(0, p[i] - c * sum(t[0:i + 1])) for i in range(n)])
if r > l:
print('Radewoosh')
elif r < l:
print('Limak')
else:
print('Tie')
``` | 3 | |
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,664,425,530 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 62 | 0 | x=list(map(int,input().split()))
z=x[0]*[1]
print(z/2) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
x=list(map(int,input().split()))
z=x[0]*[1]
print(z/2)
``` | -1 |
382 | C | Arithmetic Progression | PROGRAMMING | 1,700 | [
"implementation",
"sortings"
] | null | null | Everybody knows what an arithmetic progression is. Let us remind you just in case that an arithmetic progression is such sequence of numbers *a*1,<=*a*2,<=...,<=*a**n* of length *n*, that the following condition fulfills:
For example, sequences [1, 5], [10], [5, 4, 3] are arithmetic progressions and sequences [1, 3, 2], [1, 2, 4] are not.
Alexander has *n* cards containing integers. Arthur wants to give Alexander exactly one more card with a number so that he could use the resulting *n*<=+<=1 cards to make an arithmetic progression (Alexander has to use all of his cards).
Arthur has already bought a card but he hasn't written a number on it. Help him, print all integers that you can write on a card so that the described condition fulfilled. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of cards. The next line contains the sequence of integers — the numbers on Alexander's cards. The numbers are positive integers, each of them doesn't exceed 108. | If Arthur can write infinitely many distinct integers on the card, print on a single line -1.
Otherwise, print on the first line the number of integers that suit you. In the second line, print the numbers in the increasing order. Note that the numbers in the answer can exceed 108 or even be negative (see test samples). | [
"3\n4 1 7\n",
"1\n10\n",
"4\n1 3 5 9\n",
"4\n4 3 4 5\n",
"2\n2 4\n"
] | [
"2\n-2 10\n",
"-1\n",
"1\n7\n",
"0\n",
"3\n0 3 6\n"
] | none | 1,500 | [
{
"input": "3\n4 1 7",
"output": "2\n-2 10"
},
{
"input": "1\n10",
"output": "-1"
},
{
"input": "4\n1 3 5 9",
"output": "1\n7"
},
{
"input": "4\n4 3 4 5",
"output": "0"
},
{
"input": "2\n2 4",
"output": "3\n0 3 6"
},
{
"input": "4\n1 3 4 5",
"output": "1\n2"
},
{
"input": "2\n3 3",
"output": "1\n3"
},
{
"input": "2\n13 2",
"output": "2\n-9 24"
},
{
"input": "5\n2 2 2 2 2",
"output": "1\n2"
},
{
"input": "6\n11 1 7 9 5 13",
"output": "1\n3"
},
{
"input": "2\n100000000 1",
"output": "2\n-99999998 199999999"
},
{
"input": "5\n2 3 1 4 6",
"output": "1\n5"
},
{
"input": "5\n1 2 2 3 4",
"output": "0"
},
{
"input": "3\n1 4 2",
"output": "1\n3"
},
{
"input": "3\n8 8 8",
"output": "1\n8"
},
{
"input": "5\n2 2 2 2 3",
"output": "0"
},
{
"input": "1\n100000000",
"output": "-1"
},
{
"input": "20\n27 6 3 18 54 33 9 15 39 12 57 48 21 51 60 30 24 36 42 45",
"output": "2\n0 63"
},
{
"input": "40\n100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000 100000000",
"output": "1\n100000000"
},
{
"input": "49\n81787 163451 104059 89211 96635 133755 148603 141179 159739 122619 123 144891 70651 11259 63227 3835 44667 37243 100347 26107 137467 18683 156027 59515 22395 40955 111483 52091 7547 85499 107771 178299 115195 152315 74363 126331 33531 130043 14971 48379 167163 182011 170875 78075 174587 55803 66939 29819 118907",
"output": "1\n92923"
},
{
"input": "9\n1 2 3 3 4 4 5 5 6",
"output": "0"
},
{
"input": "7\n1 1 2 3 4 5 6",
"output": "0"
},
{
"input": "2\n4 1",
"output": "2\n-2 7"
},
{
"input": "2\n2 100000000",
"output": "3\n-99999996 50000001 199999998"
},
{
"input": "8\n1 2 3 4 11 12 13 14",
"output": "0"
},
{
"input": "7\n5 40 45 50 55 60 65",
"output": "0"
},
{
"input": "1\n1",
"output": "-1"
},
{
"input": "2\n1 1",
"output": "1\n1"
},
{
"input": "2\n100000000 2",
"output": "3\n-99999996 50000001 199999998"
},
{
"input": "3\n2 2 3",
"output": "0"
},
{
"input": "5\n1 3 5 9 13",
"output": "0"
},
{
"input": "5\n1 2 4 8 16",
"output": "0"
},
{
"input": "3\n2 2 5",
"output": "0"
},
{
"input": "5\n1 2 3 4 8",
"output": "0"
},
{
"input": "3\n1 3 4",
"output": "1\n2"
},
{
"input": "5\n1 2 4 6 7",
"output": "0"
},
{
"input": "4\n1 5 9 11",
"output": "0"
},
{
"input": "4\n3 4 5 9",
"output": "0"
},
{
"input": "4\n1 5 6 8",
"output": "0"
},
{
"input": "4\n2 6 8 12",
"output": "0"
},
{
"input": "5\n1 2 3 5 7",
"output": "0"
},
{
"input": "6\n1 2 3 4 6 8",
"output": "0"
}
] | 1,680,253,875 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 93 | 4,403,200 | from collections import Counter , defaultdict , deque
from bisect import bisect_left , bisect_right
from copy import deepcopy
from math import ceil , floor , sqrt , lcm , gcd , comb
from heapq import heapify , heappop , heappush , nlargest , nsmallest
from itertools import accumulate, combinations, permutations
from functools import reduce , lru_cache
def I():
return input()
def II():
return int(input())
def MI():
return map(int, input().split())
def LI():
return list(input().split())
def LII():
return list(map(int, input().split()))
def GMI():
return map(lambda x: int(x) - 1, input().split())
def LGMI():
return list(map(lambda x: int(x) - 1, input().split()))
def solve():
n = II()
a = LII()
if n == 1: print(-1) ; return 0
elif n == 2:
a.sort()
if (a[1] - a[0]) % 2 == 0 and (a[1] - a[0]) != 0:
print(3)
print(a[0] - (a[1] - a[0]) , (a[0] + a[1]) // 2 , a[1] + (a[1] - a[0]))
return 0
elif a[0] == a[1]:
print(1)
print(a[1])
return 0
else:
print(2)
print(a[0] - (a[1] - a[0]) , a[1] + (a[1] - a[0]))
return 0
a.sort()
area = set([a[i] - a[i - 1] for i in range(1 , n)])
if len(area) == 1 and area != {0} : print(2) ; print(a[0] - a[1] + a[0] , a[-1] + a[1] - a[0]) ; return 0
elif len(area) == 1 and area == {0} : print(1) ; print(a[0]) ; return 0
elif len(area) == 2 and max(area) == 2 * min(area):
print(1)
for i in range(1 , n):
if a[i] - a[i - 1] == 2 * min(area):
print(a[i - 1] + min(area))
return 0
else: print(-1) ; return 0
return 0
if __name__ == '__main__':
for _ in range(1):
solve() | Title: Arithmetic Progression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody knows what an arithmetic progression is. Let us remind you just in case that an arithmetic progression is such sequence of numbers *a*1,<=*a*2,<=...,<=*a**n* of length *n*, that the following condition fulfills:
For example, sequences [1, 5], [10], [5, 4, 3] are arithmetic progressions and sequences [1, 3, 2], [1, 2, 4] are not.
Alexander has *n* cards containing integers. Arthur wants to give Alexander exactly one more card with a number so that he could use the resulting *n*<=+<=1 cards to make an arithmetic progression (Alexander has to use all of his cards).
Arthur has already bought a card but he hasn't written a number on it. Help him, print all integers that you can write on a card so that the described condition fulfilled.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of cards. The next line contains the sequence of integers — the numbers on Alexander's cards. The numbers are positive integers, each of them doesn't exceed 108.
Output Specification:
If Arthur can write infinitely many distinct integers on the card, print on a single line -1.
Otherwise, print on the first line the number of integers that suit you. In the second line, print the numbers in the increasing order. Note that the numbers in the answer can exceed 108 or even be negative (see test samples).
Demo Input:
['3\n4 1 7\n', '1\n10\n', '4\n1 3 5 9\n', '4\n4 3 4 5\n', '2\n2 4\n']
Demo Output:
['2\n-2 10\n', '-1\n', '1\n7\n', '0\n', '3\n0 3 6\n']
Note:
none | ```python
from collections import Counter , defaultdict , deque
from bisect import bisect_left , bisect_right
from copy import deepcopy
from math import ceil , floor , sqrt , lcm , gcd , comb
from heapq import heapify , heappop , heappush , nlargest , nsmallest
from itertools import accumulate, combinations, permutations
from functools import reduce , lru_cache
def I():
return input()
def II():
return int(input())
def MI():
return map(int, input().split())
def LI():
return list(input().split())
def LII():
return list(map(int, input().split()))
def GMI():
return map(lambda x: int(x) - 1, input().split())
def LGMI():
return list(map(lambda x: int(x) - 1, input().split()))
def solve():
n = II()
a = LII()
if n == 1: print(-1) ; return 0
elif n == 2:
a.sort()
if (a[1] - a[0]) % 2 == 0 and (a[1] - a[0]) != 0:
print(3)
print(a[0] - (a[1] - a[0]) , (a[0] + a[1]) // 2 , a[1] + (a[1] - a[0]))
return 0
elif a[0] == a[1]:
print(1)
print(a[1])
return 0
else:
print(2)
print(a[0] - (a[1] - a[0]) , a[1] + (a[1] - a[0]))
return 0
a.sort()
area = set([a[i] - a[i - 1] for i in range(1 , n)])
if len(area) == 1 and area != {0} : print(2) ; print(a[0] - a[1] + a[0] , a[-1] + a[1] - a[0]) ; return 0
elif len(area) == 1 and area == {0} : print(1) ; print(a[0]) ; return 0
elif len(area) == 2 and max(area) == 2 * min(area):
print(1)
for i in range(1 , n):
if a[i] - a[i - 1] == 2 * min(area):
print(a[i - 1] + min(area))
return 0
else: print(-1) ; return 0
return 0
if __name__ == '__main__':
for _ in range(1):
solve()
``` | 0 | |
779 | C | Dishonest Sellers | PROGRAMMING | 1,200 | [
"constructive algorithms",
"greedy",
"sortings"
] | null | null | Igor found out discounts in a shop and decided to buy *n* items. Discounts at the store will last for a week and Igor knows about each item that its price now is *a**i*, and after a week of discounts its price will be *b**i*.
Not all of sellers are honest, so now some products could be more expensive than after a week of discounts.
Igor decided that buy at least *k* of items now, but wait with the rest of the week in order to save money as much as possible. Your task is to determine the minimum money that Igor can spend to buy all *n* items. | In the first line there are two positive integer numbers *n* and *k* (1<=≤<=*n*<=≤<=2·105, 0<=≤<=*k*<=≤<=*n*) — total number of items to buy and minimal number of items Igor wants to by right now.
The second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) — prices of items during discounts (i.e. right now).
The third line contains sequence of integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=104) — prices of items after discounts (i.e. after a week). | Print the minimal amount of money Igor will spend to buy all *n* items. Remember, he should buy at least *k* items right now. | [
"3 1\n5 4 6\n3 1 5\n",
"5 3\n3 4 7 10 3\n4 5 5 12 5\n"
] | [
"10\n",
"25\n"
] | In the first example Igor should buy item 3 paying 6. But items 1 and 2 he should buy after a week. He will pay 3 and 1 for them. So in total he will pay 6 + 3 + 1 = 10.
In the second example Igor should buy right now items 1, 2, 4 and 5, paying for them 3, 4, 10 and 3, respectively. Item 3 he should buy after a week of discounts, he will pay 5 for it. In total he will spend 3 + 4 + 10 + 3 + 5 = 25. | 1,000 | [
{
"input": "3 1\n5 4 6\n3 1 5",
"output": "10"
},
{
"input": "5 3\n3 4 7 10 3\n4 5 5 12 5",
"output": "25"
},
{
"input": "1 0\n9\n8",
"output": "8"
},
{
"input": "2 0\n4 10\n1 2",
"output": "3"
},
{
"input": "4 2\n19 5 17 13\n3 18 8 10",
"output": "29"
},
{
"input": "5 3\n28 17 20 45 45\n39 12 41 27 9",
"output": "101"
},
{
"input": "10 5\n87 96 19 81 10 88 7 49 36 21\n11 75 28 28 74 17 64 19 81 31",
"output": "243"
},
{
"input": "50 45\n80 125 152 122 85 62 123 195 157 73 8 127 47 193 70 132 131 38 98 97 185 98 68 166 114 53 144 106 141 106 191 123 44 199 35 18 84 169 46 52 129 102 155 130 63 169 116 145 154 41\n155 187 79 106 136 173 17 146 9 47 173 21 37 183 110 74 185 14 82 156 147 25 162 195 26 25 22 80 171 180 7 92 53 18 100 17 159 184 37 127 116 192 163 49 94 95 118 102 8 30",
"output": "4680"
},
{
"input": "5 2\n1 1 1 1 1\n2 2 2 2 2",
"output": "5"
},
{
"input": "5 2\n2 4 4 4 4\n3 1 1 1 1",
"output": "9"
},
{
"input": "6 3\n9 9 9 2 2 2\n6 6 6 1 1 1",
"output": "24"
},
{
"input": "5 3\n10 17 23 26 35\n7 18 18 29 32",
"output": "103"
},
{
"input": "2 1\n10 12\n5 6",
"output": "16"
}
] | 1,492,111,767 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 8 | 171 | 9,932,800 | '''input
5 3
3 4 7 10 3
4 5 5 12 5
'''
n, k = map(int, input().split())
a, b = list(map(int, input().split())), list(map(int, input().split()))
d = sorted([a[i] - b[i] for i in range(n)])
t = sum(d[:k])
while d[k] < 0:
t += d[k]
del d[k]
print(sum(b) + t)
| Title: Dishonest Sellers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Igor found out discounts in a shop and decided to buy *n* items. Discounts at the store will last for a week and Igor knows about each item that its price now is *a**i*, and after a week of discounts its price will be *b**i*.
Not all of sellers are honest, so now some products could be more expensive than after a week of discounts.
Igor decided that buy at least *k* of items now, but wait with the rest of the week in order to save money as much as possible. Your task is to determine the minimum money that Igor can spend to buy all *n* items.
Input Specification:
In the first line there are two positive integer numbers *n* and *k* (1<=≤<=*n*<=≤<=2·105, 0<=≤<=*k*<=≤<=*n*) — total number of items to buy and minimal number of items Igor wants to by right now.
The second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) — prices of items during discounts (i.e. right now).
The third line contains sequence of integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=104) — prices of items after discounts (i.e. after a week).
Output Specification:
Print the minimal amount of money Igor will spend to buy all *n* items. Remember, he should buy at least *k* items right now.
Demo Input:
['3 1\n5 4 6\n3 1 5\n', '5 3\n3 4 7 10 3\n4 5 5 12 5\n']
Demo Output:
['10\n', '25\n']
Note:
In the first example Igor should buy item 3 paying 6. But items 1 and 2 he should buy after a week. He will pay 3 and 1 for them. So in total he will pay 6 + 3 + 1 = 10.
In the second example Igor should buy right now items 1, 2, 4 and 5, paying for them 3, 4, 10 and 3, respectively. Item 3 he should buy after a week of discounts, he will pay 5 for it. In total he will spend 3 + 4 + 10 + 3 + 5 = 25. | ```python
'''input
5 3
3 4 7 10 3
4 5 5 12 5
'''
n, k = map(int, input().split())
a, b = list(map(int, input().split())), list(map(int, input().split()))
d = sorted([a[i] - b[i] for i in range(n)])
t = sum(d[:k])
while d[k] < 0:
t += d[k]
del d[k]
print(sum(b) + t)
``` | -1 | |
469 | A | I Wanna Be the Guy | PROGRAMMING | 800 | [
"greedy",
"implementation"
] | null | null | There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other? | The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*. | If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes). | [
"4\n3 1 2 3\n2 2 4\n",
"4\n3 1 2 3\n2 2 3\n"
] | [
"I become the guy.\n",
"Oh, my keyboard!\n"
] | In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4. | 500 | [
{
"input": "4\n3 1 2 3\n2 2 4",
"output": "I become the guy."
},
{
"input": "4\n3 1 2 3\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "10\n5 8 6 1 5 4\n6 1 3 2 9 4 6",
"output": "Oh, my keyboard!"
},
{
"input": "10\n8 8 10 7 3 1 4 2 6\n8 9 5 10 3 7 2 4 8",
"output": "I become the guy."
},
{
"input": "10\n9 6 1 8 3 9 7 5 10 4\n7 1 3 2 7 6 9 5",
"output": "I become the guy."
},
{
"input": "100\n75 83 69 73 30 76 37 48 14 41 42 21 35 15 50 61 86 85 46 3 31 13 78 10 2 44 80 95 56 82 38 75 77 4 99 9 84 53 12 11 36 74 39 72 43 89 57 28 54 1 51 66 27 22 93 59 68 88 91 29 7 20 63 8 52 23 64 58 100 79 65 49 96 71 33 45\n83 50 89 73 34 28 99 67 77 44 19 60 68 42 8 27 94 85 14 39 17 78 24 21 29 63 92 32 86 22 71 81 31 82 65 48 80 59 98 3 70 55 37 12 15 72 47 9 11 33 16 7 91 74 13 64 38 84 6 61 93 90 45 69 1 54 52 100 57 10 35 49 53 75 76 43 62 5 4 18 36 96 79 23",
"output": "Oh, my keyboard!"
},
{
"input": "1\n1 1\n1 1",
"output": "I become the guy."
},
{
"input": "1\n0\n1 1",
"output": "I become the guy."
},
{
"input": "1\n1 1\n0",
"output": "I become the guy."
},
{
"input": "1\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n44 71 70 55 49 43 16 53 7 95 58 56 38 76 67 94 20 73 29 90 25 30 8 84 5 14 77 52 99 91 66 24 39 37 22 44 78 12 63 59 32 51 15 82 34\n56 17 10 96 80 69 13 81 31 57 4 48 68 89 50 45 3 33 36 2 72 100 64 87 21 75 54 74 92 65 23 40 97 61 18 28 98 93 35 83 9 79 46 27 41 62 88 6 47 60 86 26 42 85 19 1 11",
"output": "I become the guy."
},
{
"input": "100\n78 63 59 39 11 58 4 2 80 69 22 95 90 26 65 16 30 100 66 99 67 79 54 12 23 28 45 56 70 74 60 82 73 91 68 43 92 75 51 21 17 97 86 44 62 47 85 78 72 64 50 81 71 5 57 13 31 76 87 9 49 96 25 42 19 35 88 53 7 83 38 27 29 41 89 93 10 84 18\n78 1 16 53 72 99 9 36 59 49 75 77 94 79 35 4 92 42 82 83 76 97 20 68 55 47 65 50 14 30 13 67 98 8 7 40 64 32 87 10 33 90 93 18 26 71 17 46 24 28 89 58 37 91 39 34 25 48 84 31 96 95 80 88 3 51 62 52 85 61 12 15 27 6 45 38 2 22 60",
"output": "I become the guy."
},
{
"input": "2\n2 2 1\n0",
"output": "I become the guy."
},
{
"input": "2\n1 2\n2 1 2",
"output": "I become the guy."
},
{
"input": "80\n57 40 1 47 36 69 24 76 5 72 26 4 29 62 6 60 3 70 8 64 18 37 16 14 13 21 25 7 66 68 44 74 61 39 38 33 15 63 34 65 10 23 56 51 80 58 49 75 71 12 50 57 2 30 54 27 17 52\n61 22 67 15 28 41 26 1 80 44 3 38 18 37 79 57 11 7 65 34 9 36 40 5 48 29 64 31 51 63 27 4 50 13 24 32 58 23 19 46 8 73 39 2 21 56 77 53 59 78 43 12 55 45 30 74 33 68 42 47 17 54",
"output": "Oh, my keyboard!"
},
{
"input": "100\n78 87 96 18 73 32 38 44 29 64 40 70 47 91 60 69 24 1 5 34 92 94 99 22 83 65 14 68 15 20 74 31 39 100 42 4 97 46 25 6 8 56 79 9 71 35 54 19 59 93 58 62 10 85 57 45 33 7 86 81 30 98 26 61 84 41 23 28 88 36 66 51 80 53 37 63 43 95 75\n76 81 53 15 26 37 31 62 24 87 41 39 75 86 46 76 34 4 51 5 45 65 67 48 68 23 71 27 94 47 16 17 9 96 84 89 88 100 18 52 69 42 6 92 7 64 49 12 98 28 21 99 25 55 44 40 82 19 36 30 77 90 14 43 50 3 13 95 78 35 20 54 58 11 2 1 33",
"output": "Oh, my keyboard!"
},
{
"input": "100\n77 55 26 98 13 91 78 60 23 76 12 11 36 62 84 80 18 1 68 92 81 67 19 4 2 10 17 77 96 63 15 69 46 97 82 42 83 59 50 72 14 40 89 9 52 29 56 31 74 39 45 85 22 99 44 65 95 6 90 38 54 32 49 34 3 70 75 33 94 53 21 71 5 66 73 41 100 24\n69 76 93 5 24 57 59 6 81 4 30 12 44 15 67 45 73 3 16 8 47 95 20 64 68 85 54 17 90 86 66 58 13 37 42 51 35 32 1 28 43 80 7 14 48 19 62 55 2 91 25 49 27 26 38 79 89 99 22 60 75 53 88 82 34 21 87 71 72 61",
"output": "I become the guy."
},
{
"input": "100\n74 96 32 63 12 69 72 99 15 22 1 41 79 77 71 31 20 28 75 73 85 37 38 59 42 100 86 89 55 87 68 4 24 57 52 8 92 27 56 98 95 58 34 9 45 14 11 36 66 76 61 19 25 23 78 49 90 26 80 43 70 13 65 10 5 74 81 21 44 60 97 3 47 93 6\n64 68 21 27 16 91 23 22 33 12 71 88 90 50 62 43 28 29 57 59 5 74 10 95 35 1 67 93 36 32 86 40 6 64 78 46 89 15 84 53 18 30 17 85 2 3 47 92 25 48 76 51 20 82 52 83 99 63 80 11 94 54 39 7 58",
"output": "I become the guy."
},
{
"input": "100\n75 11 98 44 47 88 94 23 78 59 70 2 43 39 34 63 71 19 42 61 30 74 14 77 97 53 92 60 67 36 37 13 6 86 62 46 41 3 25 93 7 12 27 48 55 49 31 35 51 10 57 54 95 82 28 90 73 26 17 50 81 56 20 87 40 85 72 64 99 29 91 5 80 18 24 52\n72 93 59 5 88 47 9 58 48 1 43 50 100 87 61 91 45 98 99 56 25 84 53 73 78 54 63 38 37 2 77 95 89 85 4 90 10 33 12 22 74 32 34 70 71 52 96 57 15 66 31 27 75 8 21 39 62 44 67 94 81 68 14 19 36 28 11 79 16 65 46 83 76",
"output": "Oh, my keyboard!"
},
{
"input": "3\n1 2\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "4\n1 2\n3 1 3 4",
"output": "I become the guy."
},
{
"input": "6\n2 1 2\n3 4 5 6",
"output": "Oh, my keyboard!"
}
] | 1,698,000,928 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 26 | 93 | 0 | d = int(input())
x,y = [[int(x) for x in input().split()] for i in range(2)]
f = True
for i in range(1,d+1):
if not (i in x or i in y):
f = False
break
if f :
print("I become the guy.")
else: print("Oh, my keyboard!") | Title: I Wanna Be the Guy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
Input Specification:
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
Output Specification:
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
Demo Input:
['4\n3 1 2 3\n2 2 4\n', '4\n3 1 2 3\n2 2 3\n']
Demo Output:
['I become the guy.\n', 'Oh, my keyboard!\n']
Note:
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4. | ```python
d = int(input())
x,y = [[int(x) for x in input().split()] for i in range(2)]
f = True
for i in range(1,d+1):
if not (i in x or i in y):
f = False
break
if f :
print("I become the guy.")
else: print("Oh, my keyboard!")
``` | 0 | |
817 | C | Really Big Numbers | PROGRAMMING | 1,600 | [
"binary search",
"brute force",
"dp",
"math"
] | null | null | Ivan likes to learn different things about numbers, but he is especially interested in really big numbers. Ivan thinks that a positive integer number *x* is really big if the difference between *x* and the sum of its digits (in decimal representation) is not less than *s*. To prove that these numbers may have different special properties, he wants to know how rare (or not rare) they are — in fact, he needs to calculate the quantity of really big numbers that are not greater than *n*.
Ivan tried to do the calculations himself, but soon realized that it's too difficult for him. So he asked you to help him in calculations. | The first (and the only) line contains two integers *n* and *s* (1<=≤<=*n*,<=*s*<=≤<=1018). | Print one integer — the quantity of really big numbers that are not greater than *n*. | [
"12 1\n",
"25 20\n",
"10 9\n"
] | [
"3\n",
"0\n",
"1\n"
] | In the first example numbers 10, 11 and 12 are really big.
In the second example there are no really big numbers that are not greater than 25 (in fact, the first really big number is 30: 30 - 3 ≥ 20).
In the third example 10 is the only really big number (10 - 1 ≥ 9). | 0 | [
{
"input": "12 1",
"output": "3"
},
{
"input": "25 20",
"output": "0"
},
{
"input": "10 9",
"output": "1"
},
{
"input": "300 1000",
"output": "0"
},
{
"input": "500 1000",
"output": "0"
},
{
"input": "1000 2000",
"output": "0"
},
{
"input": "10000 1000",
"output": "8991"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "0"
},
{
"input": "1000000000000000000 100000000000000000",
"output": "899999999999999991"
},
{
"input": "1000000000000000000 10000000000000000",
"output": "989999999999999991"
},
{
"input": "1000000000000000000 1000000000000000",
"output": "998999999999999991"
},
{
"input": "1000000000000000000 100000000000000",
"output": "999899999999999991"
},
{
"input": "1000000000000000000 200000000000000000",
"output": "799999999999999991"
},
{
"input": "10 5",
"output": "1"
},
{
"input": "20 5",
"output": "11"
},
{
"input": "20 9",
"output": "11"
},
{
"input": "100 9",
"output": "91"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "130 118",
"output": "1"
},
{
"input": "190 181",
"output": "0"
},
{
"input": "1999 1971",
"output": "10"
},
{
"input": "100 99",
"output": "1"
},
{
"input": "6909094398 719694282",
"output": "6189400069"
},
{
"input": "260 258",
"output": "0"
},
{
"input": "35 19",
"output": "6"
},
{
"input": "100 87",
"output": "1"
},
{
"input": "91 89",
"output": "0"
},
{
"input": "109 89",
"output": "10"
},
{
"input": "109 91",
"output": "10"
},
{
"input": "20331 11580",
"output": "8732"
},
{
"input": "405487470 255750281",
"output": "149737161"
},
{
"input": "17382 12863",
"output": "4493"
},
{
"input": "19725 14457",
"output": "5246"
},
{
"input": "24848 15384",
"output": "9449"
},
{
"input": "25727 15982",
"output": "9728"
},
{
"input": "109 90",
"output": "10"
},
{
"input": "1000000000000000000 999999999999999999",
"output": "1"
},
{
"input": "1000000000000000000 999999999999999998",
"output": "1"
},
{
"input": "1009 980",
"output": "10"
},
{
"input": "999999999999999999 999999999999999838",
"output": "0"
},
{
"input": "1000000000000000000 99999999999999800",
"output": "900000000000000061"
},
{
"input": "8785369357 3377262261",
"output": "5408107058"
},
{
"input": "110 109",
"output": "0"
},
{
"input": "999 777",
"output": "200"
},
{
"input": "327170000015578 77230000029054",
"output": "249939999986479"
},
{
"input": "12515000022229 1791000022317",
"output": "10723999999880"
},
{
"input": "9999999999999 9999999999882",
"output": "10"
},
{
"input": "213 196",
"output": "14"
},
{
"input": "92 82",
"output": "0"
},
{
"input": "148 136",
"output": "0"
},
{
"input": "8 9",
"output": "0"
},
{
"input": "309 299",
"output": "0"
},
{
"input": "9999 9963",
"output": "10"
},
{
"input": "82 81",
"output": "0"
},
{
"input": "9999999 9999936",
"output": "10"
},
{
"input": "171 155",
"output": "2"
},
{
"input": "999 972",
"output": "10"
},
{
"input": "999999999999 999999999891",
"output": "10"
},
{
"input": "9 9",
"output": "0"
},
{
"input": "6900 6885",
"output": "1"
},
{
"input": "96 57",
"output": "27"
},
{
"input": "5 4",
"output": "0"
},
{
"input": "17386 5814",
"output": "11557"
},
{
"input": "493679757404593 316259583979965",
"output": "177420173424564"
},
{
"input": "18474 9478",
"output": "8975"
},
{
"input": "270091571496186 250931112649966",
"output": "19160458846177"
},
{
"input": "565751690089037 381448507916936",
"output": "184303182172038"
},
{
"input": "19 10",
"output": "0"
}
] | 1,689,907,446 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 68 | 62 | 1,433,600 | n,s=map(int,input().split())
def cal(x):
global s
ls=list(map(int,str(x)))
if (int(x)-sum(ls))>=s:
return True
return False
l=1
r=10**18
while l<=r:
mid=(l+r)//2
if cal(mid):
r=mid-1
else:
l=mid+1
if l>n:
print(0)
else:
print(n-l+1) | Title: Really Big Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan likes to learn different things about numbers, but he is especially interested in really big numbers. Ivan thinks that a positive integer number *x* is really big if the difference between *x* and the sum of its digits (in decimal representation) is not less than *s*. To prove that these numbers may have different special properties, he wants to know how rare (or not rare) they are — in fact, he needs to calculate the quantity of really big numbers that are not greater than *n*.
Ivan tried to do the calculations himself, but soon realized that it's too difficult for him. So he asked you to help him in calculations.
Input Specification:
The first (and the only) line contains two integers *n* and *s* (1<=≤<=*n*,<=*s*<=≤<=1018).
Output Specification:
Print one integer — the quantity of really big numbers that are not greater than *n*.
Demo Input:
['12 1\n', '25 20\n', '10 9\n']
Demo Output:
['3\n', '0\n', '1\n']
Note:
In the first example numbers 10, 11 and 12 are really big.
In the second example there are no really big numbers that are not greater than 25 (in fact, the first really big number is 30: 30 - 3 ≥ 20).
In the third example 10 is the only really big number (10 - 1 ≥ 9). | ```python
n,s=map(int,input().split())
def cal(x):
global s
ls=list(map(int,str(x)))
if (int(x)-sum(ls))>=s:
return True
return False
l=1
r=10**18
while l<=r:
mid=(l+r)//2
if cal(mid):
r=mid-1
else:
l=mid+1
if l>n:
print(0)
else:
print(n-l+1)
``` | 3 | |
573 | B | Bear and Blocks | PROGRAMMING | 1,600 | [
"binary search",
"data structures",
"dp",
"math"
] | null | null | Limak is a little bear who loves to play. Today he is playing by destroying block towers. He built *n* towers in a row. The *i*-th tower is made of *h**i* identical blocks. For clarification see picture for the first sample.
Limak will repeat the following operation till everything is destroyed.
Block is called internal if it has all four neighbors, i.e. it has each side (top, left, down and right) adjacent to other block or to the floor. Otherwise, block is boundary. In one operation Limak destroys all boundary blocks. His paws are very fast and he destroys all those blocks at the same time.
Limak is ready to start. You task is to count how many operations will it take him to destroy all towers. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=109) — sizes of towers. | Print the number of operations needed to destroy all towers. | [
"6\n2 1 4 6 2 2\n",
"7\n3 3 3 1 3 3 3\n"
] | [
"3\n",
"2\n"
] | The picture below shows all three operations for the first sample test. Each time boundary blocks are marked with red color. | 1,000 | [
{
"input": "6\n2 1 4 6 2 2",
"output": "3"
},
{
"input": "7\n3 3 3 1 3 3 3",
"output": "2"
},
{
"input": "7\n5128 5672 5805 5452 5882 5567 5032",
"output": "4"
},
{
"input": "10\n1 2 2 3 5 5 5 4 2 1",
"output": "5"
},
{
"input": "14\n20 20 20 20 20 20 3 20 20 20 20 20 20 20",
"output": "5"
},
{
"input": "50\n3 2 4 3 5 3 4 5 3 2 3 3 3 4 5 4 2 2 3 3 4 4 3 2 3 3 2 3 4 4 5 2 5 2 3 5 4 4 2 2 3 5 2 5 2 2 5 4 5 4",
"output": "4"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1049 1098",
"output": "1"
},
{
"input": "2\n100 100",
"output": "1"
},
{
"input": "5\n1 2 3 2 1",
"output": "3"
},
{
"input": "15\n2 2 1 1 2 2 2 2 2 2 2 2 2 1 2",
"output": "2"
},
{
"input": "28\n415546599 415546599 415546599 415546599 415546599 415546599 415546599 415546599 415546599 2 802811737 802811737 802811737 802811737 802811737 802811737 802811737 802811737 1 550595901 550595901 550595901 550595901 550595901 550595901 550595901 550595901 550595901",
"output": "6"
},
{
"input": "45\n3 12 13 11 13 13 10 11 14 15 15 13 14 12 13 11 14 10 10 14 14 11 10 12 11 11 13 14 10 11 14 13 14 11 11 11 12 15 1 10 15 12 14 14 14",
"output": "13"
},
{
"input": "84\n1 3 4 5 6 5 6 7 8 9 7 4 5 4 2 5 1 1 1 3 2 7 7 8 10 9 5 6 5 2 3 3 3 3 3 2 4 8 6 5 8 9 8 7 9 3 4 4 4 2 2 1 6 4 9 5 9 9 10 7 10 4 5 4 2 4 3 3 4 4 6 6 6 9 10 12 7 5 9 8 5 3 3 2",
"output": "8"
},
{
"input": "170\n1 2 1 2 1 1 1 1 2 3 2 1 1 2 2 1 2 1 2 1 1 2 3 3 2 1 1 1 1 1 1 1 1 2 1 2 3 3 2 1 2 2 1 2 3 2 1 1 2 3 2 1 2 1 1 1 2 3 3 2 1 2 1 2 1 1 1 2 1 2 1 1 2 2 1 1 2 1 2 2 1 2 1 2 2 1 2 1 2 3 2 1 1 2 3 4 4 3 2 1 2 1 2 1 2 3 3 2 1 2 1 1 1 1 1 1 1 2 2 1 1 2 1 1 1 1 2 1 1 2 3 2 1 2 2 1 2 1 1 1 2 2 1 2 1 2 3 2 1 2 1 1 1 2 3 4 5 4 3 2 1 1 2 1 2 3 4 3 2 1",
"output": "5"
},
{
"input": "1\n5",
"output": "1"
}
] | 1,613,636,753 | 2,147,483,647 | PyPy 3 | OK | TESTS | 41 | 186 | 10,956,800 | from sys import stdin,stdout
nmbr = lambda: int(stdin.readline())
lst = lambda: list(map(int,stdin.readline().split()))
PI=float('inf')
for _ in range(1):#nmbr()):
n=nmbr()
a=lst()
ans=0
pre=[0]*n
suf=[0]*n
pre[0]=suf[n-1]=1
for i in range(1,n):
pre[i]=min(1+pre[i-1],a[i])
for i in range(n-2,-1,-1):
suf[i]=min(1+suf[i+1],a[i])
for pp,ss in zip(pre,suf):
ans=max(ans,min(pp,ss))
print(ans) | Title: Bear and Blocks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is a little bear who loves to play. Today he is playing by destroying block towers. He built *n* towers in a row. The *i*-th tower is made of *h**i* identical blocks. For clarification see picture for the first sample.
Limak will repeat the following operation till everything is destroyed.
Block is called internal if it has all four neighbors, i.e. it has each side (top, left, down and right) adjacent to other block or to the floor. Otherwise, block is boundary. In one operation Limak destroys all boundary blocks. His paws are very fast and he destroys all those blocks at the same time.
Limak is ready to start. You task is to count how many operations will it take him to destroy all towers.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=105).
The second line contains *n* space-separated integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=109) — sizes of towers.
Output Specification:
Print the number of operations needed to destroy all towers.
Demo Input:
['6\n2 1 4 6 2 2\n', '7\n3 3 3 1 3 3 3\n']
Demo Output:
['3\n', '2\n']
Note:
The picture below shows all three operations for the first sample test. Each time boundary blocks are marked with red color. | ```python
from sys import stdin,stdout
nmbr = lambda: int(stdin.readline())
lst = lambda: list(map(int,stdin.readline().split()))
PI=float('inf')
for _ in range(1):#nmbr()):
n=nmbr()
a=lst()
ans=0
pre=[0]*n
suf=[0]*n
pre[0]=suf[n-1]=1
for i in range(1,n):
pre[i]=min(1+pre[i-1],a[i])
for i in range(n-2,-1,-1):
suf[i]=min(1+suf[i+1],a[i])
for pp,ss in zip(pre,suf):
ans=max(ans,min(pp,ss))
print(ans)
``` | 3 | |
964 | A | Splits | PROGRAMMING | 800 | [
"math"
] | null | null | Let's define a split of $n$ as a nonincreasing sequence of positive integers, the sum of which is $n$.
For example, the following sequences are splits of $8$: $[4, 4]$, $[3, 3, 2]$, $[2, 2, 1, 1, 1, 1]$, $[5, 2, 1]$.
The following sequences aren't splits of $8$: $[1, 7]$, $[5, 4]$, $[11, -3]$, $[1, 1, 4, 1, 1]$.
The weight of a split is the number of elements in the split that are equal to the first element. For example, the weight of the split $[1, 1, 1, 1, 1]$ is $5$, the weight of the split $[5, 5, 3, 3, 3]$ is $2$ and the weight of the split $[9]$ equals $1$.
For a given $n$, find out the number of different weights of its splits. | The first line contains one integer $n$ ($1 \leq n \leq 10^9$). | Output one integer — the answer to the problem. | [
"7\n",
"8\n",
"9\n"
] | [
"4\n",
"5\n",
"5\n"
] | In the first sample, there are following possible weights of splits of $7$:
Weight 1: [$\textbf 7$]
Weight 2: [$\textbf 3$, $\textbf 3$, 1]
Weight 3: [$\textbf 2$, $\textbf 2$, $\textbf 2$, 1]
Weight 7: [$\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$] | 500 | [
{
"input": "7",
"output": "4"
},
{
"input": "8",
"output": "5"
},
{
"input": "9",
"output": "5"
},
{
"input": "1",
"output": "1"
},
{
"input": "286",
"output": "144"
},
{
"input": "48",
"output": "25"
},
{
"input": "941",
"output": "471"
},
{
"input": "45154",
"output": "22578"
},
{
"input": "60324",
"output": "30163"
},
{
"input": "91840",
"output": "45921"
},
{
"input": "41909",
"output": "20955"
},
{
"input": "58288",
"output": "29145"
},
{
"input": "91641",
"output": "45821"
},
{
"input": "62258",
"output": "31130"
},
{
"input": "79811",
"output": "39906"
},
{
"input": "88740",
"output": "44371"
},
{
"input": "12351",
"output": "6176"
},
{
"input": "1960",
"output": "981"
},
{
"input": "29239",
"output": "14620"
},
{
"input": "85801",
"output": "42901"
},
{
"input": "43255",
"output": "21628"
},
{
"input": "13439",
"output": "6720"
},
{
"input": "35668",
"output": "17835"
},
{
"input": "19122",
"output": "9562"
},
{
"input": "60169",
"output": "30085"
},
{
"input": "50588",
"output": "25295"
},
{
"input": "2467",
"output": "1234"
},
{
"input": "39315",
"output": "19658"
},
{
"input": "29950",
"output": "14976"
},
{
"input": "17286",
"output": "8644"
},
{
"input": "7359066",
"output": "3679534"
},
{
"input": "1016391",
"output": "508196"
},
{
"input": "7928871",
"output": "3964436"
},
{
"input": "3968891",
"output": "1984446"
},
{
"input": "2636452",
"output": "1318227"
},
{
"input": "5076901",
"output": "2538451"
},
{
"input": "9870265",
"output": "4935133"
},
{
"input": "2453786",
"output": "1226894"
},
{
"input": "7263670",
"output": "3631836"
},
{
"input": "1890845",
"output": "945423"
},
{
"input": "574128507",
"output": "287064254"
},
{
"input": "648476655",
"output": "324238328"
},
{
"input": "97349542",
"output": "48674772"
},
{
"input": "716489761",
"output": "358244881"
},
{
"input": "858771038",
"output": "429385520"
},
{
"input": "520778784",
"output": "260389393"
},
{
"input": "439004204",
"output": "219502103"
},
{
"input": "589992198",
"output": "294996100"
},
{
"input": "371106544",
"output": "185553273"
},
{
"input": "894241590",
"output": "447120796"
},
{
"input": "123957268",
"output": "61978635"
},
{
"input": "234149297",
"output": "117074649"
},
{
"input": "789954052",
"output": "394977027"
},
{
"input": "667978920",
"output": "333989461"
},
{
"input": "154647261",
"output": "77323631"
},
{
"input": "751453521",
"output": "375726761"
},
{
"input": "848862308",
"output": "424431155"
},
{
"input": "323926781",
"output": "161963391"
},
{
"input": "576768825",
"output": "288384413"
},
{
"input": "31293802",
"output": "15646902"
},
{
"input": "2",
"output": "2"
},
{
"input": "1000000000",
"output": "500000001"
},
{
"input": "3",
"output": "2"
}
] | 1,524,138,466 | 2,147,483,647 | Python 3 | OK | TESTS | 63 | 108 | 7,065,600 | inp = int(input())
print(int(inp/2)+1) | Title: Splits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's define a split of $n$ as a nonincreasing sequence of positive integers, the sum of which is $n$.
For example, the following sequences are splits of $8$: $[4, 4]$, $[3, 3, 2]$, $[2, 2, 1, 1, 1, 1]$, $[5, 2, 1]$.
The following sequences aren't splits of $8$: $[1, 7]$, $[5, 4]$, $[11, -3]$, $[1, 1, 4, 1, 1]$.
The weight of a split is the number of elements in the split that are equal to the first element. For example, the weight of the split $[1, 1, 1, 1, 1]$ is $5$, the weight of the split $[5, 5, 3, 3, 3]$ is $2$ and the weight of the split $[9]$ equals $1$.
For a given $n$, find out the number of different weights of its splits.
Input Specification:
The first line contains one integer $n$ ($1 \leq n \leq 10^9$).
Output Specification:
Output one integer — the answer to the problem.
Demo Input:
['7\n', '8\n', '9\n']
Demo Output:
['4\n', '5\n', '5\n']
Note:
In the first sample, there are following possible weights of splits of $7$:
Weight 1: [$\textbf 7$]
Weight 2: [$\textbf 3$, $\textbf 3$, 1]
Weight 3: [$\textbf 2$, $\textbf 2$, $\textbf 2$, 1]
Weight 7: [$\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$, $\textbf 1$] | ```python
inp = int(input())
print(int(inp/2)+1)
``` | 3 | |
792 | F | Mages and Monsters | PROGRAMMING | 3,100 | [
"data structures",
"geometry"
] | null | null | Vova plays a computer game known as Mages and Monsters. Vova's character is a mage. Though as he has just started, his character knows no spells.
Vova's character can learn new spells during the game. Every spell is characterized by two values *x**i* and *y**i* — damage per second and mana cost per second, respectively. Vova doesn't have to use a spell for an integer amount of seconds. More formally, if he uses a spell with damage *x* and mana cost *y* for *z* seconds, then he will deal *x*·*z* damage and spend *y*·*z* mana (no rounding). If there is no mana left (mana amount is set in the start of the game and it remains the same at the beginning of every fight), then character won't be able to use any spells. It is prohibited to use multiple spells simultaneously.
Also Vova can fight monsters. Every monster is characterized by two values *t**j* and *h**j* — monster kills Vova's character in *t**j* seconds and has *h**j* health points. Mana refills after every fight (or Vova's character revives with full mana reserve), so previous fights have no influence on further ones.
Vova's character kills a monster, if he deals *h**j* damage to it in no more than *t**j* seconds using his spells (it is allowed to use more than one spell in a fight) and spending no more mana than he had at the beginning of the fight. If monster's health becomes zero exactly in *t**j* seconds (it means that the monster and Vova's character kill each other at the same time), then Vova wins the fight.
You have to write a program which can answer two types of queries:
- 1 *x* *y* — Vova's character learns new spell which deals *x* damage per second and costs *y* mana per second. - 2 *t* *h* — Vova fights the monster which kills his character in *t* seconds and has *h* health points.
Note that queries are given in a different form. Also remember that Vova's character knows no spells at the beginning of the game.
For every query of second type you have to determine if Vova is able to win the fight with corresponding monster. | The first line contains two integer numbers *q* and *m* (2<=≤<=*q*<=≤<=105,<=1<=≤<=*m*<=≤<=1012) — the number of queries and the amount of mana at the beginning of every fight.
*i*-th of each next *q* lines contains three numbers *k**i*, *a**i* and *b**i* (1<=≤<=*k**i*<=≤<=2,<=1<=≤<=*a**i*,<=*b**i*<=≤<=106).
Using them you can restore queries this way: let *j* be the index of the last query of second type with positive answer (*j*<==<=0 if there were none of these).
- If *k**i*<==<=1, then character learns spell with *x*<==<=(*a**i*<=+<=*j*) *mod* 106<=+<=1, *y*<==<=(*b**i*<=+<=*j*) *mod* 106<=+<=1. - If *k**i*<==<=2, then you have to determine if Vova is able to win the fight against monster with *t*<==<=(*a**i*<=+<=*j*) *mod* 106<=+<=1, *h*<==<=(*b**i*<=+<=*j*) *mod* 106<=+<=1. | For every query of second type print YES if Vova is able to win the fight with corresponding monster and NO otherwise. | [
"3 100\n1 4 9\n2 19 49\n2 19 49\n"
] | [
"YES\nNO\n"
] | In first example Vova's character at first learns the spell with 5 damage and 10 mana cost per second. Next query is a fight with monster which can kill character in 20 seconds and has 50 health points. Vova kills it in 10 seconds (spending 100 mana). Next monster has 52 health, so Vova can't deal that much damage with only 100 mana. | 0 | [
{
"input": "3 100\n1 4 9\n2 19 49\n2 19 49",
"output": "YES\nNO"
},
{
"input": "10 442006988299\n2 10 47\n1 9 83\n1 15 24\n2 19 47\n2 75 99\n2 85 23\n2 8 33\n2 9 82\n1 86 49\n2 71 49",
"output": "NO\nYES\nYES\nYES\nYES\nYES\nYES"
},
{
"input": "2 424978864039\n2 7 3\n2 10 8",
"output": "NO\nNO"
},
{
"input": "3 10\n1 1 1\n2 1 1\n2 999999 999999",
"output": "YES\nYES"
},
{
"input": "12 100\n1 8 8\n2 200 101\n2 10 99\n1 9 9\n2 10 99\n2 200 101\n1 14 4\n2 194 195\n2 194 194\n2 990 290\n2 999991 11\n2 999991 10",
"output": "NO\nNO\nYES\nNO\nNO\nYES\nNO\nNO\nYES"
},
{
"input": "15 100\n1 8 8\n2 200 101\n2 10 99\n1 9 9\n2 10 99\n2 200 101\n1 14 4\n2 194 195\n2 194 194\n2 990 290\n1 2 999992\n2 6 256\n2 7 256\n1 2 999988\n2 2 252",
"output": "NO\nNO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nYES"
},
{
"input": "3 12\n1 99 9\n1 49 1\n2 1 149",
"output": "YES"
}
] | 1,492,103,917 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 34 | 966 | 5,529,600 | def check_battle(t, h, m, spell_1, spell_2):
x1, y1 = spell_1
x2, y2 = spell_2
if y1 * h <= x1 * m and h <= x1 * t:
return True
if y2 * h <= x2 * m and h <= x2 * t:
return True
return False
def main():
q, m = map(int, input().split())
spell_1 = None
spell_2 = None
j = 0
for i in range(q):
kind, a, b = map(int, input().split())
a = (a + j) % int(1e6) + 1
b = (b + j) % int(1e6) + 1
if kind == 1:
x, y = a, b
if spell_1 is None and spell_2 is None:
spell_1 = spell_2 = (x, y)
else:
x1, y1 = spell_1
if x > x1:
spell_1 = (x, y)
x2, y2 = spell_2
if x * y2 > x2 * y:
spell_2 = (x, y)
else:
t, h = a, b
if spell_1 is None and spell_2 is None:
print("NO")
else:
result = check_battle(t, h, m, spell_1, spell_2)
if result:
print("YES")
j = i + 1
else:
print("NO")
if __name__ == '__main__':
# import sys
# sys.stdin = open("F.txt")
main()
| Title: Mages and Monsters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vova plays a computer game known as Mages and Monsters. Vova's character is a mage. Though as he has just started, his character knows no spells.
Vova's character can learn new spells during the game. Every spell is characterized by two values *x**i* and *y**i* — damage per second and mana cost per second, respectively. Vova doesn't have to use a spell for an integer amount of seconds. More formally, if he uses a spell with damage *x* and mana cost *y* for *z* seconds, then he will deal *x*·*z* damage and spend *y*·*z* mana (no rounding). If there is no mana left (mana amount is set in the start of the game and it remains the same at the beginning of every fight), then character won't be able to use any spells. It is prohibited to use multiple spells simultaneously.
Also Vova can fight monsters. Every monster is characterized by two values *t**j* and *h**j* — monster kills Vova's character in *t**j* seconds and has *h**j* health points. Mana refills after every fight (or Vova's character revives with full mana reserve), so previous fights have no influence on further ones.
Vova's character kills a monster, if he deals *h**j* damage to it in no more than *t**j* seconds using his spells (it is allowed to use more than one spell in a fight) and spending no more mana than he had at the beginning of the fight. If monster's health becomes zero exactly in *t**j* seconds (it means that the monster and Vova's character kill each other at the same time), then Vova wins the fight.
You have to write a program which can answer two types of queries:
- 1 *x* *y* — Vova's character learns new spell which deals *x* damage per second and costs *y* mana per second. - 2 *t* *h* — Vova fights the monster which kills his character in *t* seconds and has *h* health points.
Note that queries are given in a different form. Also remember that Vova's character knows no spells at the beginning of the game.
For every query of second type you have to determine if Vova is able to win the fight with corresponding monster.
Input Specification:
The first line contains two integer numbers *q* and *m* (2<=≤<=*q*<=≤<=105,<=1<=≤<=*m*<=≤<=1012) — the number of queries and the amount of mana at the beginning of every fight.
*i*-th of each next *q* lines contains three numbers *k**i*, *a**i* and *b**i* (1<=≤<=*k**i*<=≤<=2,<=1<=≤<=*a**i*,<=*b**i*<=≤<=106).
Using them you can restore queries this way: let *j* be the index of the last query of second type with positive answer (*j*<==<=0 if there were none of these).
- If *k**i*<==<=1, then character learns spell with *x*<==<=(*a**i*<=+<=*j*) *mod* 106<=+<=1, *y*<==<=(*b**i*<=+<=*j*) *mod* 106<=+<=1. - If *k**i*<==<=2, then you have to determine if Vova is able to win the fight against monster with *t*<==<=(*a**i*<=+<=*j*) *mod* 106<=+<=1, *h*<==<=(*b**i*<=+<=*j*) *mod* 106<=+<=1.
Output Specification:
For every query of second type print YES if Vova is able to win the fight with corresponding monster and NO otherwise.
Demo Input:
['3 100\n1 4 9\n2 19 49\n2 19 49\n']
Demo Output:
['YES\nNO\n']
Note:
In first example Vova's character at first learns the spell with 5 damage and 10 mana cost per second. Next query is a fight with monster which can kill character in 20 seconds and has 50 health points. Vova kills it in 10 seconds (spending 100 mana). Next monster has 52 health, so Vova can't deal that much damage with only 100 mana. | ```python
def check_battle(t, h, m, spell_1, spell_2):
x1, y1 = spell_1
x2, y2 = spell_2
if y1 * h <= x1 * m and h <= x1 * t:
return True
if y2 * h <= x2 * m and h <= x2 * t:
return True
return False
def main():
q, m = map(int, input().split())
spell_1 = None
spell_2 = None
j = 0
for i in range(q):
kind, a, b = map(int, input().split())
a = (a + j) % int(1e6) + 1
b = (b + j) % int(1e6) + 1
if kind == 1:
x, y = a, b
if spell_1 is None and spell_2 is None:
spell_1 = spell_2 = (x, y)
else:
x1, y1 = spell_1
if x > x1:
spell_1 = (x, y)
x2, y2 = spell_2
if x * y2 > x2 * y:
spell_2 = (x, y)
else:
t, h = a, b
if spell_1 is None and spell_2 is None:
print("NO")
else:
result = check_battle(t, h, m, spell_1, spell_2)
if result:
print("YES")
j = i + 1
else:
print("NO")
if __name__ == '__main__':
# import sys
# sys.stdin = open("F.txt")
main()
``` | 0 | |
932 | A | Palindromic Supersequence | PROGRAMMING | 800 | [
"constructive algorithms"
] | null | null | You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. | First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*. | Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them. | [
"aba\n",
"ab\n"
] | [
"aba",
"aabaa"
] | In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome. | 500 | [
{
"input": "aba",
"output": "abaaba"
},
{
"input": "ab",
"output": "abba"
},
{
"input": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpa",
"output": "krnyoixirslfszfqivgkaflgkctvbvksipwomqxlyqxhlbceuhbjbfnhofcgpgwdseffycthmlpcqejgskwjkbkbbmifnurnwyhevsoqzmtvzgfiqajfrgyuzxnrtxectcnlyoisbglpdbjbslxlpoymrcxmdtqhcnlvtqdwftuzgbdxsyscwbrguostbelnvtaqdmkmihmoxqtqlxvlsssisvqvvzotoyqryuyqwoknnqcqggysrqpkrccvyhxsjmhoqoyocwcriplarjoyiqrmmpmueqbsbljddwrumauczfziodpudheexalbwpiypmdjlmwtgdrzhpxneofhqzjdmurgvmrwdotuwyknlrbvuvtnhiouvqitgyfgfieonbaapyhwpcrmehxcpkijzfiayfvoxkpaapkxovfyaifzjikpcxhemrcpwhypaabnoeifgfygtiqvuoihntvuvbrlnkywutodwrmvgrumdjzqhfoenxphzrdgtwmljdm..."
},
{
"input": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadco",
"output": "mgrfmzxqpejcixxppqgvuawutgrmezjkteofjbnrvzzkvjtacfxjjokisavsgrslryxfqgrmdsqwptajbqzvethuljbdatxghfzqrwvfgakwmoawlzqjypmhllbbuuhbpriqsnibywlgjlxowyzagrfnqafvcqwktkcjwejevzbnxhsfmwojshcdypnvbuhhuzqmgovmvgwiizatoxgblyudipahfbkewmuneoqhjmbpdtwnznblwvtjrniwlbyblhppndspojrouffazpoxtqdfpjuhitvijrohavpqatofxwmksvjcvhdecxwwmosqiczjpkfafqlboxosnjgzgdraehzdltthemeusxhiiimrdrugabnxwsygsktkcslhjebfexucsyvlwrptebkjhefsvfrmcqqdlanbetrgzwylizmrystvpgrkhlicfadcoocdafcilhkrgpvtsyrmzilywzgrtebnaldqqcmrfvsfehjkbetprwlvyscuxef..."
},
{
"input": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxar",
"output": "hdmasfcjuigrwjchmjslmpynewnzpphmudzcbxzdexjuhktdtcoibzvevsmwaxakrtdfoivkvoooypyemiidadquqepxwqkesdnakxkbzrcjkgvwwxtqxvfpxcwitljyehldgsjytmekimkkndjvnzqtjykiymkmdzpwakxdtkzcqcatlevppgfhyykgmipuodjrnfjzhcmjdbzvhywprbwdcfxiffpzbjbmbyijkqnosslqbfvvicxvoeuzruraetglthgourzhfpnubzvblfzmmbgepjjyshchthulxarraxluhthchsyjjpegbmmzflbvzbunpfhzruoghtlgtearurzueovxcivvfbqlssonqkjiybmbjbzpffixfcdwbrpwyhvzbdjmchzjfnrjdoupimgkyyhfgppveltacqczktdxkawpzdmkmyikyjtqznvjdnkkmikemtyjsgdlheyjltiwcxpfvxqtxwwvgkjcrzbkxkandsekqwxpequ..."
},
{
"input": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjg",
"output": "fggbyzobbmxtwdajawqdywnppflkkmtxzjvxopqvliwdwhzepcuiwelhbuotlkvesexnwkytonfrpqcxzzqzdvsmbsjcxxeugavekozfjlolrtqgwzqxsfgrnvrgfrqpixhsskbpzghndesvwptpvvkasfalzsetopervpwzmkgpcexqnvtnoulprwnowmsorscecvvvrjfwumcjqyrounqsgdruxttvtmrkivtxauhosokdiahsyrftzsgvgyveqwkzhqstbgywrvmsgfcfyuxpphvmyydzpohgdicoxbtjnsbyhoidnkrialowvlvmjpxcfeygqzphmbcjkupojsmmuqlydixbaluwezvnfasjfxilbyllwyipsmovdzosuwotcxerzcfuvxprtziseshjfcosalyqglpotxvxaanpocypsiyazsejjoximnbvqucftuvdksaxutvjeunodbipsumlaymjnzljurefjggjferujlznjmyalmuspib..."
},
{
"input": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgm",
"output": "qyyxqkbxsvfnjzttdqmpzinbdgayllxpfrpopwciejjjzadguurnnhvixgueukugkkjyghxknedojvmdrskswiotgatsajowionuiumuhyggjuoympuxyfahwftwufvocdguxmxabbxnfviscxtilzzauizsgugwcqtbqgoosefhkumhodwpgolfdkbuiwlzjydonwbgyzzrjwxnceltqgqelrrljmzdbftmaogiuosaqhngmdzxzlmyrwefzhqawmkdckfnyyjgdjgadtfjvrkdwysqofcgyqrnyzutycvspzbjmmesobvhshtqlrytztyieknnkporrbcmlopgtknlmsstzkigreqwgsvagmvbrvwypoxttmzzsgmmgszzmttxopywvrbvmgavsgwqergikztssmlnktgpolmcbrropknnkeiytztyrlqthshvbosemmjbzpsvcytuzynrqygcfoqsywdkrvjftdagjdgjyynfkcdkmwaqhzfewry..."
},
{
"input": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyj",
"output": "scvlhflaqvniyiyofonowwcuqajuwscdrzhbvasymvqfnthzvtjcfuaftrbjghhvslcohwpxkggrbtatjtgehuqtorwinwvrtdldyoeeozxwippuahgkuehvsmyqtodqvlufqqmqautaqirvwzvtodzxtgxiinubhrbeoiybidutrqamsdnasctxatzkvkjkrmavdravnsxyngjlugwftmhmcvvxdbfndurrbmcpuoigjpssqcortmqoqttrabhoqvopjkxvpbqdqsilvlplhgqazauyvnodsxtwnomlinjpozwhrgrkqwmlwcwdkxjxjftexiavwrejvdjcfptterblxysjcheesyqsbgdrzjxbfjqgjgmvccqcyjjycqccvmgjgqjfbxjzrdgbsqyseehcjsyxlbrettpfcjdvjerwvaixetfjxjxkdwcwlmwqkrgrhwzopjnilmonwtxsdonvyuazaqghlplvlisqdqbpvxkjpovqohbarttqoqm..."
},
{
"input": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgd",
"output": "oohkqxxtvxzmvfjjxyjwlbqmeqwwlienzkdbhswgfbkhfygltsucdijozwaiewpixapyazfztksjeoqjugjfhdbqzuezbuajfvvffkwprroyivfoocvslejffgxuiofisenroxoeixmdbzonmreikpflciwsbafrdqfvdfojgoziiibqhwwsvhnzmptgirqqulkgmyzrfekzqqujmdumxkudsgexisupedisgmdgebvlvrpyfrbrqjknrxyzfpwmsxjxismgddgmsixjxsmwpfzyxrnkjqrbrfyprvlvbegdmgsidepusixegsdukxmudmjuqqzkefrzymgkluqqrigtpmznhvswwhqbiiizogjofdvfqdrfabswiclfpkiermnozbdmxieoxornesifoiuxgffjelsvcoofviyorrpwkffvvfjaubzeuzqbdhfjgujqoejsktzfzaypaxipweiawzojidcustlgyfhkbfgwshbdkzneilwwqemqblw..."
},
{
"input": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohlig",
"output": "gilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlwzjyeyfktduzdjnivcldjjarfzmmdbyytvipbbnjqolfnlqjpidotxxfobgtgpvjmpddcyddwdcjsxxumuoyznhpvpqccgqnuouzojntanfwctthcgynrukcvshsuuqrxfdvqqggaatwytikkitywtaaggqqvdfxrquushsvckurnygchttcwfnatnjozuounqgccqpvphnzyoumuxxsjcdwddycddpmjvpgtgbofxxtodipjqlnfloqjnbbpivtyybdmmzfrajjdlcvinjdzudtkfyeyjzwlzcnrgkdxrnjwyfwtnzawmeljknllaqhrgdagttixpljuupcivnlejkemrqnafdigjzxiohliggilhoixzjgidfanqrmekjelnvicpuujlpxittgadgrhqallnkjlemwazntwfywjnrxdkgrnczlw..."
},
{
"input": "abcab",
"output": "abcabbacba"
},
{
"input": "baaaaaaa",
"output": "baaaaaaaaaaaaaab"
},
{
"input": "baaaaaa",
"output": "baaaaaaaaaaaab"
},
{
"input": "baaaaaaaaa",
"output": "baaaaaaaaaaaaaaaaaab"
},
{
"input": "baaaaaaaa",
"output": "baaaaaaaaaaaaaaaab"
}
] | 1,518,712,258 | 6,958 | Python 3 | OK | TESTS | 48 | 358 | 10,035,200 | # -*- coding: utf-8 -*-
"""
Created on Thu Feb 15 21:01:05 2018
@author: DNARNAprotein
"""
"""
CODEFORCES
http://codeforces.com/contest/932/problem/A
"""
def pikachu(a,c,n): #c is original string
prefixes=[a[0:i+1] for i in range(n+1)]
suffixes=[a[i:n+1] for i in range(n+1)]
maxi=0
for i in range(n//2):
for j in suffixes:
if prefixes[i]==j:
maxi=i+1
ans=c[maxi::][::-1]+c
l=len(ans)
return ((ans,l))
a=input()
c=a
b=a[::-1]+'#'+a
a=a+'#'+a[::-1]
n=len(c*2)
x=pikachu(a,c,n)
c=c[::-1]
y=pikachu(b,c,n)
if x[1]<y[1]:
print(x[0])
else:
print(y[0]) | Title: Palindromic Supersequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *A*. Find a string *B*, where *B* is a palindrome and *A* is a subsequence of *B*.
A subsequence of a string is a string that can be derived from it by deleting some (not necessarily consecutive) characters without changing the order of the remaining characters. For example, "cotst" is a subsequence of "contest".
A palindrome is a string that reads the same forward or backward.
The length of string *B* should be at most 104. It is guaranteed that there always exists such string.
You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104.
Input Specification:
First line contains a string *A* (1<=≤<=|*A*|<=≤<=103) consisting of lowercase Latin letters, where |*A*| is a length of *A*.
Output Specification:
Output single line containing *B* consisting of only lowercase Latin letters. You do not need to find the shortest answer, the only restriction is that the length of string *B* should not exceed 104. If there are many possible *B*, print any of them.
Demo Input:
['aba\n', 'ab\n']
Demo Output:
['aba', 'aabaa']
Note:
In the first example, "aba" is a subsequence of "aba" which is a palindrome.
In the second example, "ab" is a subsequence of "aabaa" which is a palindrome. | ```python
# -*- coding: utf-8 -*-
"""
Created on Thu Feb 15 21:01:05 2018
@author: DNARNAprotein
"""
"""
CODEFORCES
http://codeforces.com/contest/932/problem/A
"""
def pikachu(a,c,n): #c is original string
prefixes=[a[0:i+1] for i in range(n+1)]
suffixes=[a[i:n+1] for i in range(n+1)]
maxi=0
for i in range(n//2):
for j in suffixes:
if prefixes[i]==j:
maxi=i+1
ans=c[maxi::][::-1]+c
l=len(ans)
return ((ans,l))
a=input()
c=a
b=a[::-1]+'#'+a
a=a+'#'+a[::-1]
n=len(c*2)
x=pikachu(a,c,n)
c=c[::-1]
y=pikachu(b,c,n)
if x[1]<y[1]:
print(x[0])
else:
print(y[0])
``` | 3 | |
817 | A | Treasure Hunt | PROGRAMMING | 1,200 | [
"implementation",
"math",
"number theory"
] | null | null | Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times. | The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle. | Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes). | [
"0 0 0 6\n2 3\n",
"1 1 3 6\n1 5\n"
] | [
"YES\n",
"NO\n"
] | In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move | 0 | [
{
"input": "0 0 0 6\n2 3",
"output": "YES"
},
{
"input": "1 1 3 6\n1 5",
"output": "NO"
},
{
"input": "5 4 6 -10\n1 1",
"output": "NO"
},
{
"input": "6 -3 -7 -7\n1 2",
"output": "NO"
},
{
"input": "2 -5 -8 8\n2 1",
"output": "YES"
},
{
"input": "70 -81 -17 80\n87 23",
"output": "YES"
},
{
"input": "41 366 218 -240\n3456 1234",
"output": "NO"
},
{
"input": "-61972 -39646 -42371 -24854\n573 238",
"output": "NO"
},
{
"input": "-84870 -42042 94570 98028\n8972 23345",
"output": "YES"
},
{
"input": "-58533 -50999 -1007 -59169\n8972 23345",
"output": "NO"
},
{
"input": "-100000 -100000 100000 100000\n100000 100000",
"output": "YES"
},
{
"input": "-100000 -100000 100000 100000\n1 1",
"output": "YES"
},
{
"input": "5 2 5 3\n1 1",
"output": "NO"
},
{
"input": "5 5 5 5\n5 5",
"output": "YES"
},
{
"input": "0 0 1000 1000\n1 1",
"output": "YES"
},
{
"input": "0 0 0 1\n1 1",
"output": "NO"
},
{
"input": "1 1 4 4\n2 2",
"output": "NO"
},
{
"input": "100000 100000 99999 99999\n100000 100000",
"output": "NO"
},
{
"input": "1 1 1 6\n1 5",
"output": "NO"
},
{
"input": "2 9 4 0\n2 3",
"output": "YES"
},
{
"input": "0 0 0 9\n2 3",
"output": "NO"
},
{
"input": "14 88 14 88\n100 500",
"output": "YES"
},
{
"input": "-1 0 3 0\n4 4",
"output": "NO"
},
{
"input": "0 0 8 9\n2 3",
"output": "NO"
},
{
"input": "-2 5 7 -6\n1 1",
"output": "YES"
},
{
"input": "3 7 -8 8\n2 2",
"output": "NO"
},
{
"input": "-4 -8 -6 -1\n1 3",
"output": "NO"
},
{
"input": "0 8 6 2\n1 1",
"output": "YES"
},
{
"input": "-5 -2 -8 -2\n1 1",
"output": "NO"
},
{
"input": "1 4 -5 0\n1 1",
"output": "YES"
},
{
"input": "8 -4 4 -7\n1 2",
"output": "NO"
},
{
"input": "5 2 2 4\n2 2",
"output": "NO"
},
{
"input": "2 0 -4 6\n1 2",
"output": "NO"
},
{
"input": "-2 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "-6 5 10 6\n2 4",
"output": "NO"
},
{
"input": "3 -7 1 -8\n1 2",
"output": "NO"
},
{
"input": "4 1 4 -4\n9 4",
"output": "NO"
},
{
"input": "9 -3 -9 -3\n2 2",
"output": "NO"
},
{
"input": "-6 -6 -10 -5\n6 7",
"output": "NO"
},
{
"input": "-5 -2 2 2\n1 7",
"output": "NO"
},
{
"input": "9 0 8 1\n7 10",
"output": "NO"
},
{
"input": "-1 6 -7 -6\n6 4",
"output": "YES"
},
{
"input": "2 2 -3 -3\n3 1",
"output": "NO"
},
{
"input": "2 -6 7 2\n2 1",
"output": "NO"
},
{
"input": "-6 2 -7 -7\n1 2",
"output": "NO"
},
{
"input": "-5 -5 -1 -5\n2 2",
"output": "YES"
},
{
"input": "0 5 3 -6\n2 2",
"output": "NO"
},
{
"input": "0 -6 2 -1\n1 1",
"output": "NO"
},
{
"input": "-6 6 -5 -4\n1 2",
"output": "YES"
},
{
"input": "7 -7 1 -7\n2 2",
"output": "NO"
},
{
"input": "99966 -99952 -99966 99923\n1 1",
"output": "NO"
},
{
"input": "99921 99980 -99956 -99907\n3 4",
"output": "NO"
},
{
"input": "100000 100000 -100000 -100000\n1 1",
"output": "YES"
},
{
"input": "1 0 2 0\n5 1",
"output": "NO"
},
{
"input": "-3 0 -8 0\n7 2",
"output": "NO"
},
{
"input": "-9 4 -5 -1\n8 2",
"output": "NO"
},
{
"input": "-99999 -100000 100000 100000\n1 1",
"output": "NO"
},
{
"input": "0 0 -100 -100\n2 2",
"output": "YES"
},
{
"input": "9 -5 -3 -2\n1 4",
"output": "NO"
},
{
"input": "1 -10 -10 5\n7 5",
"output": "NO"
},
{
"input": "6 -9 -1 -9\n1 9",
"output": "NO"
}
] | 1,497,539,500 | 400 | Python 3 | WRONG_ANSWER | TESTS | 4 | 61 | 0 | from sys import stdin, stdout
x1, y1, x2, y2 = map(int, stdin.readline().split())
a, b = map(int, stdin.readline().split())
x, y = abs(x2 - x1), abs(y2 - y1)
if x % a or y % b:
stdout.write('NO')
elif (x % (2 * a)) % 2 == (y % (2 * b)) % 2:
stdout.write('YES')
else:
stdout.write('NO') | Title: Treasure Hunt
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Captain Bill the Hummingbird and his crew recieved an interesting challenge offer. Some stranger gave them a map, potion of teleportation and said that only this potion might help them to reach the treasure.
Bottle with potion has two values *x* and *y* written on it. These values define four moves which can be performed using the potion:
- - - -
Map shows that the position of Captain Bill the Hummingbird is (*x*1,<=*y*1) and the position of the treasure is (*x*2,<=*y*2).
You task is to tell Captain Bill the Hummingbird whether he should accept this challenge or decline. If it is possible for Captain to reach the treasure using the potion then output "YES", otherwise "NO" (without quotes).
The potion can be used infinite amount of times.
Input Specification:
The first line contains four integer numbers *x*1,<=*y*1,<=*x*2,<=*y*2 (<=-<=105<=≤<=*x*1,<=*y*1,<=*x*2,<=*y*2<=≤<=105) — positions of Captain Bill the Hummingbird and treasure respectively.
The second line contains two integer numbers *x*,<=*y* (1<=≤<=*x*,<=*y*<=≤<=105) — values on the potion bottle.
Output Specification:
Print "YES" if it is possible for Captain to reach the treasure using the potion, otherwise print "NO" (without quotes).
Demo Input:
['0 0 0 6\n2 3\n', '1 1 3 6\n1 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example there exists such sequence of moves:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7c939890fb4ed35688177327dac981bfa9216c00.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the first type of move 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/afbfa42fbac4e0641e7466e3aac74cbbb08ed597.png" style="max-width: 100.0%;max-height: 100.0%;"/> — the third type of move | ```python
from sys import stdin, stdout
x1, y1, x2, y2 = map(int, stdin.readline().split())
a, b = map(int, stdin.readline().split())
x, y = abs(x2 - x1), abs(y2 - y1)
if x % a or y % b:
stdout.write('NO')
elif (x % (2 * a)) % 2 == (y % (2 * b)) % 2:
stdout.write('YES')
else:
stdout.write('NO')
``` | 0 | |
258 | A | Little Elephant and Bits | PROGRAMMING | 1,100 | [
"greedy",
"math"
] | null | null | The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation. | The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits. | In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem. | [
"101\n",
"110010\n"
] | [
"11\n",
"11010\n"
] | In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | 500 | [
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
] | 1,607,159,485 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 404 | 1,740,800 | a = list(input())
if a.count('0') > 0:
a.remove('0')
else:
a.remove('1')
print(*a,sep='')
| Title: Little Elephant and Bits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>. | ```python
a = list(input())
if a.count('0') > 0:
a.remove('0')
else:
a.remove('1')
print(*a,sep='')
``` | 3 |
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.