contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
626
|
C
|
Block Towers
|
PROGRAMMING
| 1,600
|
[
"brute force",
"greedy",
"math",
"number theory"
] | null | null |
Students in a class are making towers of blocks. Each student makes a (non-zero) tower by stacking pieces lengthwise on top of each other. *n* of the students use pieces made of two blocks and *m* of the students use pieces made of three blocks.
The students don’t want to use too many blocks, but they also want to be unique, so no two students’ towers may contain the same number of blocks. Find the minimum height necessary for the tallest of the students' towers.
|
The first line of the input contains two space-separated integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=1<=000<=000, *n*<=+<=*m*<=><=0) — the number of students using two-block pieces and the number of students using three-block pieces, respectively.
|
Print a single integer, denoting the minimum possible height of the tallest tower.
|
[
"1 3\n",
"3 2\n",
"5 0\n"
] |
[
"9\n",
"8\n",
"10\n"
] |
In the first case, the student using two-block pieces can make a tower of height 4, and the students using three-block pieces can make towers of height 3, 6, and 9 blocks. The tallest tower has a height of 9 blocks.
In the second case, the students can make towers of heights 2, 4, and 8 with two-block pieces and towers of heights 3 and 6 with three-block pieces, for a maximum height of 8 blocks.
| 1,000
|
[
{
"input": "1 3",
"output": "9"
},
{
"input": "3 2",
"output": "8"
},
{
"input": "5 0",
"output": "10"
},
{
"input": "4 2",
"output": "9"
},
{
"input": "0 1000000",
"output": "3000000"
},
{
"input": "1000000 1",
"output": "2000000"
},
{
"input": "1083 724",
"output": "2710"
},
{
"input": "1184 868",
"output": "3078"
},
{
"input": "1285 877",
"output": "3243"
},
{
"input": "820189 548173",
"output": "2052543"
},
{
"input": "968867 651952",
"output": "2431228"
},
{
"input": "817544 553980",
"output": "2057286"
},
{
"input": "813242 543613",
"output": "2035282"
},
{
"input": "961920 647392",
"output": "2413968"
},
{
"input": "825496 807050",
"output": "2448819"
},
{
"input": "974174 827926",
"output": "2703150"
},
{
"input": "969872 899794",
"output": "2804499"
},
{
"input": "818549 720669",
"output": "2308827"
},
{
"input": "967227 894524",
"output": "2792626"
},
{
"input": "185253 152723",
"output": "506964"
},
{
"input": "195173 150801",
"output": "518961"
},
{
"input": "129439 98443",
"output": "341823"
},
{
"input": "163706 157895",
"output": "482402"
},
{
"input": "197973 140806",
"output": "508168"
},
{
"input": "1000000 1000000",
"output": "3000000"
},
{
"input": "1000000 999999",
"output": "2999998"
},
{
"input": "999999 1000000",
"output": "3000000"
},
{
"input": "500000 500100",
"output": "1500300"
},
{
"input": "500000 166000",
"output": "1000000"
},
{
"input": "500000 499000",
"output": "1498500"
},
{
"input": "500000 167000",
"output": "1000500"
},
{
"input": "1 1000000",
"output": "3000000"
},
{
"input": "2 999123",
"output": "2997369"
},
{
"input": "10 988723",
"output": "2966169"
},
{
"input": "234 298374",
"output": "895122"
},
{
"input": "2365 981235",
"output": "2943705"
},
{
"input": "12345 981732",
"output": "2945196"
},
{
"input": "108752 129872",
"output": "389616"
},
{
"input": "984327 24352",
"output": "1968654"
},
{
"input": "928375 1253",
"output": "1856750"
},
{
"input": "918273 219",
"output": "1836546"
},
{
"input": "987521 53",
"output": "1975042"
},
{
"input": "123456 1",
"output": "246912"
},
{
"input": "789123 0",
"output": "1578246"
},
{
"input": "143568 628524",
"output": "1885572"
},
{
"input": "175983 870607",
"output": "2611821"
},
{
"input": "6 4",
"output": "15"
},
{
"input": "6 3",
"output": "14"
},
{
"input": "7 3",
"output": "15"
},
{
"input": "5 4",
"output": "14"
},
{
"input": "5 3",
"output": "12"
},
{
"input": "8 5",
"output": "20"
},
{
"input": "1 0",
"output": "2"
},
{
"input": "19170 15725",
"output": "52342"
},
{
"input": "3000 2000",
"output": "7500"
},
{
"input": "7 4",
"output": "16"
},
{
"input": "50 30",
"output": "120"
},
{
"input": "300 200",
"output": "750"
},
{
"input": "9 4",
"output": "20"
},
{
"input": "4 3",
"output": "10"
},
{
"input": "1 1",
"output": "3"
},
{
"input": "8 6",
"output": "21"
},
{
"input": "10 6",
"output": "24"
},
{
"input": "65 56",
"output": "182"
},
{
"input": "13 10",
"output": "34"
},
{
"input": "14 42",
"output": "126"
},
{
"input": "651 420",
"output": "1606"
},
{
"input": "8 9",
"output": "27"
},
{
"input": "15 10",
"output": "38"
},
{
"input": "999999 888888",
"output": "2833330"
},
{
"input": "192056 131545",
"output": "485402"
},
{
"input": "32 16",
"output": "72"
},
{
"input": "18 12",
"output": "45"
},
{
"input": "1000000 666667",
"output": "2500000"
},
{
"input": "0 1",
"output": "3"
},
{
"input": "9 5",
"output": "21"
},
{
"input": "1515 1415",
"output": "4395"
},
{
"input": "300000 200000",
"output": "750000"
}
] | 1,455,388,490
| 3,590
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 3
| 61
| 0
|
def main():
n, m = map(int, input().split())
s = 0
i = 0
while i < n:
s += 2
if m > 0 and s % 3 == 0:
m -= 1
else:
i += 1
if m > 0:
s = max(m * 3, s)
print(s)
main()
|
Title: Block Towers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Students in a class are making towers of blocks. Each student makes a (non-zero) tower by stacking pieces lengthwise on top of each other. *n* of the students use pieces made of two blocks and *m* of the students use pieces made of three blocks.
The students don’t want to use too many blocks, but they also want to be unique, so no two students’ towers may contain the same number of blocks. Find the minimum height necessary for the tallest of the students' towers.
Input Specification:
The first line of the input contains two space-separated integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=1<=000<=000, *n*<=+<=*m*<=><=0) — the number of students using two-block pieces and the number of students using three-block pieces, respectively.
Output Specification:
Print a single integer, denoting the minimum possible height of the tallest tower.
Demo Input:
['1 3\n', '3 2\n', '5 0\n']
Demo Output:
['9\n', '8\n', '10\n']
Note:
In the first case, the student using two-block pieces can make a tower of height 4, and the students using three-block pieces can make towers of height 3, 6, and 9 blocks. The tallest tower has a height of 9 blocks.
In the second case, the students can make towers of heights 2, 4, and 8 with two-block pieces and towers of heights 3 and 6 with three-block pieces, for a maximum height of 8 blocks.
|
```python
def main():
n, m = map(int, input().split())
s = 0
i = 0
while i < n:
s += 2
if m > 0 and s % 3 == 0:
m -= 1
else:
i += 1
if m > 0:
s = max(m * 3, s)
print(s)
main()
```
| 0
|
|
577
|
A
|
Multiplication Table
|
PROGRAMMING
| 1,000
|
[
"implementation",
"number theory"
] | null | null |
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1.
You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
|
The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table.
|
Print a single number: the number of times *x* occurs in the table.
|
[
"10 5\n",
"6 12\n",
"5 13\n"
] |
[
"2\n",
"4\n",
"0\n"
] |
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
| 500
|
[
{
"input": "10 5",
"output": "2"
},
{
"input": "6 12",
"output": "4"
},
{
"input": "5 13",
"output": "0"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "1 1000000000",
"output": "0"
},
{
"input": "100000 1000000000",
"output": "16"
},
{
"input": "100000 362880",
"output": "154"
},
{
"input": "1 4",
"output": "0"
},
{
"input": "9 12",
"output": "4"
},
{
"input": "10 123",
"output": "0"
},
{
"input": "9551 975275379",
"output": "0"
},
{
"input": "17286 948615687",
"output": "0"
},
{
"input": "58942 936593001",
"output": "0"
},
{
"input": "50000 989460910",
"output": "4"
},
{
"input": "22741 989460910",
"output": "0"
},
{
"input": "22740 989460910",
"output": "0"
},
{
"input": "100000 989460910",
"output": "4"
},
{
"input": "100000 98280",
"output": "128"
},
{
"input": "100000 997920",
"output": "222"
},
{
"input": "100000 720720",
"output": "226"
},
{
"input": "100000 2162160",
"output": "282"
},
{
"input": "100000 4324320",
"output": "320"
},
{
"input": "100000 8648640",
"output": "348"
},
{
"input": "100000 183783600",
"output": "438"
},
{
"input": "100000 551350800",
"output": "392"
},
{
"input": "40000 551350800",
"output": "150"
},
{
"input": "20000 400000000",
"output": "1"
},
{
"input": "19999 400000000",
"output": "0"
},
{
"input": "19999 399960001",
"output": "1"
},
{
"input": "31621 999887641",
"output": "1"
},
{
"input": "31622 999887641",
"output": "1"
},
{
"input": "31620 999887641",
"output": "0"
},
{
"input": "100000 999887641",
"output": "3"
},
{
"input": "100000 25",
"output": "3"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "100000 3628800",
"output": "220"
},
{
"input": "100000 39916800",
"output": "328"
},
{
"input": "100000 479001600",
"output": "254"
},
{
"input": "4 9",
"output": "1"
},
{
"input": "2 6",
"output": "0"
},
{
"input": "20 100",
"output": "3"
},
{
"input": "10 3",
"output": "2"
},
{
"input": "4 4",
"output": "3"
},
{
"input": "2 4",
"output": "1"
},
{
"input": "89874 1",
"output": "1"
}
] | 1,691,259,252
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 61
| 0
|
n,x=list(map(int,input().split()))
f=[]
i=1
while i*i<=x:
if x%i==0:
f.append((i,x//i,))
i+=1
ans=0
for i,j in f:
if i<=n and j<=n:
ans+=1
print(ans)
|
Title: Multiplication Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's consider a table consisting of *n* rows and *n* columns. The cell located at the intersection of *i*-th row and *j*-th column contains number *i*<=×<=*j*. The rows and columns are numbered starting from 1.
You are given a positive integer *x*. Your task is to count the number of cells in a table that contain number *x*.
Input Specification:
The single line contains numbers *n* and *x* (1<=≤<=*n*<=≤<=105, 1<=≤<=*x*<=≤<=109) — the size of the table and the number that we are looking for in the table.
Output Specification:
Print a single number: the number of times *x* occurs in the table.
Demo Input:
['10 5\n', '6 12\n', '5 13\n']
Demo Output:
['2\n', '4\n', '0\n']
Note:
A table for the second sample test is given below. The occurrences of number 12 are marked bold.
|
```python
n,x=list(map(int,input().split()))
f=[]
i=1
while i*i<=x:
if x%i==0:
f.append((i,x//i,))
i+=1
ans=0
for i,j in f:
if i<=n and j<=n:
ans+=1
print(ans)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
International Abbreviation Olympiad takes place annually starting from 1989. Each year the competition receives an abbreviation of form IAO'y, where *y* stands for some number of consequent last digits of the current year. Organizers always pick an abbreviation with non-empty string *y* that has never been used before. Among all such valid abbreviations they choose the shortest one and announce it to be the abbreviation of this year's competition.
For example, the first three Olympiads (years 1989, 1990 and 1991, respectively) received the abbreviations IAO'9, IAO'0 and IAO'1, while the competition in 2015 received an abbreviation IAO'15, as IAO'5 has been already used in 1995.
You are given a list of abbreviations. For each of them determine the year it stands for.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of abbreviations to process.
Then *n* lines follow, each containing a single abbreviation. It's guaranteed that each abbreviation contains at most nine digits.
|
For each abbreviation given in the input, find the year of the corresponding Olympiad.
|
[
"5\nIAO'15\nIAO'2015\nIAO'1\nIAO'9\nIAO'0\n",
"4\nIAO'9\nIAO'99\nIAO'999\nIAO'9999\n"
] |
[
"2015\n12015\n1991\n1989\n1990\n",
"1989\n1999\n2999\n9999\n"
] |
none
| 0
|
[
{
"input": "5\nIAO'15\nIAO'2015\nIAO'1\nIAO'9\nIAO'0",
"output": "2015\n12015\n1991\n1989\n1990"
},
{
"input": "4\nIAO'9\nIAO'99\nIAO'999\nIAO'9999",
"output": "1989\n1999\n2999\n9999"
},
{
"input": "1\nIAO'111110",
"output": "1111110"
},
{
"input": "2\nIAO'0\nIAO'00",
"output": "1990\n2000"
},
{
"input": "1\nIAO'111111",
"output": "1111111"
},
{
"input": "1\nIAO'111111111",
"output": "1111111111"
},
{
"input": "1\nIAO'001",
"output": "3001"
},
{
"input": "1\nIAO'2000",
"output": "12000"
},
{
"input": "1\nIAO'11109999",
"output": "111109999"
},
{
"input": "1\nIAO'11111",
"output": "111111"
},
{
"input": "1\nIAO'100000",
"output": "1100000"
},
{
"input": "1\nIAO'18999990",
"output": "18999990"
},
{
"input": "1\nIAO'113098",
"output": "1113098"
},
{
"input": "1\nIAO'111122",
"output": "1111122"
},
{
"input": "1\nIAO'1110222",
"output": "11110222"
},
{
"input": "1\nIAO'11133333",
"output": "11133333"
},
{
"input": "1\nIAO'000000000",
"output": "1000000000"
},
{
"input": "4\nIAO'3098\nIAO'99\nIAO'999\nIAO'9999",
"output": "13098\n1999\n2999\n9999"
},
{
"input": "1\nIAO'11100000",
"output": "111100000"
},
{
"input": "2\nIAO'15\nIAO'15",
"output": "2015\n2015"
},
{
"input": "1\nIAO'999999999",
"output": "999999999"
},
{
"input": "1\nIAO'1112121",
"output": "11112121"
},
{
"input": "1\nIAO'111113098",
"output": "1111113098"
},
{
"input": "1\nIAO'10005000",
"output": "110005000"
},
{
"input": "1\nIAO'111378",
"output": "1111378"
},
{
"input": "1\nIAO'112222",
"output": "1112222"
},
{
"input": "1\nIAO'021113099",
"output": "1021113099"
},
{
"input": "1\nIAO'123456789",
"output": "123456789"
},
{
"input": "1\nIAO'000000001",
"output": "1000000001"
},
{
"input": "1\nIAO'089",
"output": "3089"
},
{
"input": "9\nIAO'0\nIAO'00\nIAO'000\nIAO'0000\nIAO'00000\nIAO'000000\nIAO'0000000\nIAO'00000000\nIAO'000000000",
"output": "1990\n2000\n3000\n10000\n100000\n1000000\n10000000\n100000000\n1000000000"
},
{
"input": "2\nIAO'999999999\nIAO'999999999",
"output": "999999999\n999999999"
},
{
"input": "1\nIAO'2015",
"output": "12015"
},
{
"input": "1\nIAO'113097",
"output": "1113097"
},
{
"input": "1\nIAO'11378",
"output": "111378"
}
] | 1,689,598,579
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
print("_RANDOM_GUESS_1689598579.7954633")# 1689598579.795484
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
International Abbreviation Olympiad takes place annually starting from 1989. Each year the competition receives an abbreviation of form IAO'y, where *y* stands for some number of consequent last digits of the current year. Organizers always pick an abbreviation with non-empty string *y* that has never been used before. Among all such valid abbreviations they choose the shortest one and announce it to be the abbreviation of this year's competition.
For example, the first three Olympiads (years 1989, 1990 and 1991, respectively) received the abbreviations IAO'9, IAO'0 and IAO'1, while the competition in 2015 received an abbreviation IAO'15, as IAO'5 has been already used in 1995.
You are given a list of abbreviations. For each of them determine the year it stands for.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of abbreviations to process.
Then *n* lines follow, each containing a single abbreviation. It's guaranteed that each abbreviation contains at most nine digits.
Output Specification:
For each abbreviation given in the input, find the year of the corresponding Olympiad.
Demo Input:
["5\nIAO'15\nIAO'2015\nIAO'1\nIAO'9\nIAO'0\n", "4\nIAO'9\nIAO'99\nIAO'999\nIAO'9999\n"]
Demo Output:
['2015\n12015\n1991\n1989\n1990\n', '1989\n1999\n2999\n9999\n']
Note:
none
|
```python
print("_RANDOM_GUESS_1689598579.7954633")# 1689598579.795484
```
| 0
|
|
445
|
B
|
DZY Loves Chemistry
|
PROGRAMMING
| 1,400
|
[
"dfs and similar",
"dsu",
"greedy"
] | null | null |
DZY loves chemistry, and he enjoys mixing chemicals.
DZY has *n* chemicals, and *m* pairs of them will react. He wants to pour these chemicals into a test tube, and he needs to pour them in one by one, in any order.
Let's consider the danger of a test tube. Danger of an empty test tube is 1. And every time when DZY pours a chemical, if there are already one or more chemicals in the test tube that can react with it, the danger of the test tube will be multiplied by 2. Otherwise the danger remains as it is.
Find the maximum possible danger after pouring all the chemicals one by one in optimal order.
|
The first line contains two space-separated integers *n* and *m* .
Each of the next *m* lines contains two space-separated integers *x**i* and *y**i* (1<=≤<=*x**i*<=<<=*y**i*<=≤<=*n*). These integers mean that the chemical *x**i* will react with the chemical *y**i*. Each pair of chemicals will appear at most once in the input.
Consider all the chemicals numbered from 1 to *n* in some order.
|
Print a single integer — the maximum possible danger.
|
[
"1 0\n",
"2 1\n1 2\n",
"3 2\n1 2\n2 3\n"
] |
[
"1\n",
"2\n",
"4\n"
] |
In the first sample, there's only one way to pour, and the danger won't increase.
In the second sample, no matter we pour the 1st chemical first, or pour the 2nd chemical first, the answer is always 2.
In the third sample, there are four ways to achieve the maximum possible danger: 2-1-3, 2-3-1, 1-2-3 and 3-2-1 (that is the numbers of the chemicals in order of pouring).
| 1,000
|
[
{
"input": "1 0",
"output": "1"
},
{
"input": "2 1\n1 2",
"output": "2"
},
{
"input": "3 2\n1 2\n2 3",
"output": "4"
},
{
"input": "10 10\n1 8\n4 10\n4 6\n5 10\n2 3\n1 7\n3 4\n3 6\n6 9\n3 7",
"output": "512"
},
{
"input": "20 20\n6 8\n13 20\n7 13\n6 17\n5 15\n1 12\n2 15\n5 17\n5 14\n6 14\n12 20\n7 20\n1 6\n1 7\n2 19\n14 17\n1 10\n11 15\n9 18\n2 12",
"output": "32768"
},
{
"input": "30 30\n7 28\n16 26\n14 24\n16 18\n20 29\n4 28\n19 21\n8 26\n1 25\n14 22\n13 23\n4 15\n15 16\n2 19\n29 30\n12 20\n3 4\n3 26\n3 11\n22 27\n5 16\n2 24\n2 18\n7 16\n17 21\n17 25\n8 15\n23 27\n12 21\n5 30",
"output": "67108864"
},
{
"input": "40 40\n28 33\n15 21\n12 29\n14 31\n2 26\n3 12\n25 34\n6 30\n6 25\n5 28\n9 17\n23 29\n30 36\n3 21\n35 37\n7 25\n29 39\n15 19\n12 35\n24 34\n15 25\n19 33\n26 31\n7 29\n1 40\n11 27\n6 9\n6 27\n36 39\n10 14\n6 16\n23 25\n2 38\n3 24\n30 31\n29 30\n4 12\n11 13\n14 40\n22 39",
"output": "34359738368"
},
{
"input": "50 50\n16 21\n23 47\n23 30\n2 12\n23 41\n3 16\n14 20\n4 49\n2 47\n19 29\n13 42\n5 8\n24 38\n13 32\n34 37\n38 46\n3 20\n27 50\n7 42\n33 45\n2 48\n41 47\n9 48\n15 26\n27 37\n32 34\n17 24\n1 39\n27 30\n10 33\n38 47\n32 33\n14 39\n35 50\n2 19\n3 12\n27 34\n18 25\n12 23\n31 44\n5 35\n28 45\n38 39\n13 44\n34 38\n16 46\n5 15\n26 30\n47 49\n2 10",
"output": "4398046511104"
},
{
"input": "50 0",
"output": "1"
},
{
"input": "50 7\n16 32\n31 34\n4 16\n4 39\n1 50\n43 49\n1 33",
"output": "128"
},
{
"input": "7 20\n2 3\n3 6\n1 6\n1 2\n3 5\n1 7\n4 5\n4 7\n1 3\n2 6\n2 7\n4 6\n3 4\n1 4\n3 7\n1 5\n2 5\n5 6\n5 7\n2 4",
"output": "64"
},
{
"input": "5 4\n1 2\n2 3\n3 4\n4 5",
"output": "16"
},
{
"input": "10 7\n1 2\n2 3\n1 5\n2 7\n7 8\n1 9\n9 10",
"output": "128"
},
{
"input": "20 15\n1 3\n3 4\n3 5\n4 6\n1 7\n1 8\n1 9\n7 11\n8 12\n5 13\n3 16\n1 17\n3 18\n1 19\n17 20",
"output": "32768"
},
{
"input": "30 24\n2 3\n3 4\n1 5\n4 6\n6 7\n1 8\n1 9\n4 10\n9 11\n5 12\n6 13\n10 14\n14 15\n12 16\n14 17\n2 18\n8 19\n3 20\n10 21\n11 24\n3 25\n1 26\n7 27\n4 29",
"output": "16777216"
},
{
"input": "40 28\n1 2\n2 4\n3 5\n1 7\n1 8\n7 9\n6 10\n7 11\n2 12\n9 13\n11 15\n12 16\n1 18\n10 19\n7 21\n7 23\n20 25\n24 27\n14 28\n9 29\n23 30\n27 31\n11 34\n21 35\n32 36\n23 38\n7 39\n20 40",
"output": "268435456"
},
{
"input": "50 41\n1 2\n1 3\n2 4\n1 5\n2 7\n4 8\n7 9\n2 11\n10 13\n11 14\n12 15\n14 16\n4 19\n7 20\n14 21\n8 23\n16 24\n16 25\n16 26\n19 27\n2 28\n3 29\n21 30\n12 31\n20 32\n23 33\n30 34\n6 35\n34 36\n34 37\n33 38\n34 40\n30 41\n3 42\n39 43\n5 44\n8 45\n40 46\n20 47\n31 49\n34 50",
"output": "2199023255552"
},
{
"input": "50 39\n1 2\n1 4\n5 6\n4 7\n5 8\n7 9\n9 10\n10 11\n2 12\n8 14\n11 15\n11 17\n3 18\n13 19\n17 20\n7 21\n6 22\n22 23\n14 24\n22 25\n23 26\n26 27\n27 28\n15 29\n8 30\n26 31\n32 33\n21 35\n14 36\n30 37\n17 38\n12 40\n11 42\n14 43\n12 44\n1 45\n29 46\n22 47\n47 50",
"output": "549755813888"
},
{
"input": "50 38\n1 2\n2 3\n3 4\n3 5\n4 7\n5 10\n9 11\n9 12\n11 13\n12 14\n6 15\n8 16\n2 18\n15 19\n3 20\n10 21\n4 22\n9 24\n2 25\n23 26\n3 28\n20 29\n14 30\n4 32\n24 33\n20 36\n1 38\n19 39\n39 40\n22 41\n18 42\n19 43\n40 45\n45 46\n9 47\n6 48\n9 49\n25 50",
"output": "274877906944"
},
{
"input": "50 41\n1 3\n1 4\n2 5\n2 7\n1 8\n2 10\n4 11\n5 12\n12 13\n4 14\n10 17\n1 18\n1 21\n5 22\n14 23\n19 24\n13 25\n3 26\n11 27\n6 28\n26 29\n21 30\n17 31\n15 32\n1 33\n12 34\n23 36\n6 37\n15 38\n37 39\n31 40\n15 41\n25 42\n19 43\n20 44\n32 45\n44 46\n31 47\n2 48\n32 49\n27 50",
"output": "2199023255552"
},
{
"input": "50 47\n1 2\n1 3\n1 4\n1 5\n5 6\n2 7\n2 8\n2 9\n2 10\n8 11\n5 12\n11 13\n10 14\n6 15\n9 16\n1 17\n1 18\n8 19\n5 20\n5 21\n11 22\n2 23\n22 24\n24 25\n5 26\n21 27\n27 28\n8 29\n2 30\n4 31\n11 32\n17 33\n22 34\n25 35\n28 36\n28 37\n11 38\n17 39\n19 42\n6 43\n11 44\n29 45\n2 46\n24 47\n7 48\n3 49\n44 50",
"output": "140737488355328"
},
{
"input": "11 20\n3 6\n2 6\n2 9\n4 5\n9 11\n6 8\n5 6\n1 6\n4 11\n9 10\n5 10\n4 6\n3 8\n2 3\n1 7\n1 11\n2 7\n1 3\n3 7\n1 8",
"output": "1024"
},
{
"input": "26 17\n1 2\n2 3\n1 6\n6 7\n7 8\n2 9\n4 10\n3 11\n11 12\n9 13\n6 14\n2 16\n5 18\n6 19\n11 22\n15 24\n6 26",
"output": "131072"
},
{
"input": "48 43\n1 2\n1 3\n3 4\n4 5\n2 6\n5 7\n7 9\n4 10\n6 11\n3 12\n6 13\n3 14\n6 15\n13 16\n4 17\n12 18\n18 19\n1 20\n1 21\n16 22\n9 23\n3 24\n22 25\n2 26\n10 27\n18 28\n13 30\n3 31\n24 33\n29 34\n15 35\n16 36\n23 37\n21 38\n34 39\n37 40\n39 41\n19 42\n15 43\n23 44\n22 45\n14 47\n10 48",
"output": "8796093022208"
},
{
"input": "8 5\n1 2\n1 3\n1 4\n5 6\n7 8",
"output": "32"
},
{
"input": "8 7\n1 2\n2 3\n3 4\n1 4\n5 6\n6 7\n7 8",
"output": "64"
}
] | 1,682,355,589
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
n, m = map(int, input().split())
s = set()
for _ in range(m):
u, v = map(int, input().split())
s.add(u)
s.add(v)
print(2 ** (len(s) - 1))
|
Title: DZY Loves Chemistry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chemistry, and he enjoys mixing chemicals.
DZY has *n* chemicals, and *m* pairs of them will react. He wants to pour these chemicals into a test tube, and he needs to pour them in one by one, in any order.
Let's consider the danger of a test tube. Danger of an empty test tube is 1. And every time when DZY pours a chemical, if there are already one or more chemicals in the test tube that can react with it, the danger of the test tube will be multiplied by 2. Otherwise the danger remains as it is.
Find the maximum possible danger after pouring all the chemicals one by one in optimal order.
Input Specification:
The first line contains two space-separated integers *n* and *m* .
Each of the next *m* lines contains two space-separated integers *x**i* and *y**i* (1<=≤<=*x**i*<=<<=*y**i*<=≤<=*n*). These integers mean that the chemical *x**i* will react with the chemical *y**i*. Each pair of chemicals will appear at most once in the input.
Consider all the chemicals numbered from 1 to *n* in some order.
Output Specification:
Print a single integer — the maximum possible danger.
Demo Input:
['1 0\n', '2 1\n1 2\n', '3 2\n1 2\n2 3\n']
Demo Output:
['1\n', '2\n', '4\n']
Note:
In the first sample, there's only one way to pour, and the danger won't increase.
In the second sample, no matter we pour the 1st chemical first, or pour the 2nd chemical first, the answer is always 2.
In the third sample, there are four ways to achieve the maximum possible danger: 2-1-3, 2-3-1, 1-2-3 and 3-2-1 (that is the numbers of the chemicals in order of pouring).
|
```python
n, m = map(int, input().split())
s = set()
for _ in range(m):
u, v = map(int, input().split())
s.add(u)
s.add(v)
print(2 ** (len(s) - 1))
```
| 0
|
|
846
|
C
|
Four Segments
|
PROGRAMMING
| 1,800
|
[
"brute force",
"data structures",
"dp"
] | null | null |
You are given an array of *n* integer numbers. Let *sum*(*l*,<=*r*) be the sum of all numbers on positions from *l* to *r* non-inclusive (*l*-th element is counted, *r*-th element is not counted). For indices *l* and *r* holds 0<=≤<=*l*<=≤<=*r*<=≤<=*n*. Indices in array are numbered from 0.
For example, if *a*<==<=[<=-<=5,<=3,<=9,<=4], then *sum*(0,<=1)<==<=<=-<=5, *sum*(0,<=2)<==<=<=-<=2, *sum*(1,<=4)<==<=16 and *sum*(*i*,<=*i*)<==<=0 for each *i* from 0 to 4.
Choose the indices of three delimiters *delim*0, *delim*1, *delim*2 (0<=≤<=*delim*0<=≤<=*delim*1<=≤<=*delim*2<=≤<=*n*) and divide the array in such a way that the value of *res*<==<=*sum*(0,<=*delim*0) - *sum*(*delim*0,<=*delim*1) + *sum*(*delim*1,<=*delim*2) - *sum*(*delim*2,<=*n*) is maximal.
Note that some of the expressions *sum*(*l*,<=*r*) can correspond to empty segments (if *l*<==<=*r* for some segment).
|
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=5000).
The second line contains *n* numbers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1 (<=-<=109<=≤<=*a**i*<=≤<=109).
|
Choose three indices so that the value of *res* is maximal. If there are multiple answers, print any of them.
|
[
"3\n-1 2 3\n",
"4\n0 0 -1 0\n",
"1\n10000\n"
] |
[
"0 1 3\n",
"0 0 0\n",
"1 1 1\n"
] |
none
| 0
|
[
{
"input": "3\n-1 2 3",
"output": "0 1 3"
},
{
"input": "4\n0 0 -1 0",
"output": "0 0 0"
},
{
"input": "1\n10000",
"output": "0 0 1"
},
{
"input": "1\n-1",
"output": "0 0 0"
},
{
"input": "1\n0",
"output": "0 0 0"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0 0 0"
},
{
"input": "100\n-1 -1 0 1 -1 0 0 -1 -1 1 1 0 1 0 -1 1 0 0 -1 0 0 0 1 0 0 1 1 1 1 0 -1 -1 0 0 0 1 1 -1 0 0 1 1 1 0 -1 -1 0 -1 0 -1 -1 0 1 0 1 -1 1 -1 -1 -1 0 0 -1 0 -1 -1 0 -1 1 1 -1 1 0 1 -1 -1 1 1 -1 1 0 -1 1 -1 1 1 1 1 1 -1 0 1 0 0 -1 0 1 1 -1 -1",
"output": "43 68 98"
},
{
"input": "100\n2 1 -2 -1 -2 0 -1 -2 1 2 0 1 0 -2 -1 -2 0 2 0 1 -2 -2 2 0 -2 2 -2 0 2 0 2 0 -1 0 -2 2 -1 -1 -2 -1 0 -2 2 0 -2 -2 -2 -1 1 0 -2 -1 2 -1 -2 1 -1 1 1 2 -2 1 -2 1 2 2 -2 1 -2 0 -1 -1 -2 -2 1 0 -1 -1 2 0 2 0 -1 2 1 -1 2 0 2 1 1 1 -1 -1 1 -2 0 0 -2 0",
"output": "2 78 92"
},
{
"input": "10\n-6 -4 -7 0 7 9 8 3 8 7",
"output": "0 3 10"
},
{
"input": "4\n-1 1 -2 -2",
"output": "0 1 2"
},
{
"input": "2\n-3 -1",
"output": "0 0 0"
}
] | 1,686,397,290
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 6
| 62
| 0
|
class Segment:
def __init__(self, l, r, seg_sum):
self.l = l
self.r = r
self.seg_sum = seg_sum
def main():
n = int(input())
data = list(map(int, input().split()))
segment_data = list()
seg_sum = 0
is_positive = True
seg_start = 0
for i, x in enumerate(data):
if x >= 0 and is_positive:
seg_sum += x
if x < 0 and not is_positive:
seg_sum += x
else:
segment_data.append(Segment(seg_start, i, seg_sum))
seg_start = i
seg_sum = x
is_positive = not is_positive
segment_data.append(Segment(seg_start, n, seg_sum))
segment_sum = list()
prev_sum = 0
for segment in segment_data:
prev_sum += segment.seg_sum
segment_sum.append(prev_sum)
segment_max = segment_sum[0]
segment_max_pos = 0
for i, x in enumerate(segment_sum):
if x > segment_max:
segment_max = x
segment_max_pos = i
if x < 0:
break
print(segment_data[segment_max_pos].r, end=' ')
if segment_max_pos == len(segment_data) - 1:
print(n, n)
return
segment_sum = list()
prev_sum = 0
for segment in segment_data[segment_max_pos + 1:]:
prev_sum += segment.seg_sum
segment_sum.append(prev_sum)
segment_min = segment_sum[0]
segment_min_pos = segment_max_pos + 1
for i, x in enumerate(segment_sum[1:]):
if x < segment_min:
segment_min = x
segment_min_pos = (i + 1) + segment_max_pos + 1
if x >= 0:
break
print(segment_data[segment_min_pos].r, end=' ')
if segment_min_pos == len(segment_data) - 1:
print(n)
return
segment_sum = list()
prev_sum = 0
for segment in segment_data[segment_min_pos + 1:]:
prev_sum += segment.seg_sum
segment_sum.append(prev_sum)
segment_max = segment_sum[0]
segment_max_pos = segment_min_pos + 1
for i, x in enumerate(segment_sum[1:]):
if x > segment_max:
segment_max = x
segment_max_pos = (i + 1) + segment_min_pos + 1
if x < 0 and sum(segment_sum[i + segment_min_pos + 1:]) < sum(segment_sum[:i + segment_min_pos + 1]):
break
print(segment_data[segment_max_pos].r)
main()
|
Title: Four Segments
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of *n* integer numbers. Let *sum*(*l*,<=*r*) be the sum of all numbers on positions from *l* to *r* non-inclusive (*l*-th element is counted, *r*-th element is not counted). For indices *l* and *r* holds 0<=≤<=*l*<=≤<=*r*<=≤<=*n*. Indices in array are numbered from 0.
For example, if *a*<==<=[<=-<=5,<=3,<=9,<=4], then *sum*(0,<=1)<==<=<=-<=5, *sum*(0,<=2)<==<=<=-<=2, *sum*(1,<=4)<==<=16 and *sum*(*i*,<=*i*)<==<=0 for each *i* from 0 to 4.
Choose the indices of three delimiters *delim*0, *delim*1, *delim*2 (0<=≤<=*delim*0<=≤<=*delim*1<=≤<=*delim*2<=≤<=*n*) and divide the array in such a way that the value of *res*<==<=*sum*(0,<=*delim*0) - *sum*(*delim*0,<=*delim*1) + *sum*(*delim*1,<=*delim*2) - *sum*(*delim*2,<=*n*) is maximal.
Note that some of the expressions *sum*(*l*,<=*r*) can correspond to empty segments (if *l*<==<=*r* for some segment).
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=5000).
The second line contains *n* numbers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1 (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
Choose three indices so that the value of *res* is maximal. If there are multiple answers, print any of them.
Demo Input:
['3\n-1 2 3\n', '4\n0 0 -1 0\n', '1\n10000\n']
Demo Output:
['0 1 3\n', '0 0 0\n', '1 1 1\n']
Note:
none
|
```python
class Segment:
def __init__(self, l, r, seg_sum):
self.l = l
self.r = r
self.seg_sum = seg_sum
def main():
n = int(input())
data = list(map(int, input().split()))
segment_data = list()
seg_sum = 0
is_positive = True
seg_start = 0
for i, x in enumerate(data):
if x >= 0 and is_positive:
seg_sum += x
if x < 0 and not is_positive:
seg_sum += x
else:
segment_data.append(Segment(seg_start, i, seg_sum))
seg_start = i
seg_sum = x
is_positive = not is_positive
segment_data.append(Segment(seg_start, n, seg_sum))
segment_sum = list()
prev_sum = 0
for segment in segment_data:
prev_sum += segment.seg_sum
segment_sum.append(prev_sum)
segment_max = segment_sum[0]
segment_max_pos = 0
for i, x in enumerate(segment_sum):
if x > segment_max:
segment_max = x
segment_max_pos = i
if x < 0:
break
print(segment_data[segment_max_pos].r, end=' ')
if segment_max_pos == len(segment_data) - 1:
print(n, n)
return
segment_sum = list()
prev_sum = 0
for segment in segment_data[segment_max_pos + 1:]:
prev_sum += segment.seg_sum
segment_sum.append(prev_sum)
segment_min = segment_sum[0]
segment_min_pos = segment_max_pos + 1
for i, x in enumerate(segment_sum[1:]):
if x < segment_min:
segment_min = x
segment_min_pos = (i + 1) + segment_max_pos + 1
if x >= 0:
break
print(segment_data[segment_min_pos].r, end=' ')
if segment_min_pos == len(segment_data) - 1:
print(n)
return
segment_sum = list()
prev_sum = 0
for segment in segment_data[segment_min_pos + 1:]:
prev_sum += segment.seg_sum
segment_sum.append(prev_sum)
segment_max = segment_sum[0]
segment_max_pos = segment_min_pos + 1
for i, x in enumerate(segment_sum[1:]):
if x > segment_max:
segment_max = x
segment_max_pos = (i + 1) + segment_min_pos + 1
if x < 0 and sum(segment_sum[i + segment_min_pos + 1:]) < sum(segment_sum[:i + segment_min_pos + 1]):
break
print(segment_data[segment_max_pos].r)
main()
```
| 0
|
|
868
|
A
|
Bark to Unlock
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
|
The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
|
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
|
[
"ya\n4\nah\noy\nto\nha\n",
"hp\n2\nht\ntp\n",
"ah\n1\nha\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring.
| 250
|
[
{
"input": "ya\n4\nah\noy\nto\nha",
"output": "YES"
},
{
"input": "hp\n2\nht\ntp",
"output": "NO"
},
{
"input": "ah\n1\nha",
"output": "YES"
},
{
"input": "bb\n4\nba\nab\naa\nbb",
"output": "YES"
},
{
"input": "bc\n4\nca\nba\nbb\ncc",
"output": "YES"
},
{
"input": "ba\n4\ncd\nad\ncc\ncb",
"output": "YES"
},
{
"input": "pg\n4\nzl\nxs\ndi\nxn",
"output": "NO"
},
{
"input": "bn\n100\ndf\nyb\nze\nml\nyr\nof\nnw\nfm\ndw\nlv\nzr\nhu\nzt\nlw\nld\nmo\nxz\ntp\nmr\nou\nme\npx\nvp\nes\nxi\nnr\nbx\nqc\ngm\njs\nkn\ntw\nrq\nkz\nuc\nvc\nqr\nab\nna\nro\nya\nqy\ngu\nvk\nqk\ngs\nyq\nop\nhw\nrj\neo\nlz\nbh\nkr\nkb\nma\nrd\nza\nuf\nhq\nmc\nmn\nti\nwn\nsh\nax\nsi\nnd\ntz\ndu\nfj\nkl\nws\now\nnf\nvr\nye\nzc\niw\nfv\nkv\noo\nsm\nbc\nrs\nau\nuz\nuv\ngh\nsu\njn\ndz\nrl\nwj\nbk\nzl\nas\nms\nit\nwu",
"output": "YES"
},
{
"input": "bb\n1\naa",
"output": "NO"
},
{
"input": "qm\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "NO"
},
{
"input": "mq\n25\nqw\nwe\ner\nrt\nty\nyu\nui\nio\nop\npa\nas\nsd\ndf\nfg\ngh\nhj\njk\nkl\nlz\nzx\nxc\ncv\nvb\nbn\nnm",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "bb\n1\nbb",
"output": "YES"
},
{
"input": "ba\n1\ncc",
"output": "NO"
},
{
"input": "ha\n1\nha",
"output": "YES"
},
{
"input": "aa\n1\naa",
"output": "YES"
},
{
"input": "ez\n1\njl",
"output": "NO"
},
{
"input": "aa\n2\nab\nba",
"output": "YES"
},
{
"input": "aa\n2\nca\ncc",
"output": "NO"
},
{
"input": "dd\n2\nac\ndc",
"output": "NO"
},
{
"input": "qc\n2\nyc\nkr",
"output": "NO"
},
{
"input": "aa\n3\nba\nbb\nab",
"output": "YES"
},
{
"input": "ca\n3\naa\nbb\nab",
"output": "NO"
},
{
"input": "ca\n3\nbc\nbd\nca",
"output": "YES"
},
{
"input": "dd\n3\nmt\nrg\nxl",
"output": "NO"
},
{
"input": "be\n20\nad\ncd\ncb\ndb\ndd\naa\nab\nca\nae\ned\ndc\nbb\nba\nda\nee\nea\ncc\nac\nec\neb",
"output": "YES"
},
{
"input": "fc\n20\nca\nbb\nce\nfd\nde\nfa\ncc\nec\nfb\nfc\nff\nbe\ncf\nba\ndb\ned\naf\nae\nda\nef",
"output": "YES"
},
{
"input": "ca\n20\ndc\naf\ndf\neg\naa\nbc\nea\nbd\nab\ndb\ngc\nfb\nba\nbe\nee\ngf\ncf\nag\nga\nca",
"output": "YES"
},
{
"input": "ke\n20\nzk\nra\nbq\nqz\nwt\nzg\nmz\nuk\nge\nuv\nud\nfd\neh\ndm\nsk\nki\nfv\ntp\nat\nfb",
"output": "YES"
},
{
"input": "hh\n50\nag\nhg\ndg\nfh\neg\ngh\ngd\nda\nbh\nab\nhf\ndc\nhb\nfe\nad\nec\nac\nfd\nca\naf\ncg\nhd\neb\nce\nhe\nha\ngb\nea\nae\nfb\nff\nbe\nch\nhh\nee\nde\nge\ngf\naa\ngg\neh\ned\nbf\nfc\nah\nga\nbd\ncb\nbg\nbc",
"output": "YES"
},
{
"input": "id\n50\nhi\ndc\nfg\nee\ngi\nhc\nac\nih\ndg\nfc\nde\ned\nie\neb\nic\ncf\nib\nfa\ngc\nba\nbe\nga\nha\nhg\nia\ndf\nab\nei\neh\nad\nii\nci\ndh\nec\nif\ndi\nbg\nag\nhe\neg\nca\nae\ndb\naa\nid\nfh\nhh\ncc\nfb\ngb",
"output": "YES"
},
{
"input": "fe\n50\nje\nbi\nbg\ngc\nfb\nig\ndf\nji\ndg\nfe\nfc\ncf\ngf\nai\nhe\nac\nch\nja\ngh\njf\nge\ncb\nij\ngb\ncg\naf\neh\nee\nhd\njd\njb\nii\nca\nci\nga\nab\nhi\nag\nfj\nej\nfi\nie\ndj\nfg\nef\njc\njg\njh\nhf\nha",
"output": "YES"
},
{
"input": "rn\n50\nba\nec\nwg\nao\nlk\nmz\njj\ncf\nfa\njk\ndy\nsz\njs\nzr\nqv\ntx\nwv\nrd\nqw\nls\nrr\nvt\nrx\nkc\neh\nnj\niq\nyi\nkh\nue\nnv\nkz\nrn\nes\nua\nzf\nvu\nll\neg\nmj\ncz\nzj\nxz\net\neb\nci\nih\nig\nam\nvd",
"output": "YES"
},
{
"input": "ee\n100\nah\nfb\ncd\nbi\nii\nai\nid\nag\nie\nha\ndi\nec\nae\nce\njb\ndg\njg\ngd\ngf\nda\nih\nbd\nhj\ngg\nhb\ndf\ned\nfh\naf\nja\nci\nfc\nic\nji\nac\nhi\nfj\nch\nbc\njd\naa\nff\nad\ngj\nej\nde\nee\nhe\ncf\nga\nia\ncg\nbb\nhc\nbe\ngi\njf\nbg\naj\njj\nbh\nfe\ndj\nef\ngb\nge\ndb\nig\ncj\ndc\nij\njh\nei\ndd\nib\nhf\neg\nbf\nfg\nab\ngc\nfd\nhd\ngh\neh\njc\neb\nhh\nca\nje\nbj\nif\nea\nhg\nfa\ncc\nba\ndh\ncb\nfi",
"output": "YES"
},
{
"input": "if\n100\njd\nbc\nje\nhi\nga\nde\nkb\nfc\ncd\ngd\naj\ncb\nei\nbf\ncf\ndk\ndb\ncg\nki\ngg\nkg\nfa\nkj\nii\njf\njg\ngb\nbh\nbg\neh\nhj\nhb\ndg\ndj\njc\njb\nce\ndi\nig\nci\ndf\nji\nhc\nfk\naf\nac\ngk\nhd\nae\nkd\nec\nkc\neb\nfh\nij\nie\nca\nhh\nkf\nha\ndd\nif\nef\nih\nhg\nej\nfe\njk\nea\nib\nck\nhf\nak\ngi\nch\ndc\nba\nke\nad\nka\neg\njh\nja\ngc\nfd\ncc\nab\ngj\nik\nfg\nbj\nhe\nfj\nge\ngh\nhk\nbk\ned\nid\nfi",
"output": "YES"
},
{
"input": "kd\n100\nek\nea\nha\nkf\nkj\ngh\ndl\nfj\nal\nga\nlj\nik\ngd\nid\ncb\nfh\ndk\nif\nbh\nkb\nhc\nej\nhk\ngc\ngb\nef\nkk\nll\nlf\nkh\ncl\nlh\njj\nil\nhh\nci\ndb\ndf\ngk\njg\nch\nbd\ncg\nfg\nda\neb\nlg\ndg\nbk\nje\nbg\nbl\njl\ncj\nhb\nei\naa\ngl\nka\nfa\nfi\naf\nkc\nla\ngi\nij\nib\nle\ndi\nck\nag\nlc\nca\nge\nie\nlb\nke\nii\nae\nig\nic\nhe\ncf\nhd\nak\nfb\nhi\ngf\nad\nba\nhg\nbi\nkl\nac\ngg\ngj\nbe\nlk\nld\naj",
"output": "YES"
},
{
"input": "ab\n1\nab",
"output": "YES"
},
{
"input": "ya\n1\nya",
"output": "YES"
},
{
"input": "ay\n1\nyb",
"output": "NO"
},
{
"input": "ax\n2\nii\nxa",
"output": "YES"
},
{
"input": "hi\n1\nhi",
"output": "YES"
},
{
"input": "ag\n1\nag",
"output": "YES"
},
{
"input": "th\n1\nth",
"output": "YES"
},
{
"input": "sb\n1\nsb",
"output": "YES"
},
{
"input": "hp\n1\nhp",
"output": "YES"
},
{
"input": "ah\n1\nah",
"output": "YES"
},
{
"input": "ta\n1\nta",
"output": "YES"
},
{
"input": "tb\n1\ntb",
"output": "YES"
},
{
"input": "ab\n5\nca\nda\nea\nfa\nka",
"output": "NO"
},
{
"input": "ac\n1\nac",
"output": "YES"
},
{
"input": "ha\n2\nha\nzz",
"output": "YES"
},
{
"input": "ok\n1\nok",
"output": "YES"
},
{
"input": "bc\n1\nbc",
"output": "YES"
},
{
"input": "az\n1\nzz",
"output": "NO"
},
{
"input": "ab\n2\nba\ntt",
"output": "YES"
},
{
"input": "ah\n2\nap\nhp",
"output": "NO"
},
{
"input": "sh\n1\nsh",
"output": "YES"
},
{
"input": "az\n1\nby",
"output": "NO"
},
{
"input": "as\n1\nas",
"output": "YES"
},
{
"input": "ab\n2\nab\ncd",
"output": "YES"
},
{
"input": "ab\n2\nxa\nza",
"output": "NO"
},
{
"input": "ab\n2\net\nab",
"output": "YES"
},
{
"input": "ab\n1\naa",
"output": "NO"
},
{
"input": "ab\n2\nab\nde",
"output": "YES"
},
{
"input": "ah\n2\nba\nha",
"output": "YES"
},
{
"input": "ha\n3\ndd\ncc\nha",
"output": "YES"
},
{
"input": "oo\n1\nox",
"output": "NO"
},
{
"input": "ab\n2\nax\nbx",
"output": "NO"
},
{
"input": "ww\n4\nuw\now\npo\nko",
"output": "NO"
},
{
"input": "ay\n1\nay",
"output": "YES"
},
{
"input": "yo\n1\nyo",
"output": "YES"
},
{
"input": "ba\n1\nba",
"output": "YES"
},
{
"input": "qw\n1\nqw",
"output": "YES"
},
{
"input": "la\n1\nla",
"output": "YES"
},
{
"input": "ab\n2\nbb\nbc",
"output": "NO"
},
{
"input": "aa\n2\nab\nac",
"output": "NO"
},
{
"input": "ah\n2\nbb\nha",
"output": "YES"
},
{
"input": "ya\n42\nab\nac\nad\nae\naf\nag\nah\nai\nak\naj\nba\nbc\nbd\nbe\nbf\nbg\nbh\nbi\nbk\nbj\ncb\nca\ncd\nce\ncf\ncg\nch\nci\nck\ncj\ndb\ndc\nda\nde\ndf\ndg\ndh\ndi\ndk\ndj\nef\nek",
"output": "NO"
},
{
"input": "ab\n3\nab\nxx\nyy",
"output": "YES"
},
{
"input": "ab\n2\nab\ncc",
"output": "YES"
},
{
"input": "sa\n2\nxx\nas",
"output": "YES"
},
{
"input": "ma\n1\nma",
"output": "YES"
},
{
"input": "ba\n1\nbb",
"output": "NO"
},
{
"input": "bc\n1\nab",
"output": "NO"
},
{
"input": "fa\n1\nfa",
"output": "YES"
},
{
"input": "ap\n1\nap",
"output": "YES"
},
{
"input": "ab\n1\nbb",
"output": "NO"
},
{
"input": "bk\n1\nbk",
"output": "YES"
},
{
"input": "xy\n2\nxy\naa",
"output": "YES"
},
{
"input": "ab\n2\nza\nbz",
"output": "YES"
}
] | 1,507,188,043
| 943
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 1
| 46
| 0
|
password = input()
n = int(input())
firstLetter = 0
secondLetter = 0
found = 0
for i in range(n):
inputStr = input()
if inputStr == password:
found = 1
if inputStr[1] == password[0]:
firstLetter = 1
if inputStr[0] == password[1]:
secondLetter = 1
if ( found or (firstLetter and secondLetter) ):
print('YES')
# print('NO')
|
Title: Bark to Unlock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As technologies develop, manufacturers are making the process of unlocking a phone as user-friendly as possible. To unlock its new phone, Arkady's pet dog Mu-mu has to bark the password once. The phone represents a password as a string of two lowercase English letters.
Mu-mu's enemy Kashtanka wants to unlock Mu-mu's phone to steal some sensible information, but it can only bark *n* distinct words, each of which can be represented as a string of two lowercase English letters. Kashtanka wants to bark several words (not necessarily distinct) one after another to pronounce a string containing the password as a substring. Tell if it's possible to unlock the phone in this way, or not.
Input Specification:
The first line contains two lowercase English letters — the password on the phone.
The second line contains single integer *n* (1<=≤<=*n*<=≤<=100) — the number of words Kashtanka knows.
The next *n* lines contain two lowercase English letters each, representing the words Kashtanka knows. The words are guaranteed to be distinct.
Output Specification:
Print "YES" if Kashtanka can bark several words in a line forming a string containing the password, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['ya\n4\nah\noy\nto\nha\n', 'hp\n2\nht\ntp\n', 'ah\n1\nha\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first example the password is "ya", and Kashtanka can bark "oy" and then "ah", and then "ha" to form the string "oyahha" which contains the password. So, the answer is "YES".
In the second example Kashtanka can't produce a string containing password as a substring. Note that it can bark "ht" and then "tp" producing "http", but it doesn't contain the password "hp" as a substring.
In the third example the string "hahahaha" contains "ah" as a substring.
|
```python
password = input()
n = int(input())
firstLetter = 0
secondLetter = 0
found = 0
for i in range(n):
inputStr = input()
if inputStr == password:
found = 1
if inputStr[1] == password[0]:
firstLetter = 1
if inputStr[0] == password[1]:
secondLetter = 1
if ( found or (firstLetter and secondLetter) ):
print('YES')
# print('NO')
```
| 0
|
|
441
|
B
|
Valera and Fruits
|
PROGRAMMING
| 1,400
|
[
"greedy",
"implementation"
] | null | null |
Valera loves his garden, where *n* fruit trees grow.
This year he will enjoy a great harvest! On the *i*-th tree *b**i* fruit grow, they will ripen on a day number *a**i*. Unfortunately, the fruit on the tree get withered, so they can only be collected on day *a**i* and day *a**i*<=+<=1 (all fruits that are not collected in these two days, become unfit to eat).
Valera is not very fast, but there are some positive points. Valera is ready to work every day. In one day, Valera can collect no more than *v* fruits. The fruits may be either from the same tree, or from different ones. What is the maximum amount of fruit Valera can collect for all time, if he operates optimally well?
|
The first line contains two space-separated integers *n* and *v* (1<=≤<=*n*,<=*v*<=≤<=3000) — the number of fruit trees in the garden and the number of fruits that Valera can collect in a day.
Next *n* lines contain the description of trees in the garden. The *i*-th line contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=3000) — the day the fruits ripen on the *i*-th tree and the number of fruits on the *i*-th tree.
|
Print a single integer — the maximum number of fruit that Valera can collect.
|
[
"2 3\n1 5\n2 3\n",
"5 10\n3 20\n2 20\n1 20\n4 20\n5 20\n"
] |
[
"8\n",
"60\n"
] |
In the first sample, in order to obtain the optimal answer, you should act as follows.
- On the first day collect 3 fruits from the 1-st tree. - On the second day collect 1 fruit from the 2-nd tree and 2 fruits from the 1-st tree. - On the third day collect the remaining fruits from the 2-nd tree.
In the second sample, you can only collect 60 fruits, the remaining fruit will simply wither.
| 1,000
|
[
{
"input": "2 3\n1 5\n2 3",
"output": "8"
},
{
"input": "5 10\n3 20\n2 20\n1 20\n4 20\n5 20",
"output": "60"
},
{
"input": "10 3000\n1 2522\n4 445\n8 1629\n5 772\n9 2497\n6 81\n3 426\n7 1447\n2 575\n10 202",
"output": "10596"
},
{
"input": "5 3000\n5 772\n1 2522\n2 575\n4 445\n3 426",
"output": "4740"
},
{
"input": "2 1500\n2 575\n1 2522",
"output": "3097"
},
{
"input": "12 2856\n9 2728\n8 417\n3 1857\n10 1932\n1 775\n12 982\n9 1447\n1 426\n7 2918\n11 2522\n10 2497\n9 772",
"output": "18465"
},
{
"input": "24 1524\n16 934\n23 1940\n21 1447\n20 417\n24 1340\n22 1932\n13 775\n19 2918\n12 2355\n9 593\n11 2676\n3 1857\n16 868\n13 426\n18 1679\n22 991\n9 2728\n10 2497\n16 1221\n9 772\n23 2522\n24 982\n12 1431\n18 757",
"output": "25893"
},
{
"input": "1 10\n3000 30",
"output": "20"
},
{
"input": "2 1\n30 3\n31 2",
"output": "3"
},
{
"input": "4 2061\n1 426\n3 2522\n1 772\n1 1447",
"output": "5167"
},
{
"input": "2 1\n1 1\n1 1",
"output": "2"
},
{
"input": "1 10\n3000 20",
"output": "20"
},
{
"input": "1 1000\n3000 2000",
"output": "2000"
},
{
"input": "2 100\n3000 100\n3000 100",
"output": "200"
},
{
"input": "2 3\n1 6\n3 6",
"output": "12"
},
{
"input": "1 40\n3000 42",
"output": "42"
},
{
"input": "1 100\n3000 200",
"output": "200"
},
{
"input": "1 50\n3000 100",
"output": "100"
},
{
"input": "1 1\n3000 2",
"output": "2"
},
{
"input": "2 3000\n3000 3000\n3000 3000",
"output": "6000"
},
{
"input": "2 2\n2999 3\n3000 2",
"output": "5"
},
{
"input": "1 2\n3000 3",
"output": "3"
},
{
"input": "2 5\n2999 10\n3000 5",
"output": "15"
},
{
"input": "1 3\n5 3",
"output": "3"
},
{
"input": "2 1000\n2999 2000\n3000 1000",
"output": "3000"
},
{
"input": "1 5\n3000 10",
"output": "10"
},
{
"input": "1 10\n3000 15",
"output": "15"
},
{
"input": "5 1\n10 100\n2698 100\n200 100\n3000 100\n1500 100",
"output": "10"
},
{
"input": "1 1\n3000 3000",
"output": "2"
},
{
"input": "2 10\n2999 100\n3000 100",
"output": "30"
},
{
"input": "1 10\n3000 100",
"output": "20"
}
] | 1,622,971,890
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 93
| 0
|
import math
n,v = map(int, input().strip().split(' '))
l=[0]*3001
for j in range(n):
a,b = map(int,input().strip().split(' '))
if l[a-1]+b<=v:
l[a-1]+=b
else:
p1=v-l[a-1]
l[a-1]=v
p2=b-p1
if l[a]+p2<=v:
l[a]+=p2
else:
l[a]=v
print(sum(l))
|
Title: Valera and Fruits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera loves his garden, where *n* fruit trees grow.
This year he will enjoy a great harvest! On the *i*-th tree *b**i* fruit grow, they will ripen on a day number *a**i*. Unfortunately, the fruit on the tree get withered, so they can only be collected on day *a**i* and day *a**i*<=+<=1 (all fruits that are not collected in these two days, become unfit to eat).
Valera is not very fast, but there are some positive points. Valera is ready to work every day. In one day, Valera can collect no more than *v* fruits. The fruits may be either from the same tree, or from different ones. What is the maximum amount of fruit Valera can collect for all time, if he operates optimally well?
Input Specification:
The first line contains two space-separated integers *n* and *v* (1<=≤<=*n*,<=*v*<=≤<=3000) — the number of fruit trees in the garden and the number of fruits that Valera can collect in a day.
Next *n* lines contain the description of trees in the garden. The *i*-th line contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=3000) — the day the fruits ripen on the *i*-th tree and the number of fruits on the *i*-th tree.
Output Specification:
Print a single integer — the maximum number of fruit that Valera can collect.
Demo Input:
['2 3\n1 5\n2 3\n', '5 10\n3 20\n2 20\n1 20\n4 20\n5 20\n']
Demo Output:
['8\n', '60\n']
Note:
In the first sample, in order to obtain the optimal answer, you should act as follows.
- On the first day collect 3 fruits from the 1-st tree. - On the second day collect 1 fruit from the 2-nd tree and 2 fruits from the 1-st tree. - On the third day collect the remaining fruits from the 2-nd tree.
In the second sample, you can only collect 60 fruits, the remaining fruit will simply wither.
|
```python
import math
n,v = map(int, input().strip().split(' '))
l=[0]*3001
for j in range(n):
a,b = map(int,input().strip().split(' '))
if l[a-1]+b<=v:
l[a-1]+=b
else:
p1=v-l[a-1]
l[a-1]=v
p2=b-p1
if l[a]+p2<=v:
l[a]+=p2
else:
l[a]=v
print(sum(l))
```
| 0
|
|
761
|
D
|
Dasha and Very Difficult Problem
|
PROGRAMMING
| 1,700
|
[
"binary search",
"brute force",
"constructive algorithms",
"greedy",
"sortings"
] | null | null |
Dasha logged into the system and began to solve problems. One of them is as follows:
Given two sequences *a* and *b* of length *n* each you need to write a sequence *c* of length *n*, the *i*-th element of which is calculated as follows: *c**i*<==<=*b**i*<=-<=*a**i*.
About sequences *a* and *b* we know that their elements are in the range from *l* to *r*. More formally, elements satisfy the following conditions: *l*<=≤<=*a**i*<=≤<=*r* and *l*<=≤<=*b**i*<=≤<=*r*. About sequence *c* we know that all its elements are distinct.
Dasha wrote a solution to that problem quickly, but checking her work on the standard test was not so easy. Due to an error in the test system only the sequence *a* and the compressed sequence of the sequence *c* were known from that test.
Let's give the definition to a compressed sequence. A compressed sequence of sequence *c* of length *n* is a sequence *p* of length *n*, so that *p**i* equals to the number of integers which are less than or equal to *c**i* in the sequence *c*. For example, for the sequence *c*<==<=[250,<=200,<=300,<=100,<=50] the compressed sequence will be *p*<==<=[4,<=3,<=5,<=2,<=1]. Pay attention that in *c* all integers are distinct. Consequently, the compressed sequence contains all integers from 1 to *n* inclusively.
Help Dasha to find any sequence *b* for which the calculated compressed sequence of sequence *c* is correct.
|
The first line contains three integers *n*, *l*, *r* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*l*<=≤<=*r*<=≤<=109) — the length of the sequence and boundaries of the segment where the elements of sequences *a* and *b* are.
The next line contains *n* integers *a*1,<=<=*a*2,<=<=...,<=<=*a**n* (*l*<=≤<=*a**i*<=≤<=*r*) — the elements of the sequence *a*.
The next line contains *n* distinct integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n* (1<=≤<=*p**i*<=≤<=*n*) — the compressed sequence of the sequence *c*.
|
If there is no the suitable sequence *b*, then in the only line print "-1".
Otherwise, in the only line print *n* integers — the elements of any suitable sequence *b*.
|
[
"5 1 5\n1 1 1 1 1\n3 1 5 4 2\n",
"4 2 9\n3 4 8 9\n3 2 1 4\n",
"6 1 5\n1 1 1 1 1 1\n2 3 5 4 1 6\n"
] |
[
"3 1 5 4 2 ",
"2 2 2 9 ",
"-1\n"
] |
Sequence *b* which was found in the second sample is suitable, because calculated sequence *c* = [2 - 3, 2 - 4, 2 - 8, 9 - 9] = [ - 1, - 2, - 6, 0] (note that *c*<sub class="lower-index">*i*</sub> = *b*<sub class="lower-index">*i*</sub> - *a*<sub class="lower-index">*i*</sub>) has compressed sequence equals to *p* = [3, 2, 1, 4].
| 2,000
|
[
{
"input": "5 1 5\n1 1 1 1 1\n3 1 5 4 2",
"output": "3 1 5 4 2 "
},
{
"input": "4 2 9\n3 4 8 9\n3 2 1 4",
"output": "2 2 2 9 "
},
{
"input": "6 1 5\n1 1 1 1 1 1\n2 3 5 4 1 6",
"output": "-1"
},
{
"input": "5 1 7\n1 4 4 6 5\n5 2 1 4 3",
"output": "2 2 1 6 4 "
},
{
"input": "5 10 100\n12 14 15 11 13\n4 2 1 5 3",
"output": "10 10 10 10 10 "
},
{
"input": "2 1 1000000000\n1000000000 1\n2 1",
"output": "-1"
},
{
"input": "2 1 1000000000\n1000000000 1\n1 2",
"output": "1 1 "
},
{
"input": "5 1 5\n1 1 1 1 1\n1 2 3 4 5",
"output": "1 2 3 4 5 "
},
{
"input": "5 1 5\n1 1 1 1 1\n2 3 1 5 4",
"output": "2 3 1 5 4 "
},
{
"input": "1 1000000000 1000000000\n1000000000\n1",
"output": "1000000000 "
},
{
"input": "6 3 7\n6 7 5 5 5 5\n2 1 4 3 5 6",
"output": "3 3 4 3 5 6 "
},
{
"input": "3 5 100\n10 50 100\n3 2 1",
"output": "5 5 5 "
},
{
"input": "10 1 10\n9 2 9 5 5 2 6 8 2 8\n2 10 1 6 7 8 5 3 9 4",
"output": "2 3 1 2 3 1 2 2 2 3 "
},
{
"input": "30 100 200\n102 108 122 116 107 145 195 145 119 110 187 196 140 174 104 190 193 181 118 127 157 111 139 175 173 191 181 105 142 166\n30 26 20 23 27 15 2 14 21 25 6 1 17 10 29 5 3 7 22 19 13 24 18 9 11 4 8 28 16 12",
"output": "100 100 100 100 100 101 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 101 100 100 100 "
},
{
"input": "50 10 15\n13 14 12 14 12 15 13 10 11 11 15 10 14 11 14 12 11 10 10 13 11 13 12 15 14 15 13 15 13 10 12 10 15 15 10 14 11 11 10 14 11 12 13 12 10 11 13 15 14 11\n20 10 25 13 29 6 24 47 37 39 2 44 12 33 9 26 35 49 46 19 38 23 30 5 16 4 21 7 18 45 28 43 1 8 48 15 36 40 50 11 32 27 22 31 42 41 17 3 14 34",
"output": "-1"
},
{
"input": "10 8 10\n8 10 10 9 8 10 10 10 10 10\n9 5 6 8 10 2 7 3 1 4",
"output": "-1"
},
{
"input": "50 1 50\n6 20 27 26 46 35 41 41 4 12 48 13 20 5 35 7 37 3 18 17 22 42 28 1 30 46 38 38 42 29 33 42 8 45 22 40 11 33 12 15 16 49 30 19 29 40 5 12 32 22\n47 27 35 40 31 26 42 19 11 49 37 3 41 34 36 30 16 44 12 4 46 20 14 39 32 25 18 1 21 6 2 17 48 7 5 24 29 33 50 43 8 15 28 23 22 13 45 38 10 9",
"output": "-1"
},
{
"input": "11 5 11\n9 8 7 5 7 5 9 5 10 5 7\n3 4 6 9 5 11 2 10 1 8 7",
"output": "6 6 7 8 6 10 5 9 5 7 8 "
}
] | 1,593,491,240
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 63
| 624
| 37,785,600
|
n, l, r = map(int, input().split())
a = list(map(int, input().split()))
out = [-1] * n
p = list(map(int, input().split()))
pp = [(p[i],i) for i in range(n)]
pp.sort()
curr = -(l+r)
for v, i in pp:
best = curr + 1 + a[i]
if best < l:
best = l
out[i] = best
curr = best - a[i]
if max(out) > r:
print(-1)
else:
print(' '.join(map(str,out)))
|
Title: Dasha and Very Difficult Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dasha logged into the system and began to solve problems. One of them is as follows:
Given two sequences *a* and *b* of length *n* each you need to write a sequence *c* of length *n*, the *i*-th element of which is calculated as follows: *c**i*<==<=*b**i*<=-<=*a**i*.
About sequences *a* and *b* we know that their elements are in the range from *l* to *r*. More formally, elements satisfy the following conditions: *l*<=≤<=*a**i*<=≤<=*r* and *l*<=≤<=*b**i*<=≤<=*r*. About sequence *c* we know that all its elements are distinct.
Dasha wrote a solution to that problem quickly, but checking her work on the standard test was not so easy. Due to an error in the test system only the sequence *a* and the compressed sequence of the sequence *c* were known from that test.
Let's give the definition to a compressed sequence. A compressed sequence of sequence *c* of length *n* is a sequence *p* of length *n*, so that *p**i* equals to the number of integers which are less than or equal to *c**i* in the sequence *c*. For example, for the sequence *c*<==<=[250,<=200,<=300,<=100,<=50] the compressed sequence will be *p*<==<=[4,<=3,<=5,<=2,<=1]. Pay attention that in *c* all integers are distinct. Consequently, the compressed sequence contains all integers from 1 to *n* inclusively.
Help Dasha to find any sequence *b* for which the calculated compressed sequence of sequence *c* is correct.
Input Specification:
The first line contains three integers *n*, *l*, *r* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*l*<=≤<=*r*<=≤<=109) — the length of the sequence and boundaries of the segment where the elements of sequences *a* and *b* are.
The next line contains *n* integers *a*1,<=<=*a*2,<=<=...,<=<=*a**n* (*l*<=≤<=*a**i*<=≤<=*r*) — the elements of the sequence *a*.
The next line contains *n* distinct integers *p*1,<=<=*p*2,<=<=...,<=<=*p**n* (1<=≤<=*p**i*<=≤<=*n*) — the compressed sequence of the sequence *c*.
Output Specification:
If there is no the suitable sequence *b*, then in the only line print "-1".
Otherwise, in the only line print *n* integers — the elements of any suitable sequence *b*.
Demo Input:
['5 1 5\n1 1 1 1 1\n3 1 5 4 2\n', '4 2 9\n3 4 8 9\n3 2 1 4\n', '6 1 5\n1 1 1 1 1 1\n2 3 5 4 1 6\n']
Demo Output:
['3 1 5 4 2 ', '2 2 2 9 ', '-1\n']
Note:
Sequence *b* which was found in the second sample is suitable, because calculated sequence *c* = [2 - 3, 2 - 4, 2 - 8, 9 - 9] = [ - 1, - 2, - 6, 0] (note that *c*<sub class="lower-index">*i*</sub> = *b*<sub class="lower-index">*i*</sub> - *a*<sub class="lower-index">*i*</sub>) has compressed sequence equals to *p* = [3, 2, 1, 4].
|
```python
n, l, r = map(int, input().split())
a = list(map(int, input().split()))
out = [-1] * n
p = list(map(int, input().split()))
pp = [(p[i],i) for i in range(n)]
pp.sort()
curr = -(l+r)
for v, i in pp:
best = curr + 1 + a[i]
if best < l:
best = l
out[i] = best
curr = best - a[i]
if max(out) > r:
print(-1)
else:
print(' '.join(map(str,out)))
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
You've got string *s*, consisting of only lowercase English letters. Find its lexicographically maximum subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*]<==<=*s**p*1*s**p*2... *s**p**k*(1<=≤<=*p*1<=<<=*p*2<=<<=...<=<<=*p**k*<=≤<=|*s*|) a subsequence of string *s*<==<=*s*1*s*2... *s*|*s*|.
String *x*<==<=*x*1*x*2... *x*|*x*| is lexicographically larger than string *y*<==<=*y*1*y*2... *y*|*y*|, if either |*x*|<=><=|*y*| and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x*|*y*|<==<=*y*|*y*|, or exists such number *r* (*r*<=<<=|*x*|,<=*r*<=<<=|*y*|), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=><=*y**r*<=+<=1. Characters in lines are compared like their ASCII codes.
|
The single line contains a non-empty string *s*, consisting only of lowercase English letters. The string's length doesn't exceed 105.
|
Print the lexicographically maximum subsequence of string *s*.
|
[
"ababba\n",
"abbcbccacbbcbaaba\n"
] |
[
"bbba\n",
"cccccbba\n"
] |
Let's look at samples and see what the sought subsequences look like (they are marked with uppercase bold letters).
The first sample: aBaBBA
The second sample: abbCbCCaCbbCBaaBA
| 0
|
[
{
"input": "ababba",
"output": "bbba"
},
{
"input": "abbcbccacbbcbaaba",
"output": "cccccbba"
},
{
"input": "thankstosamarasauteddybearsforthiscontest",
"output": "yttt"
},
{
"input": "cantouristsolveitlessthaninoneminute",
"output": "vute"
},
{
"input": "arepretestsstrongforthisproblem",
"output": "ttttsrom"
},
{
"input": "whyareyoulookingfortestsdoyouhavewa",
"output": "yyywa"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "za"
},
{
"input": "dcbaedcba",
"output": "edcba"
},
{
"input": "abcdeabcd",
"output": "ed"
},
{
"input": "abcdedcba",
"output": "edcba"
},
{
"input": "zyxzxzwyxywxxwabcdabdacdbcacdbcacabaaba",
"output": "zzzyyxxwddddccbba"
},
{
"input": "zzyzyy",
"output": "zzzyy"
},
{
"input": "aababb",
"output": "bbb"
}
] | 1,658,236,534
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 23
| 2,000
| 102,400
|
s=input()
ans=""
i=len(s)-1
while i>=0:
if ans=="":
ans=s[i]
elif s[i]>=ans[0]:
ans=s[i]+ans
i-=1
print(ans)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got string *s*, consisting of only lowercase English letters. Find its lexicographically maximum subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*]<==<=*s**p*1*s**p*2... *s**p**k*(1<=≤<=*p*1<=<<=*p*2<=<<=...<=<<=*p**k*<=≤<=|*s*|) a subsequence of string *s*<==<=*s*1*s*2... *s*|*s*|.
String *x*<==<=*x*1*x*2... *x*|*x*| is lexicographically larger than string *y*<==<=*y*1*y*2... *y*|*y*|, if either |*x*|<=><=|*y*| and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x*|*y*|<==<=*y*|*y*|, or exists such number *r* (*r*<=<<=|*x*|,<=*r*<=<<=|*y*|), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=><=*y**r*<=+<=1. Characters in lines are compared like their ASCII codes.
Input Specification:
The single line contains a non-empty string *s*, consisting only of lowercase English letters. The string's length doesn't exceed 105.
Output Specification:
Print the lexicographically maximum subsequence of string *s*.
Demo Input:
['ababba\n', 'abbcbccacbbcbaaba\n']
Demo Output:
['bbba\n', 'cccccbba\n']
Note:
Let's look at samples and see what the sought subsequences look like (they are marked with uppercase bold letters).
The first sample: aBaBBA
The second sample: abbCbCCaCbbCBaaBA
|
```python
s=input()
ans=""
i=len(s)-1
while i>=0:
if ans=="":
ans=s[i]
elif s[i]>=ans[0]:
ans=s[i]+ans
i-=1
print(ans)
```
| 0
|
|
371
|
C
|
Hamburgers
|
PROGRAMMING
| 1,600
|
[
"binary search",
"brute force"
] | null | null |
Polycarpus loves hamburgers very much. He especially adores the hamburgers he makes with his own hands. Polycarpus thinks that there are only three decent ingredients to make hamburgers from: a bread, sausage and cheese. He writes down the recipe of his favorite "Le Hamburger de Polycarpus" as a string of letters 'B' (bread), 'S' (sausage) и 'C' (cheese). The ingredients in the recipe go from bottom to top, for example, recipe "ВSCBS" represents the hamburger where the ingredients go from bottom to top as bread, sausage, cheese, bread and sausage again.
Polycarpus has *n**b* pieces of bread, *n**s* pieces of sausage and *n**c* pieces of cheese in the kitchen. Besides, the shop nearby has all three ingredients, the prices are *p**b* rubles for a piece of bread, *p**s* for a piece of sausage and *p**c* for a piece of cheese.
Polycarpus has *r* rubles and he is ready to shop on them. What maximum number of hamburgers can he cook? You can assume that Polycarpus cannot break or slice any of the pieces of bread, sausage or cheese. Besides, the shop has an unlimited number of pieces of each ingredient.
|
The first line of the input contains a non-empty string that describes the recipe of "Le Hamburger de Polycarpus". The length of the string doesn't exceed 100, the string contains only letters 'B' (uppercase English B), 'S' (uppercase English S) and 'C' (uppercase English C).
The second line contains three integers *n**b*, *n**s*, *n**c* (1<=≤<=*n**b*,<=*n**s*,<=*n**c*<=≤<=100) — the number of the pieces of bread, sausage and cheese on Polycarpus' kitchen. The third line contains three integers *p**b*, *p**s*, *p**c* (1<=≤<=*p**b*,<=*p**s*,<=*p**c*<=≤<=100) — the price of one piece of bread, sausage and cheese in the shop. Finally, the fourth line contains integer *r* (1<=≤<=*r*<=≤<=1012) — the number of rubles Polycarpus has.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
Print the maximum number of hamburgers Polycarpus can make. If he can't make any hamburger, print 0.
|
[
"BBBSSC\n6 4 1\n1 2 3\n4\n",
"BBC\n1 10 1\n1 10 1\n21\n",
"BSC\n1 1 1\n1 1 3\n1000000000000\n"
] |
[
"2\n",
"7\n",
"200000000001\n"
] |
none
| 1,500
|
[
{
"input": "BBBSSC\n6 4 1\n1 2 3\n4",
"output": "2"
},
{
"input": "BBC\n1 10 1\n1 10 1\n21",
"output": "7"
},
{
"input": "BSC\n1 1 1\n1 1 3\n1000000000000",
"output": "200000000001"
},
{
"input": "B\n1 1 1\n1 1 1\n381",
"output": "382"
},
{
"input": "BSC\n3 5 6\n7 3 9\n100",
"output": "10"
},
{
"input": "BSC\n100 1 1\n100 1 1\n100",
"output": "51"
},
{
"input": "SBBCCSBB\n1 50 100\n31 59 21\n100000",
"output": "370"
},
{
"input": "BBBBCCCCCCCCCCCCCCCCCCCCSSSSBBBBBBBBSS\n100 100 100\n1 1 1\n3628800",
"output": "95502"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n200",
"output": "0"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n2000",
"output": "1"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n300",
"output": "0"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n300000000",
"output": "42858"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n914159265358",
"output": "130594181"
},
{
"input": "SSSSSSSSSSBBBBBBBBBCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSBB\n31 53 97\n13 17 31\n914159265358",
"output": "647421579"
},
{
"input": "BBBCSBSBBSSSSCCCCBBCSBBBBSSBBBCBSCCSSCSSCSBSSSCCCCBSCSSBSSSCCCBBCCCSCBCBBCCSCCCCSBBCCBBBBCCCCCCBSSCB\n91 87 17\n64 44 43\n958532915587",
"output": "191668251"
},
{
"input": "CSSCBBCCCSBSCBBBCSBBBCBSBCSCBCSCBCBSBCBCSSBBSBBCBBBBSCSBBCCBCCBCBBSBSBCSCSBBSSBBCSSBCSCSCCSSBCBBCBSB\n56 34 48\n78 6 96\n904174875419",
"output": "140968956"
},
{
"input": "CCSCCCSBBBSCBSCSCCSSBBBSSBBBSBBBCBCSSBCSCBBCCCBCBCBCCCSSBSBBCCCCCBBSCBSCBCBBCBBCSSBCSBSSCCSCCSCCBBBS\n33 73 67\n4 56 42\n886653164314",
"output": "277425898"
},
{
"input": "SBCSSCBBSSBCSSBBBSSBSCBSSSCBBSBBBBCSBCSBSCBSCBSCBSBSSCCCCBSBCCBCBSCCCBSCCBSBBCBSSCCCCSBSBBBSSSBCSCBC\n94 16 85\n14 18 91\n836590091442",
"output": "217522127"
},
{
"input": "BSCSBSCCSCSSCCCSBCSSBCBBSCCBSCCSSSSSSSSSCCSBSCCBBCBBSBSCCCCBCSBSBSSBBBBBSSBSSCBCCSSBSSSCBBCSBBSBCCCB\n67 54 8\n36 73 37\n782232051273",
"output": "154164772"
},
{
"input": "CBBCBSBCCSCBSSCCBCSBCSBBSCBBCSCCBSCCSCSBBSSBSBSCBBSBBCSSSSBBBBSBBCBCSBBCBCSSBBCSBSCCSCSBCSCBSCCBBCSC\n71 71 52\n52 88 3\n654400055575",
"output": "137826467"
},
{
"input": "CBBCBSBCCSCBSSCCBCSBCSBBSCBBCSCCBSCCSCSBBSBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCBBCSC\n100 1 1\n1 17 23\n954400055575",
"output": "1355681897"
},
{
"input": "C\n100 100 100\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n100 100 100\n100 100 100\n1000000000000",
"output": "100000001"
},
{
"input": "B\n100 100 100\n1 1 1\n1",
"output": "101"
},
{
"input": "SC\n2 1 1\n1 1 1\n100000000000",
"output": "50000000001"
},
{
"input": "B\n100 1 1\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\n1 1 1\n100 100 100\n1000000000000",
"output": "100000000"
},
{
"input": "CC\n1 1 1\n100 100 100\n1",
"output": "0"
},
{
"input": "B\n100 100 100\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "BSC\n100 100 100\n1 1 1\n1000000000000",
"output": "333333333433"
},
{
"input": "BSC\n100 100 100\n1 1 1\n1",
"output": "100"
}
] | 1,598,777,298
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 2
| 1,000
| 7,065,600
|
retsept = input()
b = retsept.count('B')
s = retsept.count('S')
c = retsept.count('C')
kolvo_b, kolvo_s, kolvo_c = input().split()
kolvo_b = int(kolvo_b)
kolvo_s = int(kolvo_s)
kolvo_c = int(kolvo_c)
price_b, price_s, price_c = input().split()
price_b = int(price_b)
price_s = int(price_s)
price_c = int(price_c)
butget = int(input())
burgers = 0
while True:
if kolvo_b - b < 0:
if butget > price_b:
butget = butget - price_b
kolvo_b = kolvo_b + 1
else:
break
if kolvo_s - s < 0:
if butget > price_s:
butget = butget - price_s
kolvo_s = kolvo_s + 1
else:
break
if kolvo_c - c < 0:
if butget > price_c:
butget = butget - price_c
kolvo_c = kolvo_c + 1
else:
break
else:
while kolvo_b!=0 and kolvo_c!=0 and kolvo_s!=0:
kolvo_b = kolvo_b - b
kolvo_s = kolvo_s - s
kolvo_c = kolvo_c - c
burgers = burgers + 1
print(burgers)
|
Title: Hamburgers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus loves hamburgers very much. He especially adores the hamburgers he makes with his own hands. Polycarpus thinks that there are only three decent ingredients to make hamburgers from: a bread, sausage and cheese. He writes down the recipe of his favorite "Le Hamburger de Polycarpus" as a string of letters 'B' (bread), 'S' (sausage) и 'C' (cheese). The ingredients in the recipe go from bottom to top, for example, recipe "ВSCBS" represents the hamburger where the ingredients go from bottom to top as bread, sausage, cheese, bread and sausage again.
Polycarpus has *n**b* pieces of bread, *n**s* pieces of sausage and *n**c* pieces of cheese in the kitchen. Besides, the shop nearby has all three ingredients, the prices are *p**b* rubles for a piece of bread, *p**s* for a piece of sausage and *p**c* for a piece of cheese.
Polycarpus has *r* rubles and he is ready to shop on them. What maximum number of hamburgers can he cook? You can assume that Polycarpus cannot break or slice any of the pieces of bread, sausage or cheese. Besides, the shop has an unlimited number of pieces of each ingredient.
Input Specification:
The first line of the input contains a non-empty string that describes the recipe of "Le Hamburger de Polycarpus". The length of the string doesn't exceed 100, the string contains only letters 'B' (uppercase English B), 'S' (uppercase English S) and 'C' (uppercase English C).
The second line contains three integers *n**b*, *n**s*, *n**c* (1<=≤<=*n**b*,<=*n**s*,<=*n**c*<=≤<=100) — the number of the pieces of bread, sausage and cheese on Polycarpus' kitchen. The third line contains three integers *p**b*, *p**s*, *p**c* (1<=≤<=*p**b*,<=*p**s*,<=*p**c*<=≤<=100) — the price of one piece of bread, sausage and cheese in the shop. Finally, the fourth line contains integer *r* (1<=≤<=*r*<=≤<=1012) — the number of rubles Polycarpus has.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print the maximum number of hamburgers Polycarpus can make. If he can't make any hamburger, print 0.
Demo Input:
['BBBSSC\n6 4 1\n1 2 3\n4\n', 'BBC\n1 10 1\n1 10 1\n21\n', 'BSC\n1 1 1\n1 1 3\n1000000000000\n']
Demo Output:
['2\n', '7\n', '200000000001\n']
Note:
none
|
```python
retsept = input()
b = retsept.count('B')
s = retsept.count('S')
c = retsept.count('C')
kolvo_b, kolvo_s, kolvo_c = input().split()
kolvo_b = int(kolvo_b)
kolvo_s = int(kolvo_s)
kolvo_c = int(kolvo_c)
price_b, price_s, price_c = input().split()
price_b = int(price_b)
price_s = int(price_s)
price_c = int(price_c)
butget = int(input())
burgers = 0
while True:
if kolvo_b - b < 0:
if butget > price_b:
butget = butget - price_b
kolvo_b = kolvo_b + 1
else:
break
if kolvo_s - s < 0:
if butget > price_s:
butget = butget - price_s
kolvo_s = kolvo_s + 1
else:
break
if kolvo_c - c < 0:
if butget > price_c:
butget = butget - price_c
kolvo_c = kolvo_c + 1
else:
break
else:
while kolvo_b!=0 and kolvo_c!=0 and kolvo_s!=0:
kolvo_b = kolvo_b - b
kolvo_s = kolvo_s - s
kolvo_c = kolvo_c - c
burgers = burgers + 1
print(burgers)
```
| 0
|
|
315
|
B
|
Sereja and Array
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Sereja has got an array, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n*. Sereja is an active boy, so he is now going to complete *m* operations. Each operation will have one of the three forms:
1. Make *v**i*-th array element equal to *x**i*. In other words, perform the assignment *a**v**i*<==<=*x**i*. 1. Increase each array element by *y**i*. In other words, perform *n* assignments *a**i*<==<=*a**i*<=+<=*y**i* (1<=≤<=*i*<=≤<=*n*). 1. Take a piece of paper and write out the *q**i*-th array element. That is, the element *a**q**i*.
Help Sereja, complete all his operations.
|
The first line contains integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the original array.
Next *m* lines describe operations, the *i*-th line describes the *i*-th operation. The first number in the *i*-th line is integer *t**i* (1<=≤<=*t**i*<=≤<=3) that represents the operation type. If *t**i*<==<=1, then it is followed by two integers *v**i* and *x**i*, (1<=≤<=*v**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=109). If *t**i*<==<=2, then it is followed by integer *y**i* (1<=≤<=*y**i*<=≤<=104). And if *t**i*<==<=3, then it is followed by integer *q**i* (1<=≤<=*q**i*<=≤<=*n*).
|
For each third type operation print value *a**q**i*. Print the values in the order, in which the corresponding queries follow in the input.
|
[
"10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9\n"
] |
[
"2\n9\n11\n20\n30\n40\n39\n"
] |
none
| 1,000
|
[
{
"input": "10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9",
"output": "2\n9\n11\n20\n30\n40\n39"
},
{
"input": "1 3\n1\n1 1 2\n2 1\n3 1",
"output": "3"
},
{
"input": "1 1\n1\n3 1",
"output": "1"
},
{
"input": "6 6\n202714501 613423725 367325359 862808465 182588146 745008828\n2 492\n2 1943\n1 3 173984392\n1 3 9356383\n3 4\n1 5 472683539",
"output": "862810900"
},
{
"input": "6 5\n545129895 918519812 2334334 565540665 484519712 904102869\n3 3\n1 2 641196860\n2 779\n2 3036\n3 1",
"output": "2334334\n545133710"
},
{
"input": "5 5\n286163265 724763447 761775891 215352371 491215007\n1 4 780579549\n1 2 638546757\n3 4\n1 3 38072627\n2 6119",
"output": "780579549"
},
{
"input": "4 4\n529316834 995684640 949078705 317773978\n3 3\n3 1\n2 6271\n1 1 856879574",
"output": "949078705\n529316834"
},
{
"input": "5 4\n293170637 715384768 756975575 129004053 875201151\n1 3 695181967\n3 3\n2 2288\n1 5 332270946",
"output": "695181967"
}
] | 1,418,233,847
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 92
| 409,600
|
import sys
import math
n, m = [int(x) for x in (sys.stdin.readline()).split()]
an = [int(x) for x in (sys.stdin.readline()).split()]
k = [0] * 100001
vsum = 0
for i in range(m):
t = [int(x) for x in (sys.stdin.readline()).split()]
if(t[0] == 1):
k[t[1] - 1] += vsum
an[t[1] - 1] = t[2]
elif(t[0] == 2):
vsum += t[1]
elif(t[0] == 3):
print(str(an[t[1] - 1] + vsum - k[t[1] - 1]))
|
Title: Sereja and Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja has got an array, consisting of *n* integers, *a*1,<=*a*2,<=...,<=*a**n*. Sereja is an active boy, so he is now going to complete *m* operations. Each operation will have one of the three forms:
1. Make *v**i*-th array element equal to *x**i*. In other words, perform the assignment *a**v**i*<==<=*x**i*. 1. Increase each array element by *y**i*. In other words, perform *n* assignments *a**i*<==<=*a**i*<=+<=*y**i* (1<=≤<=*i*<=≤<=*n*). 1. Take a piece of paper and write out the *q**i*-th array element. That is, the element *a**q**i*.
Help Sereja, complete all his operations.
Input Specification:
The first line contains integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the original array.
Next *m* lines describe operations, the *i*-th line describes the *i*-th operation. The first number in the *i*-th line is integer *t**i* (1<=≤<=*t**i*<=≤<=3) that represents the operation type. If *t**i*<==<=1, then it is followed by two integers *v**i* and *x**i*, (1<=≤<=*v**i*<=≤<=*n*,<=1<=≤<=*x**i*<=≤<=109). If *t**i*<==<=2, then it is followed by integer *y**i* (1<=≤<=*y**i*<=≤<=104). And if *t**i*<==<=3, then it is followed by integer *q**i* (1<=≤<=*q**i*<=≤<=*n*).
Output Specification:
For each third type operation print value *a**q**i*. Print the values in the order, in which the corresponding queries follow in the input.
Demo Input:
['10 11\n1 2 3 4 5 6 7 8 9 10\n3 2\n3 9\n2 10\n3 1\n3 10\n1 1 10\n2 10\n2 10\n3 1\n3 10\n3 9\n']
Demo Output:
['2\n9\n11\n20\n30\n40\n39\n']
Note:
none
|
```python
import sys
import math
n, m = [int(x) for x in (sys.stdin.readline()).split()]
an = [int(x) for x in (sys.stdin.readline()).split()]
k = [0] * 100001
vsum = 0
for i in range(m):
t = [int(x) for x in (sys.stdin.readline()).split()]
if(t[0] == 1):
k[t[1] - 1] += vsum
an[t[1] - 1] = t[2]
elif(t[0] == 2):
vsum += t[1]
elif(t[0] == 3):
print(str(an[t[1] - 1] + vsum - k[t[1] - 1]))
```
| 0
|
|
199
|
A
|
Hexadecimal's theorem
|
PROGRAMMING
| 900
|
[
"brute force",
"constructive algorithms",
"implementation",
"number theory"
] | null | null |
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
|
The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
|
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them.
|
[
"3\n",
"13\n"
] |
[
"1 1 1\n",
"2 3 8\n"
] |
none
| 500
|
[
{
"input": "3",
"output": "1 1 1"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "0",
"output": "0 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "1",
"output": "1 0 0"
},
{
"input": "2",
"output": "1 1 0"
},
{
"input": "3",
"output": "1 1 1"
},
{
"input": "5",
"output": "1 1 3"
},
{
"input": "8",
"output": "1 2 5"
},
{
"input": "13",
"output": "2 3 8"
},
{
"input": "21",
"output": "3 5 13"
},
{
"input": "34",
"output": "5 8 21"
},
{
"input": "55",
"output": "8 13 34"
},
{
"input": "89",
"output": "13 21 55"
},
{
"input": "144",
"output": "21 34 89"
},
{
"input": "233",
"output": "34 55 144"
},
{
"input": "377",
"output": "55 89 233"
},
{
"input": "610",
"output": "89 144 377"
},
{
"input": "987",
"output": "144 233 610"
},
{
"input": "1597",
"output": "233 377 987"
},
{
"input": "2584",
"output": "377 610 1597"
},
{
"input": "4181",
"output": "610 987 2584"
},
{
"input": "6765",
"output": "987 1597 4181"
},
{
"input": "10946",
"output": "1597 2584 6765"
},
{
"input": "17711",
"output": "2584 4181 10946"
},
{
"input": "28657",
"output": "4181 6765 17711"
},
{
"input": "46368",
"output": "6765 10946 28657"
},
{
"input": "75025",
"output": "10946 17711 46368"
},
{
"input": "121393",
"output": "17711 28657 75025"
},
{
"input": "196418",
"output": "28657 46368 121393"
},
{
"input": "317811",
"output": "46368 75025 196418"
},
{
"input": "514229",
"output": "75025 121393 317811"
},
{
"input": "832040",
"output": "121393 196418 514229"
},
{
"input": "1346269",
"output": "196418 317811 832040"
},
{
"input": "2178309",
"output": "317811 514229 1346269"
},
{
"input": "3524578",
"output": "514229 832040 2178309"
},
{
"input": "5702887",
"output": "832040 1346269 3524578"
},
{
"input": "9227465",
"output": "1346269 2178309 5702887"
},
{
"input": "14930352",
"output": "2178309 3524578 9227465"
},
{
"input": "24157817",
"output": "3524578 5702887 14930352"
},
{
"input": "39088169",
"output": "5702887 9227465 24157817"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "165580141",
"output": "24157817 39088169 102334155"
},
{
"input": "267914296",
"output": "39088169 63245986 165580141"
},
{
"input": "433494437",
"output": "63245986 102334155 267914296"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "701408733",
"output": "102334155 165580141 433494437"
},
{
"input": "102334155",
"output": "14930352 24157817 63245986"
},
{
"input": "63245986",
"output": "9227465 14930352 39088169"
}
] | 1,543,299,499
| 2,147,483,647
|
Python 3
|
MEMORY_LIMIT_EXCEEDED
|
TESTS
| 2
| 2,088
| 268,390,400
|
if __name__== "__main__":
n=int(input())
lst=[-1,0,1]
b=0
a=1
j=3
f=1
i=1
while (f!=n):
t=a
a=a+b
b=t
f=a
lst.append(f)
l=len(lst)
if n<=3:
if n<=2:
print("I'm too stupid to solve this problem")
else:
print(1,1,1)
else:
print(lst[l-5],lst[l-4],lst[l-2])
|
Title: Hexadecimal's theorem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, a chaotic virus Hexadecimal advanced a new theorem which will shake the Universe. She thinks that each Fibonacci number can be represented as sum of three not necessary different Fibonacci numbers.
Let's remember how Fibonacci numbers can be calculated. *F*0<==<=0, *F*1<==<=1, and all the next numbers are *F**i*<==<=*F**i*<=-<=2<=+<=*F**i*<=-<=1.
So, Fibonacci numbers make a sequence of numbers: 0, 1, 1, 2, 3, 5, 8, 13, ...
If you haven't run away from the PC in fear, you have to help the virus. Your task is to divide given Fibonacci number *n* by three not necessary different Fibonacci numbers or say that it is impossible.
Input Specification:
The input contains of a single integer *n* (0<=≤<=*n*<=<<=109) — the number that should be represented by the rules described above. It is guaranteed that *n* is a Fibonacci number.
Output Specification:
Output three required numbers: *a*, *b* and *c*. If there is no answer for the test you have to print "I'm too stupid to solve this problem" without the quotes.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '13\n']
Demo Output:
['1 1 1\n', '2 3 8\n']
Note:
none
|
```python
if __name__== "__main__":
n=int(input())
lst=[-1,0,1]
b=0
a=1
j=3
f=1
i=1
while (f!=n):
t=a
a=a+b
b=t
f=a
lst.append(f)
l=len(lst)
if n<=3:
if n<=2:
print("I'm too stupid to solve this problem")
else:
print(1,1,1)
else:
print(lst[l-5],lst[l-4],lst[l-2])
```
| 0
|
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,689,533,133
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 46
| 0
|
n = int(input())
data = list(map(int, input().split()))
l, r, d, s = 0, n - 1, 0, 0
while l <= r:
if (l + r) % 2 == (n - 1) % 2:
if data[l] > data[r]:
s += data[l]
l += 1
else:
s += data[r]
r -= 1
else:
if data[l] > data[r]:
d += data[l]
l += 1
else:
d += data[r]
r -= 1
print(s, d)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
n = int(input())
data = list(map(int, input().split()))
l, r, d, s = 0, n - 1, 0, 0
while l <= r:
if (l + r) % 2 == (n - 1) % 2:
if data[l] > data[r]:
s += data[l]
l += 1
else:
s += data[r]
r -= 1
else:
if data[l] > data[r]:
d += data[l]
l += 1
else:
d += data[r]
r -= 1
print(s, d)
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Julia is going to cook a chicken in the kitchen of her dormitory. To save energy, the stove in the kitchen automatically turns off after *k* minutes after turning on.
During cooking, Julia goes to the kitchen every *d* minutes and turns on the stove if it is turned off. While the cooker is turned off, it stays warm. The stove switches on and off instantly.
It is known that the chicken needs *t* minutes to be cooked on the stove, if it is turned on, and 2*t* minutes, if it is turned off. You need to find out, how much time will Julia have to cook the chicken, if it is considered that the chicken is cooked evenly, with constant speed when the stove is turned on and at a constant speed when it is turned off.
|
The single line contains three integers *k*, *d* and *t* (1<=≤<=*k*,<=*d*,<=*t*<=≤<=1018).
|
Print a single number, the total time of cooking in minutes. The relative or absolute error must not exceed 10<=-<=9.
Namely, let's assume that your answer is *x* and the answer of the jury is *y*. The checker program will consider your answer correct if .
|
[
"3 2 6\n",
"4 2 20\n"
] |
[
"6.5\n",
"20.0\n"
] |
In the first example, the chicken will be cooked for 3 minutes on the turned on stove, after this it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cce5d3f2f46552034d5ae5d487725705429ec7a5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Then the chicken will be cooked for one minute on a turned off stove, it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a10fa55d1324328f9ba60c9343ed0ecb0506d678.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Thus, after four minutes the chicken will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6fcc8bd6c2188b260d9d18e7b6c9e3908848df71.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Before the fifth minute Julia will turn on the stove and after 2.5 minutes the chicken will be ready <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/87a86c8e9632089279245fff912c077126c4e704.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second example, when the stove is turned off, Julia will immediately turn it on, so the stove will always be turned on and the chicken will be cooked in 20 minutes.
| 0
|
[
{
"input": "3 2 6",
"output": "6.5"
},
{
"input": "4 2 20",
"output": "20.0"
},
{
"input": "8 10 9",
"output": "10.0"
},
{
"input": "43 50 140",
"output": "150.5"
},
{
"input": "251 79 76",
"output": "76.0"
},
{
"input": "892 67 1000",
"output": "1023.0"
},
{
"input": "1000 1000 1000",
"output": "1000.0"
},
{
"input": "87 4 1000",
"output": "1005.5"
},
{
"input": "1 629 384378949109878497",
"output": "767537647587662141"
},
{
"input": "2124 6621 12695",
"output": "19018"
},
{
"input": "27548 68747 111",
"output": "111.0"
},
{
"input": "74974 46016 1000000000",
"output": "1102134775.0"
},
{
"input": "223 844 704",
"output": "1014.5"
},
{
"input": "1 558 743",
"output": "1483"
},
{
"input": "43 387 402",
"output": "718"
},
{
"input": "972 2 763",
"output": "763.0"
},
{
"input": "330 167 15",
"output": "15.0"
},
{
"input": "387 43 650",
"output": "650.0"
},
{
"input": "1 314 824",
"output": "1642"
},
{
"input": "2 4 18",
"output": "24.0"
},
{
"input": "3 5 127",
"output": "158.0"
},
{
"input": "3260 4439 6837",
"output": "7426.5"
},
{
"input": "3950 7386 195",
"output": "195.0"
},
{
"input": "18036 47899 1000000000",
"output": "1452914012"
},
{
"input": "29 46 1000000000",
"output": "1226666661.0"
},
{
"input": "403 957 1000000000000000000",
"output": "1407352941176470446"
},
{
"input": "999999999999999999 1000000000000000000 1000000000000000000",
"output": "1000000000000000000.5"
},
{
"input": "9 1000000000000000000 1000000000000000000",
"output": "1999999999999999982"
},
{
"input": "1 2 1000000000000000000",
"output": "1333333333333333333.0"
},
{
"input": "2 5 1000000000000000000",
"output": "1428571428571428571.0"
},
{
"input": "81413279254461199 310548139128293806 1000000000000000000",
"output": "1572837149684581517.5"
},
{
"input": "6 3 417701740543616353",
"output": "417701740543616353.0"
},
{
"input": "17 68 4913",
"output": "7854"
},
{
"input": "68 17 4913",
"output": "4913.0"
},
{
"input": "121 395 621154158314692955",
"output": "950991831528308936"
},
{
"input": "897 443 134730567336441375",
"output": "160877739434079591.0"
},
{
"input": "200 10 979220166595737684",
"output": "979220166595737684.0"
},
{
"input": "740 251 930540301905511549",
"output": "938642796161889076.5"
},
{
"input": "4 232 801899894850800409",
"output": "1576616742418522838"
},
{
"input": "472 499 166288453006087540",
"output": "170912333779686266.5"
},
{
"input": "42 9 1000000000000000000",
"output": "1034482758620689654.0"
},
{
"input": "312 93 1000000000000000000",
"output": "1087719298245614020.0"
},
{
"input": "1000 1000 1000000000000000000",
"output": "1000000000000000000.0"
},
{
"input": "6000 1000 1000000000",
"output": "1000000000.0"
},
{
"input": "9999999999 33333 1000000000",
"output": "1000000000.0"
},
{
"input": "33333 9999999999 1000000000",
"output": "1999966667"
},
{
"input": "25441360464 2658201820 1000000000",
"output": "1000000000.0"
},
{
"input": "20958318104 46685 253251869",
"output": "253251869.0"
},
{
"input": "963276084 698548036 1000000000",
"output": "1036723916"
},
{
"input": "574520976350867177 413897686591532160 1000000000000000000",
"output": "1126637198416098571.5"
},
{
"input": "575556838390916379 15 1000000000000000000",
"output": "1000000000000000003.0"
},
{
"input": "1000000000000000000 1000000000000000000 1000000000000000000",
"output": "1000000000000000000.0"
},
{
"input": "1 1000000000000000000 1000000000000000000",
"output": "1999999999999999998"
},
{
"input": "8 1000000000000000000 1000000000000000000",
"output": "1999999999999999984"
},
{
"input": "1 976958144546785462 1000000000000000000",
"output": "1999999999999999997"
},
{
"input": "3 10 1000000000000000000",
"output": "1538461538461538461.0"
},
{
"input": "312200625484460654 543737694709247394 1000000000000000000",
"output": "1231537069224786740.0"
},
{
"input": "2 99 53",
"output": "102"
},
{
"input": "900000000000000000 1 1234",
"output": "1234.0"
}
] | 1,531,531,621
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 77
| 0
|
import math
k,d,t = map(int,input().split())
n = k // d
if k % d : n += 1
x = (k + d) / (2 * t)
cnt = 1 / x
cnt = math.floor(cnt)
rest = 1 - x * cnt
ans = cnt * n * d + rest * t
if(k / t < rest):ans += (rest - k / t) * t
print(ans)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Julia is going to cook a chicken in the kitchen of her dormitory. To save energy, the stove in the kitchen automatically turns off after *k* minutes after turning on.
During cooking, Julia goes to the kitchen every *d* minutes and turns on the stove if it is turned off. While the cooker is turned off, it stays warm. The stove switches on and off instantly.
It is known that the chicken needs *t* minutes to be cooked on the stove, if it is turned on, and 2*t* minutes, if it is turned off. You need to find out, how much time will Julia have to cook the chicken, if it is considered that the chicken is cooked evenly, with constant speed when the stove is turned on and at a constant speed when it is turned off.
Input Specification:
The single line contains three integers *k*, *d* and *t* (1<=≤<=*k*,<=*d*,<=*t*<=≤<=1018).
Output Specification:
Print a single number, the total time of cooking in minutes. The relative or absolute error must not exceed 10<=-<=9.
Namely, let's assume that your answer is *x* and the answer of the jury is *y*. The checker program will consider your answer correct if .
Demo Input:
['3 2 6\n', '4 2 20\n']
Demo Output:
['6.5\n', '20.0\n']
Note:
In the first example, the chicken will be cooked for 3 minutes on the turned on stove, after this it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cce5d3f2f46552034d5ae5d487725705429ec7a5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Then the chicken will be cooked for one minute on a turned off stove, it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a10fa55d1324328f9ba60c9343ed0ecb0506d678.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Thus, after four minutes the chicken will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6fcc8bd6c2188b260d9d18e7b6c9e3908848df71.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Before the fifth minute Julia will turn on the stove and after 2.5 minutes the chicken will be ready <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/87a86c8e9632089279245fff912c077126c4e704.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second example, when the stove is turned off, Julia will immediately turn it on, so the stove will always be turned on and the chicken will be cooked in 20 minutes.
|
```python
import math
k,d,t = map(int,input().split())
n = k // d
if k % d : n += 1
x = (k + d) / (2 * t)
cnt = 1 / x
cnt = math.floor(cnt)
rest = 1 - x * cnt
ans = cnt * n * d + rest * t
if(k / t < rest):ans += (rest - k / t) * t
print(ans)
```
| 0
|
|
937
|
B
|
Vile Grasshoppers
|
PROGRAMMING
| 1,400
|
[
"brute force",
"math",
"number theory"
] | null | null |
The weather is fine today and hence it's high time to climb the nearby pine and enjoy the landscape.
The pine's trunk includes several branches, located one above another and numbered from 2 to *y*. Some of them (more precise, from 2 to *p*) are occupied by tiny vile grasshoppers which you're at war with. These grasshoppers are known for their awesome jumping skills: the grasshopper at branch *x* can jump to branches .
Keeping this in mind, you wisely decided to choose such a branch that none of the grasshoppers could interrupt you. At the same time you wanna settle as high as possible since the view from up there is simply breathtaking.
In other words, your goal is to find the highest branch that cannot be reached by any of the grasshoppers or report that it's impossible.
|
The only line contains two integers *p* and *y* (2<=≤<=*p*<=≤<=*y*<=≤<=109).
|
Output the number of the highest suitable branch. If there are none, print -1 instead.
|
[
"3 6\n",
"3 4\n"
] |
[
"5\n",
"-1\n"
] |
In the first sample case grasshopper from branch 2 reaches branches 2, 4 and 6 while branch 3 is initially settled by another grasshopper. Therefore the answer is 5.
It immediately follows that there are no valid branches in second sample case.
| 1,000
|
[
{
"input": "3 6",
"output": "5"
},
{
"input": "3 4",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "5 50",
"output": "49"
},
{
"input": "944192806 944193066",
"output": "944192807"
},
{
"input": "1000000000 1000000000",
"output": "-1"
},
{
"input": "2 1000000000",
"output": "999999999"
},
{
"input": "28788 944193066",
"output": "944192833"
},
{
"input": "49 52",
"output": "-1"
},
{
"input": "698964997 734575900",
"output": "734575871"
},
{
"input": "287894773 723316271",
"output": "723316207"
},
{
"input": "171837140 733094070",
"output": "733094069"
},
{
"input": "37839169 350746807",
"output": "350746727"
},
{
"input": "125764821 234689174",
"output": "234689137"
},
{
"input": "413598841 430509920",
"output": "430509917"
},
{
"input": "145320418 592508508",
"output": "592508479"
},
{
"input": "155098216 476450875",
"output": "476450861"
},
{
"input": "459843315 950327842",
"output": "950327831"
},
{
"input": "469621113 834270209",
"output": "834270209"
},
{
"input": "13179877 557546766",
"output": "557546753"
},
{
"input": "541748242 723508350",
"output": "723508301"
},
{
"input": "607450717 924641194",
"output": "924641189"
},
{
"input": "786360384 934418993",
"output": "934418981"
},
{
"input": "649229491 965270051",
"output": "965270051"
},
{
"input": "144179719 953974590",
"output": "953974583"
},
{
"input": "28122086 963752388",
"output": "963752347"
},
{
"input": "268497487 501999053",
"output": "501999053"
},
{
"input": "356423140 385941420",
"output": "385941419"
},
{
"input": "71233638 269883787",
"output": "269883787"
},
{
"input": "2601 698964997",
"output": "698964983"
},
{
"input": "4096 287894773",
"output": "287894771"
},
{
"input": "5675 171837140",
"output": "171837131"
},
{
"input": "13067 350746807",
"output": "350746727"
},
{
"input": "8699 234689174",
"output": "234689137"
},
{
"input": "12190 413598841",
"output": "413598817"
},
{
"input": "20555 592508508",
"output": "592508479"
},
{
"input": "19137 476450875",
"output": "476450861"
},
{
"input": "8793 950327842",
"output": "950327831"
},
{
"input": "1541 834270209",
"output": "834270209"
},
{
"input": "1082 13179877",
"output": "13179871"
},
{
"input": "3888 723508350",
"output": "723508301"
},
{
"input": "14078 607450717",
"output": "607450703"
},
{
"input": "20869 786360384",
"output": "786360373"
},
{
"input": "13689 965270051",
"output": "965270051"
},
{
"input": "782 144179719",
"output": "144179719"
},
{
"input": "404 28122086",
"output": "28122079"
},
{
"input": "21992 501999053",
"output": "501999053"
},
{
"input": "13745 385941420",
"output": "385941419"
},
{
"input": "8711 269883787",
"output": "269883787"
},
{
"input": "31333 981756889",
"output": "981756871"
},
{
"input": "944192808 944193061",
"output": "-1"
},
{
"input": "3 9",
"output": "7"
},
{
"input": "4 5",
"output": "5"
},
{
"input": "2 13",
"output": "13"
},
{
"input": "7 53",
"output": "53"
},
{
"input": "10 1000000000",
"output": "999999997"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "4 9",
"output": "7"
}
] | 1,593,989,407
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 1
| 108
| 20,172,800
|
from sys import stdin
def is_prime(n):
if n <= 1:
return False
if n <= 3:
return True
if n % 2 == 0 or n % 3 == 0:
return False
i = 5
while i * i <= n:
if n % i == 0 or n % (i + 2) == 0:
return False
i = i + 6
return True
x, y = map(int, stdin.readline().rstrip().split(" "))
r = 0
if x == y or y == 2:
print(-1)
else:
if y%2==0:
y = y - 1
for i in range(y, x-1, -2):
if is_prime(i):
r = i
break
if r:
print(r)
else:
print(-1)
|
Title: Vile Grasshoppers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The weather is fine today and hence it's high time to climb the nearby pine and enjoy the landscape.
The pine's trunk includes several branches, located one above another and numbered from 2 to *y*. Some of them (more precise, from 2 to *p*) are occupied by tiny vile grasshoppers which you're at war with. These grasshoppers are known for their awesome jumping skills: the grasshopper at branch *x* can jump to branches .
Keeping this in mind, you wisely decided to choose such a branch that none of the grasshoppers could interrupt you. At the same time you wanna settle as high as possible since the view from up there is simply breathtaking.
In other words, your goal is to find the highest branch that cannot be reached by any of the grasshoppers or report that it's impossible.
Input Specification:
The only line contains two integers *p* and *y* (2<=≤<=*p*<=≤<=*y*<=≤<=109).
Output Specification:
Output the number of the highest suitable branch. If there are none, print -1 instead.
Demo Input:
['3 6\n', '3 4\n']
Demo Output:
['5\n', '-1\n']
Note:
In the first sample case grasshopper from branch 2 reaches branches 2, 4 and 6 while branch 3 is initially settled by another grasshopper. Therefore the answer is 5.
It immediately follows that there are no valid branches in second sample case.
|
```python
from sys import stdin
def is_prime(n):
if n <= 1:
return False
if n <= 3:
return True
if n % 2 == 0 or n % 3 == 0:
return False
i = 5
while i * i <= n:
if n % i == 0 or n % (i + 2) == 0:
return False
i = i + 6
return True
x, y = map(int, stdin.readline().rstrip().split(" "))
r = 0
if x == y or y == 2:
print(-1)
else:
if y%2==0:
y = y - 1
for i in range(y, x-1, -2):
if is_prime(i):
r = i
break
if r:
print(r)
else:
print(-1)
```
| 0
|
|
761
|
A
|
Dasha and Stairs
|
PROGRAMMING
| 1,000
|
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
|
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
|
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
|
[
"2 3\n",
"3 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
| 500
|
[
{
"input": "2 3",
"output": "YES"
},
{
"input": "3 1",
"output": "NO"
},
{
"input": "5 4",
"output": "YES"
},
{
"input": "9 9",
"output": "YES"
},
{
"input": "85 95",
"output": "NO"
},
{
"input": "0 1",
"output": "YES"
},
{
"input": "89 25",
"output": "NO"
},
{
"input": "74 73",
"output": "YES"
},
{
"input": "62 39",
"output": "NO"
},
{
"input": "57 57",
"output": "YES"
},
{
"input": "100 99",
"output": "YES"
},
{
"input": "0 0",
"output": "NO"
},
{
"input": "98 100",
"output": "NO"
},
{
"input": "99 100",
"output": "YES"
},
{
"input": "1 0",
"output": "YES"
},
{
"input": "100 0",
"output": "NO"
},
{
"input": "0 100",
"output": "NO"
},
{
"input": "100 98",
"output": "NO"
},
{
"input": "100 100",
"output": "YES"
},
{
"input": "0 5",
"output": "NO"
},
{
"input": "2 2",
"output": "YES"
}
] | 1,501,679,390
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 11
| 46
| 4,608,000
|
a, b = (int(i) for i in input().split())
print("YES" if abs(a - b) <= 1 else "NO")
|
Title: Dasha and Stairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
Input Specification:
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
Output Specification:
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
Demo Input:
['2 3\n', '3 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
|
```python
a, b = (int(i) for i in input().split())
print("YES" if abs(a - b) <= 1 else "NO")
```
| 0
|
|
749
|
A
|
Bachgold Problem
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"math",
"number theory"
] | null | null |
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
|
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
|
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
|
[
"5\n",
"6\n"
] |
[
"2\n2 3\n",
"3\n2 2 2\n"
] |
none
| 500
|
[
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,644,756,139
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
#def is_prime(n):
# if n == 2:
# return True
# else:
# for i in range(2, n):
# if n % i == 0:
# return False
# else:
# continue
#
# return True
#
#def main():
# N = int(input())
# primes = []
# for i in range(2, N):
# if is_prime(i):
# primes.append(i)
# else:
# continue
#
#
# odds = []
# if N % 2 == 0: # if N is an even number
# for _ in range(N // 2):
# print(2, end = " ")
#
# else: # if N is an odd number; things will be change in order to find the maximum summands
# for _ in range((N-3)//2):
# odds.append(2)
#
# odds.append(3)
# for o in range(len(odds)):
# print(odds[o], end = " ")
#
#
#main()
def main():
N = int(input())
if N % 2 == 0:
for i in range(N // 2):
print(2, end = " ")
else:
odds = []
for i in range((N -3) // 2):
odds.append(2)
odds.append(3)
for j in range(len(odds)):
print(odds[j], end = " ")
main()
|
Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
Output Specification:
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none
|
```python
#def is_prime(n):
# if n == 2:
# return True
# else:
# for i in range(2, n):
# if n % i == 0:
# return False
# else:
# continue
#
# return True
#
#def main():
# N = int(input())
# primes = []
# for i in range(2, N):
# if is_prime(i):
# primes.append(i)
# else:
# continue
#
#
# odds = []
# if N % 2 == 0: # if N is an even number
# for _ in range(N // 2):
# print(2, end = " ")
#
# else: # if N is an odd number; things will be change in order to find the maximum summands
# for _ in range((N-3)//2):
# odds.append(2)
#
# odds.append(3)
# for o in range(len(odds)):
# print(odds[o], end = " ")
#
#
#main()
def main():
N = int(input())
if N % 2 == 0:
for i in range(N // 2):
print(2, end = " ")
else:
odds = []
for i in range((N -3) // 2):
odds.append(2)
odds.append(3)
for j in range(len(odds)):
print(odds[j], end = " ")
main()
```
| 0
|
|
385
|
B
|
Bear and Strings
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy",
"implementation",
"math",
"strings"
] | null | null |
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
|
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
|
Print a single number — the answer to the problem.
|
[
"bearbtear\n",
"bearaabearc\n"
] |
[
"6\n",
"20\n"
] |
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11).
| 1,000
|
[
{
"input": "bearbtear",
"output": "6"
},
{
"input": "bearaabearc",
"output": "20"
},
{
"input": "pbearbearhbearzqbearjkterasjhy",
"output": "291"
},
{
"input": "pbearjbearbebearnbabcffbearbearwubearjezpiorrbearbearjbdlbearbearqbearjbearwipmsbearoaftrsebearzsnqb",
"output": "4419"
},
{
"input": "bear",
"output": "1"
},
{
"input": "a",
"output": "0"
},
{
"input": "be",
"output": "0"
}
] | 1,685,457,920
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
str7 = input("")
a = len(str7)
s = 0
for i in range(a - 3):
if str7[i:i+4] == "bear":
s += 1
print(s)
|
Title: Bear and Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
Input Specification:
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['bearbtear\n', 'bearaabearc\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11).
|
```python
str7 = input("")
a = len(str7)
s = 0
for i in range(a - 3):
if str7[i:i+4] == "bear":
s += 1
print(s)
```
| 0
|
|
1,003
|
A
|
Polycarp's Pockets
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
|
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
|
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
|
[
"6\n1 2 4 3 3 2\n",
"1\n100\n"
] |
[
"2\n",
"1\n"
] |
none
| 0
|
[
{
"input": "6\n1 2 4 3 3 2",
"output": "2"
},
{
"input": "1\n100",
"output": "1"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71",
"output": "51"
},
{
"input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29",
"output": "1"
},
{
"input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24",
"output": "2"
},
{
"input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6",
"output": "10"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "99"
},
{
"input": "7\n1 2 3 3 3 1 2",
"output": "3"
},
{
"input": "5\n1 2 3 4 5",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 1 1",
"output": "3"
},
{
"input": "12\n1 2 1 1 1 1 1 1 1 1 1 1",
"output": "11"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "14"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "16"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "10\n1 1 1 1 2 2 1 1 9 10",
"output": "6"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "56"
},
{
"input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92",
"output": "6"
},
{
"input": "10\n1 2 2 3 3 3 4 4 4 4",
"output": "4"
},
{
"input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21",
"output": "3"
},
{
"input": "5\n5 5 5 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 5 2 6",
"output": "3"
},
{
"input": "3\n58 59 58",
"output": "2"
},
{
"input": "9\n1 2 3 4 5 6 7 8 8",
"output": "2"
},
{
"input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "97"
},
{
"input": "3\n95 95 4",
"output": "2"
},
{
"input": "3\n2 2 5",
"output": "2"
}
] | 1,663,150,115
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 46
| 102,400
|
from collections import Counter
l=int(input())
l1=[int(i) for i in input().split()]
s=Counter(l1)
val=list(s.values())
print(max(val))
|
Title: Polycarp's Pockets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
Output Specification:
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
Demo Input:
['6\n1 2 4 3 3 2\n', '1\n100\n']
Demo Output:
['2\n', '1\n']
Note:
none
|
```python
from collections import Counter
l=int(input())
l1=[int(i) for i in input().split()]
s=Counter(l1)
val=list(s.values())
print(max(val))
```
| 3
|
|
230
|
B
|
T-primes
|
PROGRAMMING
| 1,300
|
[
"binary search",
"implementation",
"math",
"number theory"
] | null | null |
We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not.
|
The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier.
|
Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't.
|
[
"3\n4 5 6\n"
] |
[
"YES\nNO\nNO\n"
] |
The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO".
| 500
|
[
{
"input": "3\n4 5 6",
"output": "YES\nNO\nNO"
},
{
"input": "2\n48 49",
"output": "NO\nYES"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "NO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO"
},
{
"input": "1\n36",
"output": "NO"
},
{
"input": "1\n999966000289",
"output": "YES"
},
{
"input": "1\n999993399999",
"output": "NO"
},
{
"input": "9\n111 121 131 111 121 131 111 121 131",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nNO"
},
{
"input": "1\n1",
"output": "NO"
},
{
"input": "1\n10",
"output": "NO"
},
{
"input": "1\n976197352729",
"output": "NO"
},
{
"input": "1\n1000000000000",
"output": "NO"
},
{
"input": "1\n9",
"output": "YES"
},
{
"input": "6\n549755813888 847288609443 762939453125 678223072849 285311670611 137858491849",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "3\n223092870 6469693230 200560490130",
"output": "NO\nNO\nNO"
},
{
"input": "2\n81 25",
"output": "NO\nYES"
},
{
"input": "1\n16",
"output": "NO"
},
{
"input": "22\n1 2 3 4 5 6 7 8 9 10 12752041 64 121 144 27550356289 124 24657 23756 135153365 25235235235 42351351 81",
"output": "NO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "1\n225",
"output": "NO"
},
{
"input": "1\n1521",
"output": "NO"
},
{
"input": "1\n81",
"output": "NO"
}
] | 1,697,112,530
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
import math
#埃氏筛算法生成范围内所有素数
def sushu(n):
primes=[True]*(n+1)
primes[0]=primes[1]=False
x=2
while x*x<=n:
if primes[x]:
for i in range(x*x,n+1,x):
primes[i]=False
x+=1
return primes
#读取输入
n=int(input())
numbers=list(map(int,input().split()))
m=max(numbers)
primes=sushu(int(math.sqrt(m))+1)
for number in numbers:
a=math.sqrt(number)
A=int(a)
if A*A!=number:
print('NO')
else:
if primes[A]:
print('Yes')
else:
print('NO')
|
Title: T-primes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not.
Input Specification:
The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't.
Demo Input:
['3\n4 5 6\n']
Demo Output:
['YES\nNO\nNO\n']
Note:
The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO".
|
```python
import math
#埃氏筛算法生成范围内所有素数
def sushu(n):
primes=[True]*(n+1)
primes[0]=primes[1]=False
x=2
while x*x<=n:
if primes[x]:
for i in range(x*x,n+1,x):
primes[i]=False
x+=1
return primes
#读取输入
n=int(input())
numbers=list(map(int,input().split()))
m=max(numbers)
primes=sushu(int(math.sqrt(m))+1)
for number in numbers:
a=math.sqrt(number)
A=int(a)
if A*A!=number:
print('NO')
else:
if primes[A]:
print('Yes')
else:
print('NO')
```
| 0
|
|
785
|
A
|
Anton and Polyhedrons
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
|
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
|
[
"4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n",
"3\nDodecahedron\nOctahedron\nOctahedron\n"
] |
[
"42\n",
"28\n"
] |
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
| 500
|
[
{
"input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron",
"output": "42"
},
{
"input": "3\nDodecahedron\nOctahedron\nOctahedron",
"output": "28"
},
{
"input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron",
"output": "256"
},
{
"input": "1\nTetrahedron",
"output": "4"
},
{
"input": "1\nCube",
"output": "6"
},
{
"input": "1\nOctahedron",
"output": "8"
},
{
"input": "1\nDodecahedron",
"output": "12"
},
{
"input": "1\nIcosahedron",
"output": "20"
},
{
"input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron",
"output": "340"
}
] | 1,675,861,902
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 249
| 0
|
faces = {
"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20
}
ans = 0
for _ in range(int(input())):
ans += faces[input()]
print(ans)
|
Title: Anton and Polyhedrons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output Specification:
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
Demo Input:
['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n']
Demo Output:
['42\n', '28\n']
Note:
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
|
```python
faces = {
"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20
}
ans = 0
for _ in range(int(input())):
ans += faces[input()]
print(ans)
```
| 3
|
|
894
|
A
|
QAQ
|
PROGRAMMING
| 800
|
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integer — the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500
|
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,592,640,004
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 109
| 307,200
|
def answer():
a = [x for x in list(input()) if x in "AQ"]
i=0
ans=0
while i<len(a):
if a[i]=="Q":
j=i+1
while j<len(a):
if a[j]=="A":
k=j+1
while k<len(a):
if a[k]=="Q":
ans+=1
k+=1
j+=1
i+=1
print(ans)
answer()
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
def answer():
a = [x for x in list(input()) if x in "AQ"]
i=0
ans=0
while i<len(a):
if a[i]=="Q":
j=i+1
while j<len(a):
if a[j]=="A":
k=j+1
while k<len(a):
if a[k]=="Q":
ans+=1
k+=1
j+=1
i+=1
print(ans)
answer()
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Leha decided to move to a quiet town Vičkopolis, because he was tired by living in Bankopolis. Upon arrival he immediately began to expand his network of hacked computers. During the week Leha managed to get access to *n* computers throughout the town. Incidentally all the computers, which were hacked by Leha, lie on the same straight line, due to the reason that there is the only one straight street in Vičkopolis.
Let's denote the coordinate system on this street. Besides let's number all the hacked computers with integers from 1 to *n*. So the *i*-th hacked computer is located at the point *x**i*. Moreover the coordinates of all computers are distinct.
Leha is determined to have a little rest after a hard week. Therefore he is going to invite his friend Noora to a restaurant. However the girl agrees to go on a date with the only one condition: Leha have to solve a simple task.
Leha should calculate a sum of *F*(*a*) for all *a*, where *a* is a non-empty subset of the set, that consists of all hacked computers. Formally, let's denote *A* the set of all integers from 1 to *n*. Noora asks the hacker to find value of the expression . Here *F*(*a*) is calculated as the maximum among the distances between all pairs of computers from the set *a*. Formally, . Since the required sum can be quite large Noora asks to find it modulo 109<=+<=7.
Though, Leha is too tired. Consequently he is not able to solve this task. Help the hacker to attend a date.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=3·105) denoting the number of hacked computers.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109) denoting the coordinates of hacked computers. It is guaranteed that all *x**i* are distinct.
|
Print a single integer — the required sum modulo 109<=+<=7.
|
[
"2\n4 7\n",
"3\n4 3 1\n"
] |
[
"3\n",
"9\n"
] |
There are three non-empty subsets in the first sample test:<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/02b2d12556dad85f1c6c6912786eb87d4be2ea17.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/22f6a537962c86b3e28ddb8aaca28a7cdd219a8c.png" style="max-width: 100.0%;max-height: 100.0%;"/> and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7d0f73b3e94e13cb797f39e93d9da74835c5a02d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. The first and the second subset increase the sum by 0 and the third subset increases the sum by 7 - 4 = 3. In total the answer is 0 + 0 + 3 = 3.
There are seven non-empty subsets in the second sample test. Among them only the following subsets increase the answer: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f368c407c8e85e2b5fedfffaff39d471d765f026.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bb8f2118a3ac352db393b1f067b28e398ce7f816.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/049032074c04b16bc0cc153f95471c40b222072b.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc93c7f5b3d122314c9c5a707fae556a8f72a574.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In total the sum is (4 - 3) + (4 - 1) + (3 - 1) + (4 - 1) = 9.
| 0
|
[
{
"input": "2\n4 7",
"output": "3"
},
{
"input": "3\n4 3 1",
"output": "9"
},
{
"input": "20\n8 11 13 19 21 34 36 44 57 58 61 63 76 78 79 81 85 86 90 95",
"output": "83396599"
},
{
"input": "20\n1 8 9 12 15 17 18 24 30 33 36 41 53 54 59 62 64 66 72 73",
"output": "68059140"
},
{
"input": "20\n2 6 8 9 20 23 27 36 43 49 63 65 70 71 85 87 89 91 94 97",
"output": "92743989"
},
{
"input": "1\n78091781",
"output": "0"
},
{
"input": "2\n1000000000 1",
"output": "999999999"
},
{
"input": "3\n999999998 999999999 999999992",
"output": "21"
},
{
"input": "3\n465343471 465343474 465343473",
"output": "9"
},
{
"input": "10\n10 3 6 2 1 9 8 4 5 7",
"output": "7181"
},
{
"input": "10\n756734546 756734524 756734550 756734529 756734553 756734538 756734541 756734536 756734579 756734537",
"output": "36489"
},
{
"input": "10\n877105545 939360757 849826701 845946140 803128820 926787996 967305000 904694971 921301848 971203310",
"output": "861364152"
},
{
"input": "5\n4 7 13 17 18",
"output": "270"
},
{
"input": "5\n20 17 13 7 2",
"output": "330"
},
{
"input": "5\n3 17 2 5 4",
"output": "237"
},
{
"input": "5\n999999980 999999985 999999986 999999990 999999992",
"output": "210"
},
{
"input": "5\n1000000000 999999988 999999982 999999981 999999980",
"output": "342"
},
{
"input": "5\n999999984 999999997 999999994 999999991 999999982",
"output": "285"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "5\n9 10 7 4 5",
"output": "114"
}
] | 1,497,518,928
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 31
| 0
|
n = int(input())
l = sorted(list(map(int,input().split())))
l = l[::-1]
MOD = 10**9+7
power = []
two = 1
for i in range(n+3):
power.append(two)
two *= 2
two%=MOD
ans = 0
for i in range(n):
ans = (ans + (l[i] * power[n-i-1])) % MOD
ans = (ans - (l[i] * power[i])) % MOD
print(ans)
print(ans)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Leha decided to move to a quiet town Vičkopolis, because he was tired by living in Bankopolis. Upon arrival he immediately began to expand his network of hacked computers. During the week Leha managed to get access to *n* computers throughout the town. Incidentally all the computers, which were hacked by Leha, lie on the same straight line, due to the reason that there is the only one straight street in Vičkopolis.
Let's denote the coordinate system on this street. Besides let's number all the hacked computers with integers from 1 to *n*. So the *i*-th hacked computer is located at the point *x**i*. Moreover the coordinates of all computers are distinct.
Leha is determined to have a little rest after a hard week. Therefore he is going to invite his friend Noora to a restaurant. However the girl agrees to go on a date with the only one condition: Leha have to solve a simple task.
Leha should calculate a sum of *F*(*a*) for all *a*, where *a* is a non-empty subset of the set, that consists of all hacked computers. Formally, let's denote *A* the set of all integers from 1 to *n*. Noora asks the hacker to find value of the expression . Here *F*(*a*) is calculated as the maximum among the distances between all pairs of computers from the set *a*. Formally, . Since the required sum can be quite large Noora asks to find it modulo 109<=+<=7.
Though, Leha is too tired. Consequently he is not able to solve this task. Help the hacker to attend a date.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=3·105) denoting the number of hacked computers.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109) denoting the coordinates of hacked computers. It is guaranteed that all *x**i* are distinct.
Output Specification:
Print a single integer — the required sum modulo 109<=+<=7.
Demo Input:
['2\n4 7\n', '3\n4 3 1\n']
Demo Output:
['3\n', '9\n']
Note:
There are three non-empty subsets in the first sample test:<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/02b2d12556dad85f1c6c6912786eb87d4be2ea17.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/22f6a537962c86b3e28ddb8aaca28a7cdd219a8c.png" style="max-width: 100.0%;max-height: 100.0%;"/> and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7d0f73b3e94e13cb797f39e93d9da74835c5a02d.png" style="max-width: 100.0%;max-height: 100.0%;"/>. The first and the second subset increase the sum by 0 and the third subset increases the sum by 7 - 4 = 3. In total the answer is 0 + 0 + 3 = 3.
There are seven non-empty subsets in the second sample test. Among them only the following subsets increase the answer: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f368c407c8e85e2b5fedfffaff39d471d765f026.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bb8f2118a3ac352db393b1f067b28e398ce7f816.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/049032074c04b16bc0cc153f95471c40b222072b.png" style="max-width: 100.0%;max-height: 100.0%;"/>, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc93c7f5b3d122314c9c5a707fae556a8f72a574.png" style="max-width: 100.0%;max-height: 100.0%;"/>. In total the sum is (4 - 3) + (4 - 1) + (3 - 1) + (4 - 1) = 9.
|
```python
n = int(input())
l = sorted(list(map(int,input().split())))
l = l[::-1]
MOD = 10**9+7
power = []
two = 1
for i in range(n+3):
power.append(two)
two *= 2
two%=MOD
ans = 0
for i in range(n):
ans = (ans + (l[i] * power[n-i-1])) % MOD
ans = (ans - (l[i] * power[i])) % MOD
print(ans)
print(ans)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Andryusha is an orderly boy and likes to keep things in their place.
Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe.
Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time?
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs.
The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*.
It is guaranteed that Andryusha took exactly two socks of each pair.
|
Print single integer — the maximum number of socks that were on the table at the same time.
|
[
"1\n1 1\n",
"3\n2 1 1 3 2 3\n"
] |
[
"1\n",
"2\n"
] |
In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time.
In the second example Andryusha behaved as follows:
- Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
| 0
|
[
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n2 1 1 3 2 3",
"output": "2"
},
{
"input": "5\n5 1 3 2 4 3 1 2 4 5",
"output": "5"
},
{
"input": "10\n4 2 6 3 4 8 7 1 1 5 2 10 6 8 3 5 10 9 9 7",
"output": "6"
},
{
"input": "50\n30 47 31 38 37 50 36 43 9 23 2 2 15 31 14 49 9 16 6 44 27 14 5 6 3 47 25 26 1 35 3 15 24 19 8 46 49 41 4 26 40 28 42 11 34 35 46 18 7 28 18 40 19 42 4 41 38 48 50 12 29 39 33 17 25 22 22 21 36 45 27 30 20 7 13 29 39 44 21 8 37 45 34 1 20 10 11 17 33 12 43 13 10 16 48 24 32 5 23 32",
"output": "25"
},
{
"input": "50\n1 1 2 2 3 3 4 4 5 5 6 6 7 7 8 8 9 9 10 10 11 11 12 12 13 13 14 14 15 15 16 16 17 17 18 18 19 19 20 20 21 21 22 22 23 23 24 24 25 25 26 26 27 27 28 28 29 29 30 30 31 31 32 32 33 33 34 34 35 35 36 36 37 37 38 38 39 39 40 40 41 41 42 42 43 43 44 44 45 45 46 46 47 47 48 48 49 49 50 50",
"output": "1"
},
{
"input": "50\n50 50 49 49 48 48 47 47 46 46 45 45 44 44 43 43 42 42 41 41 40 40 39 39 38 38 37 37 36 36 35 35 34 34 33 33 32 32 31 31 30 30 29 29 28 28 27 27 26 26 25 25 24 24 23 23 22 22 21 21 20 20 19 19 18 18 17 17 16 16 15 15 14 14 13 13 12 12 11 11 10 10 9 9 8 8 7 7 6 6 5 5 4 4 3 3 2 2 1 1",
"output": "1"
},
{
"input": "50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "50"
},
{
"input": "50\n50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "50"
},
{
"input": "10\n2 9 4 1 6 7 10 3 1 5 8 6 2 3 10 7 4 8 5 9",
"output": "9"
}
] | 1,683,230,598
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 3
| 1,372
| 19,763,200
|
n=int(input());lst = list(map(int,input().split()))
freq=[];mx=0;flag=True
for i in range(n):
if lst[i] in freq:
freq.remove(lst[i])
else:
freq.append(lst[i])
socks = len(freq)
if flag:
mx = socks
flag = False
elif mx<socks:
mx = socks
print(mx)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andryusha is an orderly boy and likes to keep things in their place.
Today he faced a problem to put his socks in the wardrobe. He has *n* distinct pairs of socks which are initially in a bag. The pairs are numbered from 1 to *n*. Andryusha wants to put paired socks together and put them in the wardrobe. He takes the socks one by one from the bag, and for each sock he looks whether the pair of this sock has been already took out of the bag, or not. If not (that means the pair of this sock is still in the bag), he puts the current socks on the table in front of him. Otherwise, he puts both socks from the pair to the wardrobe.
Andryusha remembers the order in which he took the socks from the bag. Can you tell him what is the maximum number of socks that were on the table at the same time?
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=105) — the number of sock pairs.
The second line contains 2*n* integers *x*1,<=*x*2,<=...,<=*x*2*n* (1<=≤<=*x**i*<=≤<=*n*), which describe the order in which Andryusha took the socks from the bag. More precisely, *x**i* means that the *i*-th sock Andryusha took out was from pair *x**i*.
It is guaranteed that Andryusha took exactly two socks of each pair.
Output Specification:
Print single integer — the maximum number of socks that were on the table at the same time.
Demo Input:
['1\n1 1\n', '3\n2 1 1 3 2 3\n']
Demo Output:
['1\n', '2\n']
Note:
In the first example Andryusha took a sock from the first pair and put it on the table. Then he took the next sock which is from the first pair as well, so he immediately puts both socks to the wardrobe. Thus, at most one sock was on the table at the same time.
In the second example Andryusha behaved as follows:
- Initially the table was empty, he took out a sock from pair 2 and put it on the table. - Sock (2) was on the table. Andryusha took out a sock from pair 1 and put it on the table. - Socks (1, 2) were on the table. Andryusha took out a sock from pair 1, and put this pair into the wardrobe. - Sock (2) was on the table. Andryusha took out a sock from pair 3 and put it on the table. - Socks (2, 3) were on the table. Andryusha took out a sock from pair 2, and put this pair into the wardrobe. - Sock (3) was on the table. Andryusha took out a sock from pair 3 and put this pair into the wardrobe.
|
```python
n=int(input());lst = list(map(int,input().split()))
freq=[];mx=0;flag=True
for i in range(n):
if lst[i] in freq:
freq.remove(lst[i])
else:
freq.append(lst[i])
socks = len(freq)
if flag:
mx = socks
flag = False
elif mx<socks:
mx = socks
print(mx)
```
| 0
|
|
353
|
A
|
Domino
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even.
To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
|
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
|
[
"2\n4 2\n6 4\n",
"1\n2 3\n",
"3\n1 4\n2 3\n4 4\n"
] |
[
"0\n",
"-1\n",
"1\n"
] |
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything.
In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd.
In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
| 500
|
[
{
"input": "2\n4 2\n6 4",
"output": "0"
},
{
"input": "1\n2 3",
"output": "-1"
},
{
"input": "3\n1 4\n2 3\n4 4",
"output": "1"
},
{
"input": "5\n5 4\n5 4\n1 5\n5 5\n3 3",
"output": "1"
},
{
"input": "20\n1 3\n5 2\n5 2\n2 6\n2 4\n1 1\n1 3\n1 4\n2 6\n4 2\n5 6\n2 2\n6 2\n4 3\n2 1\n6 2\n6 5\n4 5\n2 4\n1 4",
"output": "-1"
},
{
"input": "100\n2 3\n2 4\n3 3\n1 4\n5 2\n5 4\n6 6\n3 4\n1 1\n4 2\n5 1\n5 5\n5 3\n3 6\n4 1\n1 6\n1 1\n3 2\n4 5\n6 1\n6 4\n1 1\n3 4\n3 3\n2 2\n1 1\n4 4\n6 4\n3 2\n5 2\n6 4\n3 2\n3 5\n4 4\n1 4\n5 2\n3 4\n1 4\n2 2\n5 6\n3 5\n6 1\n5 5\n1 6\n6 3\n1 4\n1 5\n5 5\n4 1\n3 2\n4 1\n5 5\n5 5\n1 5\n1 2\n6 4\n1 3\n3 6\n4 3\n3 5\n6 4\n2 6\n5 5\n1 4\n2 2\n2 3\n5 1\n2 5\n1 2\n2 6\n5 5\n4 6\n1 4\n3 6\n2 3\n6 1\n6 5\n3 2\n6 4\n4 5\n4 5\n2 6\n1 3\n6 2\n1 2\n2 3\n4 3\n5 4\n3 4\n1 6\n6 6\n2 4\n4 1\n3 1\n2 6\n5 4\n1 2\n6 5\n3 6\n2 4",
"output": "-1"
},
{
"input": "1\n2 4",
"output": "0"
},
{
"input": "1\n1 1",
"output": "-1"
},
{
"input": "1\n1 2",
"output": "-1"
},
{
"input": "2\n1 1\n3 3",
"output": "0"
},
{
"input": "2\n1 1\n2 2",
"output": "-1"
},
{
"input": "2\n1 1\n1 2",
"output": "-1"
},
{
"input": "5\n1 2\n6 6\n1 1\n3 3\n6 1",
"output": "1"
},
{
"input": "5\n5 4\n2 6\n6 2\n1 4\n6 2",
"output": "0"
},
{
"input": "10\n4 1\n3 2\n1 2\n2 6\n3 5\n2 1\n5 2\n4 6\n5 6\n3 1",
"output": "0"
},
{
"input": "10\n6 1\n4 4\n2 6\n6 5\n3 6\n6 3\n2 4\n5 1\n1 6\n1 5",
"output": "-1"
},
{
"input": "15\n1 2\n5 1\n6 4\n5 1\n1 6\n2 6\n3 1\n6 4\n3 1\n2 1\n6 4\n3 5\n6 2\n1 6\n1 1",
"output": "1"
},
{
"input": "15\n3 3\n2 1\n5 4\n3 3\n5 3\n5 4\n2 5\n1 3\n3 2\n3 3\n3 5\n2 5\n4 1\n2 3\n5 4",
"output": "-1"
},
{
"input": "20\n1 5\n6 4\n4 3\n6 2\n1 1\n1 5\n6 3\n2 3\n3 6\n3 6\n3 6\n2 5\n4 3\n4 6\n5 5\n4 6\n3 4\n4 2\n3 3\n5 2",
"output": "0"
},
{
"input": "20\n2 1\n6 5\n3 1\n2 5\n3 5\n4 1\n1 1\n5 4\n5 1\n2 4\n1 5\n3 2\n1 2\n3 5\n5 2\n1 2\n1 3\n4 2\n2 3\n4 5",
"output": "-1"
},
{
"input": "25\n4 1\n6 3\n1 3\n2 3\n2 4\n6 6\n4 2\n4 2\n1 5\n5 4\n1 2\n2 5\n3 6\n4 1\n3 4\n2 6\n6 1\n5 6\n6 6\n4 2\n1 5\n3 3\n3 3\n6 5\n1 4",
"output": "-1"
},
{
"input": "25\n5 5\n4 3\n2 5\n4 3\n4 6\n4 2\n5 6\n2 1\n5 4\n6 6\n1 3\n1 4\n2 3\n5 6\n5 4\n5 6\n5 4\n6 3\n3 5\n1 3\n2 5\n2 2\n4 4\n2 1\n4 4",
"output": "-1"
},
{
"input": "30\n3 5\n2 5\n1 6\n1 6\n2 4\n5 5\n5 4\n5 6\n5 4\n2 1\n2 4\n1 6\n3 5\n1 1\n3 6\n5 5\n1 6\n3 4\n1 4\n4 6\n2 1\n3 3\n1 3\n4 5\n1 4\n1 6\n2 1\n4 6\n3 5\n5 6",
"output": "1"
},
{
"input": "30\n2 3\n3 1\n6 6\n1 3\n5 5\n3 6\n4 5\n2 1\n1 3\n2 3\n4 4\n2 4\n6 4\n2 4\n5 4\n2 1\n2 5\n2 5\n4 2\n1 4\n2 6\n3 2\n3 2\n6 6\n4 2\n3 4\n6 3\n6 6\n6 6\n5 5",
"output": "1"
},
{
"input": "35\n6 1\n4 3\n1 2\n4 3\n6 4\n4 6\n3 1\n5 5\n3 4\n5 4\n4 6\n1 6\n2 4\n6 6\n5 4\n5 2\n1 3\n1 4\n3 5\n1 4\n2 3\n4 5\n4 3\n6 1\n5 3\n3 2\n5 6\n3 5\n6 5\n4 1\n1 3\n5 5\n4 6\n6 1\n1 3",
"output": "1"
},
{
"input": "35\n4 3\n5 6\n4 5\n2 5\n6 6\n4 1\n2 2\n4 2\n3 4\n4 1\n6 6\n6 3\n1 5\n1 5\n5 6\n4 2\n4 6\n5 5\n2 2\n5 2\n1 2\n4 6\n6 6\n6 5\n2 1\n3 5\n2 5\n3 1\n5 3\n6 4\n4 6\n5 6\n5 1\n3 4\n3 5",
"output": "1"
},
{
"input": "40\n5 6\n1 1\n3 3\n2 6\n6 6\n5 4\n6 4\n3 5\n1 3\n4 4\n4 4\n2 5\n1 3\n3 6\n5 2\n4 3\n4 4\n5 6\n2 3\n1 1\n3 1\n1 1\n1 5\n4 3\n5 5\n3 4\n6 6\n5 6\n2 2\n6 6\n2 1\n2 4\n5 2\n2 2\n1 1\n1 4\n4 2\n3 5\n5 5\n4 5",
"output": "-1"
},
{
"input": "40\n3 2\n5 3\n4 6\n3 5\n6 1\n5 2\n1 2\n6 2\n5 3\n3 2\n4 4\n3 3\n5 2\n4 5\n1 4\n5 1\n3 3\n1 3\n1 3\n2 1\n3 6\n4 2\n4 6\n6 2\n2 5\n2 2\n2 5\n3 3\n5 3\n2 1\n3 2\n2 3\n6 3\n6 3\n3 4\n3 2\n4 3\n5 4\n2 4\n4 6",
"output": "-1"
},
{
"input": "45\n2 4\n3 4\n6 1\n5 5\n1 1\n3 5\n4 3\n5 2\n3 6\n6 1\n4 4\n6 1\n2 1\n6 1\n3 6\n3 3\n6 1\n1 2\n1 5\n6 5\n1 3\n5 6\n6 1\n4 5\n3 6\n2 2\n1 2\n4 5\n5 6\n1 5\n6 2\n2 4\n3 3\n3 1\n6 5\n6 5\n2 1\n5 2\n2 1\n3 3\n2 2\n1 4\n2 2\n3 3\n2 1",
"output": "-1"
},
{
"input": "45\n6 6\n1 6\n1 2\n3 5\n4 4\n2 1\n5 3\n2 1\n5 2\n5 3\n1 4\n5 2\n4 2\n3 6\n5 2\n1 5\n4 4\n5 5\n6 5\n2 1\n2 6\n5 5\n2 1\n6 1\n1 6\n6 5\n2 4\n4 3\n2 6\n2 4\n6 5\n6 4\n6 3\n6 6\n2 1\n6 4\n5 6\n5 4\n1 5\n5 1\n3 3\n5 6\n2 5\n4 5\n3 6",
"output": "-1"
},
{
"input": "50\n4 4\n5 1\n6 4\n6 2\n6 2\n1 4\n5 5\n4 2\n5 5\n5 4\n1 3\n3 5\n6 1\n6 1\n1 4\n4 3\n5 1\n3 6\n2 2\n6 2\n4 4\n2 3\n4 2\n6 5\n5 6\n2 2\n2 4\n3 5\n1 5\n3 2\n3 4\n5 6\n4 6\n1 6\n4 5\n2 6\n2 2\n3 5\n6 4\n5 1\n4 3\n3 4\n3 5\n3 3\n2 3\n3 2\n2 2\n1 4\n3 1\n4 4",
"output": "1"
},
{
"input": "50\n1 2\n1 4\n1 1\n4 5\n4 4\n3 2\n4 5\n3 5\n1 1\n3 4\n3 2\n2 4\n2 6\n2 6\n3 2\n4 6\n1 6\n3 1\n1 6\n2 1\n4 1\n1 6\n4 3\n6 6\n5 2\n6 4\n2 1\n4 3\n6 4\n5 1\n5 5\n3 1\n1 1\n5 5\n2 2\n2 3\n2 3\n3 5\n5 5\n1 6\n1 5\n3 6\n3 6\n1 1\n3 3\n2 6\n5 5\n1 3\n6 3\n6 6",
"output": "-1"
},
{
"input": "55\n3 2\n5 6\n5 1\n3 5\n5 5\n1 5\n5 4\n6 3\n5 6\n4 2\n3 1\n1 2\n5 5\n1 1\n5 2\n6 3\n5 4\n3 6\n4 6\n2 6\n6 4\n1 4\n1 6\n4 1\n2 5\n4 3\n2 1\n2 1\n6 2\n3 1\n2 5\n4 4\n6 3\n2 2\n3 5\n5 1\n3 6\n5 4\n4 6\n6 5\n5 6\n2 2\n3 2\n5 2\n6 5\n2 2\n5 3\n3 1\n4 5\n6 4\n2 4\n1 2\n5 6\n2 6\n5 2",
"output": "0"
},
{
"input": "55\n4 6\n3 3\n6 5\n5 3\n5 6\n2 3\n2 2\n3 4\n3 1\n5 4\n5 4\n2 4\n3 4\n4 5\n1 5\n6 3\n1 1\n5 1\n3 4\n1 5\n3 1\n2 5\n3 3\n4 3\n3 3\n3 1\n6 6\n3 3\n3 3\n5 6\n5 3\n3 5\n1 4\n5 5\n1 3\n1 4\n3 5\n3 6\n2 4\n2 4\n5 1\n6 4\n5 1\n5 5\n1 1\n3 2\n4 3\n5 4\n5 1\n2 4\n4 3\n6 1\n3 4\n1 5\n6 3",
"output": "-1"
},
{
"input": "60\n2 6\n1 4\n3 2\n1 2\n3 2\n2 4\n6 4\n4 6\n1 3\n3 1\n6 5\n2 4\n5 4\n4 2\n1 6\n3 4\n4 5\n5 2\n1 5\n5 4\n3 4\n3 4\n4 4\n4 1\n6 6\n3 6\n2 4\n2 1\n4 4\n6 5\n3 1\n4 3\n1 3\n6 3\n5 5\n1 4\n3 1\n3 6\n1 5\n3 1\n1 5\n4 4\n1 3\n2 4\n6 2\n4 1\n5 3\n3 4\n5 6\n1 2\n1 6\n6 3\n1 6\n3 6\n3 4\n6 2\n4 6\n2 3\n3 3\n3 3",
"output": "-1"
},
{
"input": "60\n2 3\n4 6\n2 4\n1 3\n5 6\n1 5\n1 2\n1 3\n5 6\n4 3\n4 2\n3 1\n1 3\n3 5\n1 5\n3 4\n2 4\n3 5\n4 5\n1 2\n3 1\n1 5\n2 5\n6 2\n1 6\n3 3\n6 2\n5 3\n1 3\n1 4\n6 4\n6 3\n4 2\n4 2\n1 4\n1 3\n3 2\n3 1\n2 1\n1 2\n3 1\n2 6\n1 4\n3 6\n3 3\n1 5\n2 4\n5 5\n6 2\n5 2\n3 3\n5 3\n3 4\n4 5\n5 6\n2 4\n5 3\n3 1\n2 4\n5 4",
"output": "-1"
},
{
"input": "65\n5 4\n3 3\n1 2\n4 3\n3 5\n1 5\n4 5\n2 6\n1 2\n1 5\n6 3\n2 6\n4 3\n3 6\n1 5\n3 5\n4 6\n2 5\n6 5\n1 4\n3 4\n4 3\n1 4\n2 5\n6 5\n3 1\n4 3\n1 2\n1 1\n6 1\n5 2\n3 2\n1 6\n2 6\n3 3\n6 6\n4 6\n1 5\n5 1\n4 5\n1 4\n3 2\n5 4\n4 2\n6 2\n1 3\n4 2\n5 3\n6 4\n3 6\n1 2\n6 1\n6 6\n3 3\n4 2\n3 5\n4 6\n4 1\n5 4\n6 1\n5 1\n5 6\n6 1\n4 6\n5 5",
"output": "1"
},
{
"input": "65\n5 4\n6 3\n5 4\n4 5\n5 3\n3 6\n1 3\n3 1\n1 3\n6 1\n6 4\n1 3\n2 2\n4 6\n4 1\n5 6\n6 5\n1 1\n1 3\n6 6\n4 1\n2 4\n5 4\n4 1\n5 5\n5 3\n6 2\n2 6\n4 2\n2 2\n6 2\n3 3\n4 5\n4 3\n3 1\n1 4\n4 5\n3 2\n5 5\n4 6\n5 1\n3 4\n5 4\n5 2\n1 6\n4 2\n3 4\n3 4\n1 3\n1 2\n3 3\n3 6\n6 4\n4 6\n6 2\n6 5\n3 2\n2 1\n6 4\n2 1\n1 5\n5 2\n6 5\n3 6\n5 1",
"output": "1"
},
{
"input": "70\n4 1\n2 6\n1 1\n5 6\n5 1\n2 3\n3 5\n1 1\n1 1\n4 6\n4 3\n1 5\n2 2\n2 3\n3 1\n6 4\n3 1\n4 2\n5 4\n1 3\n3 5\n5 2\n5 6\n4 4\n4 5\n2 2\n4 5\n3 2\n3 5\n2 5\n2 6\n5 5\n2 6\n5 1\n1 1\n2 5\n3 1\n1 2\n6 4\n6 5\n5 5\n5 1\n1 5\n2 2\n6 3\n4 3\n6 2\n5 5\n1 1\n6 2\n6 6\n3 4\n2 2\n3 5\n1 5\n2 5\n4 5\n2 4\n6 3\n5 1\n2 6\n4 2\n1 4\n1 6\n6 2\n5 2\n5 6\n2 5\n5 6\n5 5",
"output": "-1"
},
{
"input": "70\n4 3\n6 4\n5 5\n3 1\n1 2\n2 5\n4 6\n4 2\n3 2\n4 2\n1 5\n2 2\n4 3\n1 2\n6 1\n6 6\n1 6\n5 1\n2 2\n6 3\n4 2\n4 3\n1 2\n6 6\n3 3\n6 5\n6 2\n3 6\n6 6\n4 6\n5 2\n5 4\n3 3\n1 6\n5 6\n2 3\n4 6\n1 1\n1 2\n6 6\n1 1\n3 4\n1 6\n2 6\n3 4\n6 3\n5 3\n1 2\n2 3\n4 6\n2 1\n6 4\n4 6\n4 6\n4 2\n5 5\n3 5\n3 2\n4 3\n3 6\n1 4\n3 6\n1 4\n1 6\n1 5\n5 6\n4 4\n3 3\n3 5\n2 2",
"output": "0"
},
{
"input": "75\n1 3\n4 5\n4 1\n6 5\n2 1\n1 4\n5 4\n1 5\n5 3\n1 2\n4 1\n1 1\n5 1\n5 3\n1 5\n4 2\n2 2\n6 3\n1 2\n4 3\n2 5\n5 3\n5 5\n4 1\n4 6\n2 5\n6 1\n2 4\n6 4\n5 2\n6 2\n2 4\n1 3\n5 4\n6 5\n5 4\n6 4\n1 5\n4 6\n1 5\n1 1\n4 4\n3 5\n6 3\n6 5\n1 5\n2 1\n1 5\n6 6\n2 2\n2 2\n4 4\n6 6\n5 4\n4 5\n3 2\n2 4\n1 1\n4 3\n3 2\n5 4\n1 6\n1 2\n2 2\n3 5\n2 6\n1 1\n2 2\n2 3\n6 2\n3 6\n4 4\n5 1\n4 1\n4 1",
"output": "0"
},
{
"input": "75\n1 1\n2 1\n5 5\n6 5\n6 3\n1 6\n6 1\n4 4\n2 1\n6 2\n3 1\n6 4\n1 6\n2 2\n4 3\n4 2\n1 2\n6 2\n4 2\n5 1\n1 2\n3 2\n6 6\n6 3\n2 4\n4 1\n4 1\n2 4\n5 5\n2 3\n5 5\n4 5\n3 1\n1 5\n4 3\n2 3\n3 5\n4 6\n5 6\n1 6\n2 3\n2 2\n1 2\n5 6\n1 4\n1 5\n1 3\n6 2\n1 2\n4 2\n2 1\n1 3\n6 4\n4 1\n5 2\n6 2\n3 5\n2 3\n4 2\n5 1\n5 6\n3 2\n2 1\n6 6\n2 1\n6 2\n1 1\n3 2\n1 2\n3 5\n4 6\n1 3\n3 4\n5 5\n6 2",
"output": "1"
},
{
"input": "80\n3 1\n6 3\n2 2\n2 2\n6 3\n6 1\n6 5\n1 4\n3 6\n6 5\n1 3\n2 4\n1 4\n3 1\n5 3\n5 3\n1 4\n2 5\n4 3\n4 4\n4 5\n6 1\n3 1\n2 6\n4 2\n3 1\n6 5\n2 6\n2 2\n5 1\n1 3\n5 1\n2 1\n4 3\n6 3\n3 5\n4 3\n5 6\n3 3\n4 1\n5 1\n6 5\n5 1\n2 5\n6 1\n3 2\n4 3\n3 3\n5 6\n1 6\n5 2\n1 5\n5 6\n6 4\n2 2\n4 2\n4 6\n4 2\n4 4\n6 5\n5 2\n6 2\n4 6\n6 4\n4 3\n5 1\n4 1\n3 5\n3 2\n3 2\n5 3\n5 4\n3 4\n1 3\n1 2\n6 6\n6 3\n6 1\n5 6\n3 2",
"output": "0"
},
{
"input": "80\n4 5\n3 3\n3 6\n4 5\n3 4\n6 5\n1 5\n2 5\n5 6\n5 1\n5 1\n1 2\n5 5\n5 1\n2 3\n1 1\n4 5\n4 1\n1 1\n5 5\n5 6\n5 2\n5 4\n4 2\n6 2\n5 3\n3 2\n4 2\n1 3\n1 6\n2 1\n6 6\n4 5\n6 4\n2 2\n1 6\n6 2\n4 3\n2 3\n4 6\n4 6\n6 2\n3 4\n4 3\n5 5\n1 6\n3 2\n4 6\n2 3\n1 6\n5 4\n4 2\n5 4\n1 1\n4 3\n5 1\n3 6\n6 2\n3 1\n4 1\n5 3\n2 2\n3 4\n3 6\n3 5\n5 5\n5 1\n3 5\n2 6\n6 3\n6 5\n3 3\n5 6\n1 2\n3 1\n6 3\n3 4\n6 6\n6 6\n1 2",
"output": "-1"
},
{
"input": "85\n6 3\n4 1\n1 2\n3 5\n6 4\n6 2\n2 6\n1 2\n1 5\n6 2\n1 4\n6 6\n2 4\n4 6\n4 5\n1 6\n3 1\n2 5\n5 1\n5 2\n3 5\n1 1\n4 1\n2 3\n1 1\n3 3\n6 4\n1 4\n1 1\n3 6\n1 5\n1 6\n2 5\n2 2\n5 1\n6 6\n1 3\n1 5\n5 6\n4 5\n4 3\n5 5\n1 3\n6 3\n4 6\n2 4\n5 6\n6 2\n4 5\n1 4\n1 4\n6 5\n1 6\n6 1\n1 6\n5 5\n2 1\n5 2\n2 3\n1 6\n1 6\n1 6\n5 6\n2 4\n6 5\n6 5\n4 2\n5 4\n3 4\n4 3\n6 6\n3 3\n3 2\n3 6\n2 5\n2 1\n2 5\n3 4\n1 2\n5 4\n6 2\n5 1\n1 4\n3 4\n4 5",
"output": "0"
},
{
"input": "85\n3 1\n3 2\n6 3\n1 3\n2 1\n3 6\n1 4\n2 5\n6 5\n1 6\n1 5\n1 1\n4 3\n3 5\n4 6\n3 2\n6 6\n4 4\n4 1\n5 5\n4 2\n6 2\n2 2\n4 5\n6 1\n3 4\n4 5\n3 5\n4 2\n3 5\n4 4\n3 1\n4 4\n6 4\n1 4\n5 5\n1 5\n2 2\n6 5\n5 6\n6 5\n3 2\n3 2\n6 1\n6 5\n2 1\n4 6\n2 1\n3 1\n5 6\n1 3\n5 4\n1 4\n1 4\n5 3\n2 3\n1 3\n2 2\n5 3\n2 3\n2 3\n1 3\n3 6\n4 4\n6 6\n6 2\n5 1\n5 5\n5 5\n1 2\n1 4\n2 4\n3 6\n4 6\n6 3\n6 4\n5 5\n3 2\n5 4\n5 4\n4 5\n6 4\n2 1\n5 2\n5 1",
"output": "-1"
},
{
"input": "90\n5 2\n5 5\n5 1\n4 6\n4 3\n5 3\n5 6\n5 1\n3 4\n1 3\n4 2\n1 6\n6 4\n1 2\n6 1\n4 1\n6 2\n6 5\n6 2\n5 4\n3 6\n1 1\n5 5\n2 2\n1 6\n3 5\n6 5\n1 6\n1 5\n2 3\n2 6\n2 3\n3 3\n1 3\n5 1\n2 5\n3 6\n1 2\n4 4\n1 6\n2 3\n1 5\n2 5\n1 3\n2 2\n4 6\n3 6\n6 3\n1 2\n4 3\n4 5\n4 6\n3 2\n6 5\n6 2\n2 5\n2 4\n1 3\n1 6\n4 3\n1 3\n6 4\n4 6\n4 1\n1 1\n4 1\n4 4\n6 2\n6 5\n1 1\n2 2\n3 1\n1 4\n6 2\n5 2\n1 4\n1 3\n6 5\n3 2\n6 4\n3 4\n2 6\n2 2\n6 3\n4 6\n1 2\n4 2\n3 4\n2 3\n1 5",
"output": "-1"
},
{
"input": "90\n1 4\n3 5\n4 2\n2 5\n4 3\n2 6\n2 6\n3 2\n4 4\n6 1\n4 3\n2 3\n5 3\n6 6\n2 2\n6 3\n4 1\n4 4\n5 6\n6 4\n4 2\n5 6\n4 6\n4 4\n6 4\n4 1\n5 3\n3 2\n4 4\n5 2\n5 4\n6 4\n1 2\n3 3\n3 4\n6 4\n1 6\n4 2\n3 2\n1 1\n2 2\n5 1\n6 6\n4 1\n5 2\n3 6\n2 1\n2 2\n4 6\n6 5\n4 4\n5 5\n5 6\n1 6\n1 4\n5 6\n3 6\n6 3\n5 6\n6 5\n5 1\n6 1\n6 6\n6 3\n1 5\n4 5\n3 1\n6 6\n3 4\n6 2\n1 4\n2 2\n3 2\n5 6\n2 4\n1 4\n6 3\n4 6\n1 4\n5 2\n1 2\n6 5\n1 5\n1 4\n4 2\n2 5\n3 2\n5 1\n5 4\n5 3",
"output": "-1"
},
{
"input": "95\n4 3\n3 2\n5 5\n5 3\n1 6\n4 4\n5 5\n6 5\n3 5\n1 5\n4 2\n5 1\n1 2\n2 3\n6 4\n2 3\n6 3\n6 5\n5 6\n1 4\n2 6\n2 6\n2 5\n2 1\n3 1\n3 5\n2 2\n6 1\n2 4\n4 6\n6 6\n6 4\n3 2\n5 1\n4 3\n6 5\n2 3\n4 1\n2 5\n6 5\n6 5\n6 5\n5 1\n5 4\n4 6\n3 2\n2 5\n2 6\n4 6\n6 3\n6 4\n5 6\n4 6\n2 4\n3 4\n1 4\n2 4\n2 3\n5 6\n6 4\n3 1\n5 1\n3 6\n3 5\n2 6\n6 3\n4 3\n3 1\n6 1\n2 2\n6 3\n2 2\n2 2\n6 4\n6 1\n2 1\n5 6\n5 4\n5 2\n3 4\n3 6\n2 1\n1 6\n5 5\n2 6\n2 3\n3 6\n1 3\n1 5\n5 1\n1 2\n2 2\n5 3\n6 4\n4 5",
"output": "0"
},
{
"input": "95\n4 5\n5 6\n3 2\n5 1\n4 3\n4 1\n6 1\n5 2\n2 4\n5 3\n2 3\n6 4\n4 1\n1 6\n2 6\n2 3\n4 6\n2 4\n3 4\n4 2\n5 5\n1 1\n1 5\n4 3\n4 5\n6 2\n6 1\n6 3\n5 5\n4 1\n5 1\n2 3\n5 1\n3 6\n6 6\n4 5\n4 4\n4 3\n1 6\n6 6\n4 6\n6 4\n1 2\n6 2\n4 6\n6 6\n5 5\n6 1\n5 2\n4 5\n6 6\n6 5\n4 4\n1 5\n4 6\n4 1\n3 6\n5 1\n3 1\n4 6\n4 5\n1 3\n5 4\n4 5\n2 2\n6 1\n5 2\n6 5\n2 2\n1 1\n6 3\n6 1\n2 6\n3 3\n2 1\n4 6\n2 4\n5 5\n5 2\n3 2\n1 2\n6 6\n6 2\n5 1\n2 6\n5 2\n2 2\n5 5\n3 5\n3 3\n2 6\n5 3\n4 3\n1 6\n5 4",
"output": "-1"
},
{
"input": "100\n1 1\n3 5\n2 1\n1 2\n3 4\n5 6\n5 6\n6 1\n5 5\n2 4\n5 5\n5 6\n6 2\n6 6\n2 6\n1 4\n2 2\n3 2\n1 3\n5 5\n6 3\n5 6\n1 1\n1 2\n1 2\n2 1\n2 3\n1 6\n4 3\n1 1\n2 5\n2 4\n4 4\n1 5\n3 3\n6 1\n3 5\n1 1\n3 6\n3 1\n4 2\n4 3\n3 6\n6 6\n1 6\n6 2\n2 5\n5 4\n6 3\n1 4\n2 6\n6 2\n3 4\n6 1\n6 5\n4 6\n6 5\n4 4\n3 1\n6 3\n5 1\n2 4\n5 1\n1 2\n2 4\n2 1\n6 6\n5 3\n4 6\n6 3\n5 5\n3 3\n1 1\n6 5\n4 3\n2 6\n1 5\n3 5\n2 4\n4 5\n1 6\n2 3\n6 3\n5 5\n2 6\n2 6\n3 4\n3 2\n6 1\n3 4\n6 4\n3 3\n2 3\n5 1\n3 1\n6 2\n2 3\n6 4\n1 4\n1 2",
"output": "-1"
},
{
"input": "100\n1 1\n5 5\n1 2\n5 3\n5 5\n2 2\n1 5\n3 4\n3 2\n1 3\n5 6\n4 5\n2 1\n5 5\n2 2\n1 6\n6 1\n5 1\n4 1\n4 6\n3 5\n6 1\n2 3\n5 6\n3 6\n2 3\n5 6\n1 6\n3 2\n2 2\n3 3\n6 5\n5 5\n1 4\n5 6\n6 4\n1 4\n1 2\n2 6\n3 2\n6 4\n5 3\n3 3\n6 4\n4 6\n2 2\n5 6\n5 1\n1 2\n3 4\n4 5\n1 1\n3 4\n5 2\n4 5\n3 3\n1 1\n3 4\n1 6\n2 4\n1 3\n3 2\n6 5\n1 6\n3 6\n2 3\n2 6\n5 1\n5 5\n5 6\n4 1\n6 2\n3 6\n5 3\n2 2\n2 4\n6 6\n3 6\n4 6\n2 5\n5 3\n1 2\n3 4\n3 4\n6 2\n2 4\n2 2\n4 6\n3 5\n4 2\n5 6\n4 2\n2 3\n6 2\n5 6\n2 1\n3 3\n6 6\n4 3\n4 2",
"output": "1"
},
{
"input": "1\n2 2",
"output": "0"
},
{
"input": "3\n2 4\n6 6\n3 3",
"output": "-1"
},
{
"input": "2\n3 6\n4 1",
"output": "1"
},
{
"input": "3\n1 1\n1 1\n3 3",
"output": "-1"
},
{
"input": "3\n2 3\n1 1\n2 3",
"output": "1"
},
{
"input": "3\n2 2\n2 1\n1 2",
"output": "1"
},
{
"input": "3\n1 1\n1 1\n1 1",
"output": "-1"
}
] | 1,453,562,515
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 124
| 0
|
n = int(input())
arr_a, arr_b = [], []
for _ in range(n):
a, b = map(int, input().split())
arr_a.append(a)
arr_b.append(b)
if sum(arr_a) % 2 + sum(arr_b) % 2 == 0:
print(0)
exit()
for i in range(n):
arr_a[i], arr_b[i] = arr_b[i], arr_a[i]
if sum(arr_a) % 2 + sum(arr_b) % 2 == 0:
print(1)
exit()
print(-1)
|
Title: Domino
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera has got *n* domino pieces in a row. Each piece consists of two halves — the upper one and the lower one. Each of the halves contains a number from 1 to 6. Valera loves even integers very much, so he wants the sum of the numbers on the upper halves and the sum of the numbers on the lower halves to be even.
To do that, Valera can rotate the dominoes by 180 degrees. After the rotation the upper and the lower halves swap places. This action takes one second. Help Valera find out the minimum time he must spend rotating dominoes to make his wish come true.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100), denoting the number of dominoes Valera has. Next *n* lines contain two space-separated integers *x**i*,<=*y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=6). Number *x**i* is initially written on the upper half of the *i*-th domino, *y**i* is initially written on the lower half.
Output Specification:
Print a single number — the minimum required number of seconds. If Valera can't do the task in any time, print <=-<=1.
Demo Input:
['2\n4 2\n6 4\n', '1\n2 3\n', '3\n1 4\n2 3\n4 4\n']
Demo Output:
['0\n', '-1\n', '1\n']
Note:
In the first test case the sum of the numbers on the upper halves equals 10 and the sum of the numbers on the lower halves equals 6. Both numbers are even, so Valera doesn't required to do anything.
In the second sample Valera has only one piece of domino. It is written 3 on the one of its halves, therefore one of the sums will always be odd.
In the third case Valera can rotate the first piece, and after that the sum on the upper halves will be equal to 10, and the sum on the lower halves will be equal to 8.
|
```python
n = int(input())
arr_a, arr_b = [], []
for _ in range(n):
a, b = map(int, input().split())
arr_a.append(a)
arr_b.append(b)
if sum(arr_a) % 2 + sum(arr_b) % 2 == 0:
print(0)
exit()
for i in range(n):
arr_a[i], arr_b[i] = arr_b[i], arr_a[i]
if sum(arr_a) % 2 + sum(arr_b) % 2 == 0:
print(1)
exit()
print(-1)
```
| 3
|
|
40
|
A
|
Find Color
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"geometry",
"implementation",
"math"
] |
A. Find Color
|
2
|
256
|
Not so long ago as a result of combat operations the main Berland place of interest — the magic clock — was damaged. The cannon's balls made several holes in the clock, that's why the residents are concerned about the repair. The magic clock can be represented as an infinite Cartesian plane, where the origin corresponds to the clock center. The clock was painted two colors as is shown in the picture:
The picture shows only the central part of the clock. This coloring naturally extends to infinity.
The balls can be taken to be points on the plane. Your task is to find the color of the area, damaged by the given ball.
All the points located on the border of one of the areas have to be considered painted black.
|
The first and single line contains two integers *x* and *y* — the coordinates of the hole made in the clock by the ball. Each of the numbers *x* and *y* has an absolute value that does not exceed 1000.
|
Find the required color.
All the points between which and the origin of coordinates the distance is integral-value are painted black.
|
[
"-2 1\n",
"2 1\n",
"4 3\n"
] |
[
"white\n",
"black\n",
"black\n"
] |
none
| 500
|
[
{
"input": "-2 1",
"output": "white"
},
{
"input": "2 1",
"output": "black"
},
{
"input": "4 3",
"output": "black"
},
{
"input": "3 3",
"output": "black"
},
{
"input": "4 4",
"output": "white"
},
{
"input": "-4 4",
"output": "black"
},
{
"input": "4 -4",
"output": "black"
},
{
"input": "-4 -4",
"output": "white"
},
{
"input": "0 0",
"output": "black"
},
{
"input": "0 1",
"output": "black"
},
{
"input": "0 2",
"output": "black"
},
{
"input": "0 1000",
"output": "black"
},
{
"input": "1000 0",
"output": "black"
},
{
"input": "-1000 0",
"output": "black"
},
{
"input": "0 -1000",
"output": "black"
},
{
"input": "1000 -1000",
"output": "white"
},
{
"input": "12 5",
"output": "black"
},
{
"input": "12 -5",
"output": "black"
},
{
"input": "-12 -35",
"output": "black"
},
{
"input": "20 -21",
"output": "black"
},
{
"input": "-677 492",
"output": "white"
},
{
"input": "-673 -270",
"output": "white"
},
{
"input": "-668 970",
"output": "black"
},
{
"input": "-220 208",
"output": "white"
},
{
"input": "-215 -996",
"output": "black"
},
{
"input": "-211 243",
"output": "black"
},
{
"input": "-206 -518",
"output": "white"
},
{
"input": "-201 278",
"output": "black"
},
{
"input": "-196 -484",
"output": "black"
},
{
"input": "902 479",
"output": "white"
},
{
"input": "-441 572",
"output": "white"
},
{
"input": "217 221",
"output": "white"
},
{
"input": "875 -129",
"output": "white"
},
{
"input": "-469 -36",
"output": "black"
},
{
"input": "189 -387",
"output": "white"
},
{
"input": "847 -294",
"output": "white"
},
{
"input": "-496 -644",
"output": "black"
},
{
"input": "-281 -552",
"output": "white"
},
{
"input": "377 -902",
"output": "black"
},
{
"input": "165 -738",
"output": "white"
},
{
"input": "61 -175",
"output": "black"
},
{
"input": "-42 389",
"output": "black"
},
{
"input": "-589 952",
"output": "black"
},
{
"input": "-693 -929",
"output": "white"
},
{
"input": "-796 -365",
"output": "white"
},
{
"input": "658 198",
"output": "white"
},
{
"input": "555 319",
"output": "black"
},
{
"input": "8 882",
"output": "black"
},
{
"input": "-96 -556",
"output": "black"
},
{
"input": "-129 489",
"output": "black"
},
{
"input": "207 -224",
"output": "black"
},
{
"input": "64 0",
"output": "black"
},
{
"input": "17 144",
"output": "black"
},
{
"input": "60 -448",
"output": "black"
},
{
"input": "-399 -40",
"output": "black"
},
{
"input": "128 -504",
"output": "black"
},
{
"input": "0 72",
"output": "black"
},
{
"input": "168 -26",
"output": "black"
},
{
"input": "72 -154",
"output": "black"
},
{
"input": "117 -44",
"output": "black"
},
{
"input": "-72 -646",
"output": "black"
},
{
"input": "253 -204",
"output": "black"
},
{
"input": "-40 198",
"output": "black"
},
{
"input": "-216 -90",
"output": "black"
},
{
"input": "15 -8",
"output": "black"
},
{
"input": "-180 -432",
"output": "black"
},
{
"input": "280 342",
"output": "black"
},
{
"input": "132 224",
"output": "black"
},
{
"input": "-192 -256",
"output": "black"
},
{
"input": "351 -280",
"output": "black"
}
] | 1,583,601,154
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 8
| 186
| 0
|
x, y = map(int, input().split())
R = x*x + y*y
r = 1 + int((R-1)**.5)
print('black' if r*r==R or (r%2)^(x*y<=0) else 'white')
|
Title: Find Color
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Not so long ago as a result of combat operations the main Berland place of interest — the magic clock — was damaged. The cannon's balls made several holes in the clock, that's why the residents are concerned about the repair. The magic clock can be represented as an infinite Cartesian plane, where the origin corresponds to the clock center. The clock was painted two colors as is shown in the picture:
The picture shows only the central part of the clock. This coloring naturally extends to infinity.
The balls can be taken to be points on the plane. Your task is to find the color of the area, damaged by the given ball.
All the points located on the border of one of the areas have to be considered painted black.
Input Specification:
The first and single line contains two integers *x* and *y* — the coordinates of the hole made in the clock by the ball. Each of the numbers *x* and *y* has an absolute value that does not exceed 1000.
Output Specification:
Find the required color.
All the points between which and the origin of coordinates the distance is integral-value are painted black.
Demo Input:
['-2 1\n', '2 1\n', '4 3\n']
Demo Output:
['white\n', 'black\n', 'black\n']
Note:
none
|
```python
x, y = map(int, input().split())
R = x*x + y*y
r = 1 + int((R-1)**.5)
print('black' if r*r==R or (r%2)^(x*y<=0) else 'white')
```
| -1
|
25
|
A
|
IQ test
|
PROGRAMMING
| 1,300
|
[
"brute force"
] |
A. IQ test
|
2
|
256
|
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
|
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
|
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
|
[
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] |
[
"3\n",
"2\n"
] |
none
| 0
|
[
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,568,569,491
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 218
| 0
|
num = int(input())
x = list(map(int,input().strip().split()))[:num]
arry =[0]*101
for i in range(num):
if x[i] % 2 == 0:
arry[i] = "a"
elif x[i] % 2 == 1 :
arry[i] = "b"
if arry.count("b")>1:
print(arry.index("a")+1)
else:
print(arry.index("b")+1)
|
Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none
|
```python
num = int(input())
x = list(map(int,input().strip().split()))[:num]
arry =[0]*101
for i in range(num):
if x[i] % 2 == 0:
arry[i] = "a"
elif x[i] % 2 == 1 :
arry[i] = "b"
if arry.count("b")>1:
print(arry.index("a")+1)
else:
print(arry.index("b")+1)
```
| 3.9455
|
868
|
B
|
Race Against Time
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Have you ever tried to explain to the coordinator, why it is eight hours to the contest and not a single problem has been prepared yet? Misha had. And this time he has a really strong excuse: he faced a space-time paradox! Space and time replaced each other.
The entire universe turned into an enormous clock face with three hands — hour, minute, and second. Time froze, and clocks now show the time *h* hours, *m* minutes, *s* seconds.
Last time Misha talked with the coordinator at *t*1 o'clock, so now he stands on the number *t*1 on the clock face. The contest should be ready by *t*2 o'clock. In the terms of paradox it means that Misha has to go to number *t*2 somehow. Note that he doesn't have to move forward only: in these circumstances time has no direction.
Clock hands are very long, and Misha cannot get round them. He also cannot step over as it leads to the collapse of space-time. That is, if hour clock points 12 and Misha stands at 11 then he cannot move to 1 along the top arc. He has to follow all the way round the clock center (of course, if there are no other hands on his way).
Given the hands' positions, *t*1, and *t*2, find if Misha can prepare the contest on time (or should we say on space?). That is, find if he can move from *t*1 to *t*2 by the clock face.
|
Five integers *h*, *m*, *s*, *t*1, *t*2 (1<=≤<=*h*<=≤<=12, 0<=≤<=*m*,<=*s*<=≤<=59, 1<=≤<=*t*1,<=*t*2<=≤<=12, *t*1<=≠<=*t*2).
Misha's position and the target time do not coincide with the position of any hand.
|
Print "YES" (quotes for clarity), if Misha can prepare the contest on time, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
|
[
"12 30 45 3 11\n",
"12 0 1 12 1\n",
"3 47 0 4 9\n"
] |
[
"NO\n",
"YES\n",
"YES\n"
] |
The three examples are shown on the pictures below from left to right. The starting position of Misha is shown with green, the ending position is shown with pink. Note that the positions of the hands on the pictures are not exact, but are close to the exact and the answer is the same.
| 500
|
[
{
"input": "12 30 45 3 11",
"output": "NO"
},
{
"input": "12 0 1 12 1",
"output": "YES"
},
{
"input": "3 47 0 4 9",
"output": "YES"
},
{
"input": "10 22 59 6 10",
"output": "YES"
},
{
"input": "3 1 13 12 3",
"output": "NO"
},
{
"input": "11 19 28 9 10",
"output": "YES"
},
{
"input": "9 38 22 6 1",
"output": "NO"
},
{
"input": "5 41 11 5 8",
"output": "NO"
},
{
"input": "11 2 53 10 4",
"output": "YES"
},
{
"input": "9 41 17 10 1",
"output": "YES"
},
{
"input": "6 54 48 12 6",
"output": "YES"
},
{
"input": "12 55 9 5 1",
"output": "NO"
},
{
"input": "8 55 35 9 3",
"output": "NO"
},
{
"input": "3 21 34 3 10",
"output": "YES"
},
{
"input": "2 52 1 12 3",
"output": "NO"
},
{
"input": "7 17 11 1 7",
"output": "NO"
},
{
"input": "11 6 37 6 4",
"output": "YES"
},
{
"input": "9 6 22 8 1",
"output": "NO"
},
{
"input": "3 10 5 5 9",
"output": "YES"
},
{
"input": "7 12 22 11 2",
"output": "YES"
},
{
"input": "7 19 4 7 3",
"output": "NO"
},
{
"input": "11 36 21 4 6",
"output": "NO"
},
{
"input": "10 32 49 1 3",
"output": "YES"
},
{
"input": "1 9 43 11 3",
"output": "NO"
},
{
"input": "1 8 33 4 8",
"output": "NO"
},
{
"input": "3 0 33 9 4",
"output": "NO"
},
{
"input": "7 15 9 10 3",
"output": "NO"
},
{
"input": "8 3 57 11 1",
"output": "NO"
},
{
"input": "1 33 49 5 9",
"output": "NO"
},
{
"input": "3 40 0 5 7",
"output": "YES"
},
{
"input": "5 50 9 2 7",
"output": "NO"
},
{
"input": "10 0 52 6 1",
"output": "YES"
},
{
"input": "3 10 4 1 11",
"output": "NO"
},
{
"input": "2 41 53 4 6",
"output": "YES"
},
{
"input": "10 29 30 4 7",
"output": "NO"
},
{
"input": "5 13 54 9 11",
"output": "NO"
},
{
"input": "1 0 23 3 9",
"output": "NO"
},
{
"input": "1 0 41 12 1",
"output": "NO"
},
{
"input": "6 30 30 3 9",
"output": "YES"
},
{
"input": "3 7 32 11 10",
"output": "YES"
},
{
"input": "1 0 25 12 4",
"output": "NO"
},
{
"input": "12 0 0 5 6",
"output": "YES"
},
{
"input": "1 5 4 3 2",
"output": "YES"
},
{
"input": "6 30 30 9 10",
"output": "YES"
},
{
"input": "6 0 0 2 8",
"output": "NO"
},
{
"input": "10 50 59 9 10",
"output": "YES"
},
{
"input": "12 59 59 12 6",
"output": "NO"
},
{
"input": "3 0 30 3 4",
"output": "NO"
},
{
"input": "2 10 10 1 11",
"output": "YES"
},
{
"input": "10 5 30 1 12",
"output": "YES"
},
{
"input": "5 29 31 5 10",
"output": "YES"
},
{
"input": "5 2 2 11 2",
"output": "NO"
},
{
"input": "5 15 46 3 10",
"output": "YES"
},
{
"input": "1 30 50 1 2",
"output": "NO"
},
{
"input": "5 26 14 1 12",
"output": "YES"
},
{
"input": "1 58 43 12 1",
"output": "YES"
},
{
"input": "12 0 12 11 1",
"output": "NO"
},
{
"input": "6 52 41 6 5",
"output": "YES"
},
{
"input": "5 8 2 1 3",
"output": "NO"
},
{
"input": "2 0 0 1 3",
"output": "NO"
},
{
"input": "1 5 6 2 1",
"output": "YES"
},
{
"input": "9 5 5 11 12",
"output": "YES"
},
{
"input": "12 5 19 3 4",
"output": "NO"
},
{
"input": "6 14 59 1 3",
"output": "NO"
},
{
"input": "10 38 34 4 12",
"output": "YES"
},
{
"input": "2 54 14 2 12",
"output": "YES"
},
{
"input": "5 31 0 6 7",
"output": "NO"
},
{
"input": "6 15 30 3 9",
"output": "YES"
},
{
"input": "3 54 41 8 10",
"output": "NO"
},
{
"input": "3 39 10 10 12",
"output": "YES"
},
{
"input": "1 11 50 1 2",
"output": "NO"
},
{
"input": "5 40 24 8 1",
"output": "NO"
},
{
"input": "9 5 59 1 3",
"output": "NO"
},
{
"input": "5 0 0 6 7",
"output": "YES"
},
{
"input": "4 40 59 6 8",
"output": "YES"
},
{
"input": "10 13 55 12 1",
"output": "YES"
},
{
"input": "6 50 0 5 6",
"output": "YES"
},
{
"input": "7 59 3 7 4",
"output": "YES"
},
{
"input": "6 0 1 6 7",
"output": "NO"
},
{
"input": "6 15 55 3 5",
"output": "NO"
},
{
"input": "12 9 55 10 2",
"output": "YES"
},
{
"input": "2 0 1 11 2",
"output": "NO"
},
{
"input": "8 45 17 12 9",
"output": "NO"
},
{
"input": "5 30 31 11 3",
"output": "YES"
},
{
"input": "6 43 0 10 6",
"output": "NO"
},
{
"input": "6 30 30 1 11",
"output": "YES"
},
{
"input": "11 59 59 11 12",
"output": "YES"
},
{
"input": "5 45 35 9 5",
"output": "NO"
},
{
"input": "2 43 4 9 7",
"output": "NO"
},
{
"input": "12 30 50 6 9",
"output": "NO"
},
{
"input": "1 10 1 2 3",
"output": "NO"
},
{
"input": "10 5 55 9 1",
"output": "NO"
},
{
"input": "1 59 59 2 3",
"output": "YES"
},
{
"input": "1 49 14 10 3",
"output": "NO"
},
{
"input": "3 15 15 2 4",
"output": "YES"
},
{
"input": "10 5 55 1 5",
"output": "NO"
},
{
"input": "6 33 45 12 6",
"output": "YES"
},
{
"input": "1 20 20 11 1",
"output": "YES"
},
{
"input": "2 30 45 1 11",
"output": "YES"
},
{
"input": "1 55 1 11 10",
"output": "YES"
},
{
"input": "3 0 1 11 1",
"output": "NO"
},
{
"input": "1 5 6 1 12",
"output": "YES"
},
{
"input": "12 10 5 11 4",
"output": "YES"
},
{
"input": "6 5 59 12 1",
"output": "YES"
},
{
"input": "12 0 20 11 12",
"output": "YES"
},
{
"input": "3 25 30 4 5",
"output": "YES"
},
{
"input": "2 15 18 11 1",
"output": "YES"
},
{
"input": "12 5 48 11 9",
"output": "NO"
},
{
"input": "6 30 30 10 2",
"output": "YES"
},
{
"input": "1 0 11 1 2",
"output": "NO"
},
{
"input": "10 0 1 10 11",
"output": "NO"
},
{
"input": "3 30 45 10 1",
"output": "YES"
},
{
"input": "11 21 56 3 12",
"output": "YES"
},
{
"input": "3 16 16 3 4",
"output": "YES"
},
{
"input": "11 55 55 1 12",
"output": "YES"
},
{
"input": "12 12 12 11 12",
"output": "YES"
},
{
"input": "3 5 1 1 2",
"output": "NO"
},
{
"input": "3 30 45 10 11",
"output": "YES"
},
{
"input": "10 0 1 9 10",
"output": "YES"
},
{
"input": "3 0 5 3 6",
"output": "NO"
},
{
"input": "1 1 49 1 10",
"output": "NO"
},
{
"input": "9 45 15 11 12",
"output": "YES"
},
{
"input": "12 15 59 3 8",
"output": "NO"
},
{
"input": "5 0 5 3 6",
"output": "NO"
},
{
"input": "3 30 45 1 2",
"output": "YES"
},
{
"input": "2 10 11 2 4",
"output": "YES"
},
{
"input": "2 10 10 4 3",
"output": "YES"
},
{
"input": "3 30 59 1 2",
"output": "YES"
},
{
"input": "11 59 59 12 11",
"output": "YES"
},
{
"input": "10 25 50 5 6",
"output": "NO"
},
{
"input": "6 30 30 9 3",
"output": "YES"
},
{
"input": "8 14 40 12 3",
"output": "NO"
},
{
"input": "2 10 10 1 6",
"output": "YES"
}
] | 1,625,854,984
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 61
| 0
|
h,m,s,t1,t2 = map(int, input().split())
t1 = t1 * 360 // 12
t2 = t2 * 360 // 12
h = h * 360 // 12
m = m * 360 // 60
s = s * 360 // 60
if not (h in range(t1-1, t2+1) or m in range(t1-1,t2+1) or s in range(t1-1, t2+1)):
print("YES")
else:
print("NO")
|
Title: Race Against Time
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Have you ever tried to explain to the coordinator, why it is eight hours to the contest and not a single problem has been prepared yet? Misha had. And this time he has a really strong excuse: he faced a space-time paradox! Space and time replaced each other.
The entire universe turned into an enormous clock face with three hands — hour, minute, and second. Time froze, and clocks now show the time *h* hours, *m* minutes, *s* seconds.
Last time Misha talked with the coordinator at *t*1 o'clock, so now he stands on the number *t*1 on the clock face. The contest should be ready by *t*2 o'clock. In the terms of paradox it means that Misha has to go to number *t*2 somehow. Note that he doesn't have to move forward only: in these circumstances time has no direction.
Clock hands are very long, and Misha cannot get round them. He also cannot step over as it leads to the collapse of space-time. That is, if hour clock points 12 and Misha stands at 11 then he cannot move to 1 along the top arc. He has to follow all the way round the clock center (of course, if there are no other hands on his way).
Given the hands' positions, *t*1, and *t*2, find if Misha can prepare the contest on time (or should we say on space?). That is, find if he can move from *t*1 to *t*2 by the clock face.
Input Specification:
Five integers *h*, *m*, *s*, *t*1, *t*2 (1<=≤<=*h*<=≤<=12, 0<=≤<=*m*,<=*s*<=≤<=59, 1<=≤<=*t*1,<=*t*2<=≤<=12, *t*1<=≠<=*t*2).
Misha's position and the target time do not coincide with the position of any hand.
Output Specification:
Print "YES" (quotes for clarity), if Misha can prepare the contest on time, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['12 30 45 3 11\n', '12 0 1 12 1\n', '3 47 0 4 9\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n']
Note:
The three examples are shown on the pictures below from left to right. The starting position of Misha is shown with green, the ending position is shown with pink. Note that the positions of the hands on the pictures are not exact, but are close to the exact and the answer is the same.
|
```python
h,m,s,t1,t2 = map(int, input().split())
t1 = t1 * 360 // 12
t2 = t2 * 360 // 12
h = h * 360 // 12
m = m * 360 // 60
s = s * 360 // 60
if not (h in range(t1-1, t2+1) or m in range(t1-1,t2+1) or s in range(t1-1, t2+1)):
print("YES")
else:
print("NO")
```
| 0
|
|
81
|
A
|
Plug-in
|
PROGRAMMING
| 1,400
|
[
"implementation"
] |
A. Plug-in
|
1
|
256
|
Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result.
|
The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters.
|
Print the given string after it is processed. It is guaranteed that the result will contain at least one character.
|
[
"hhoowaaaareyyoouu\n",
"reallazy\n",
"abacabaabacabaa\n"
] |
[
"wre",
"rezy",
"a"
] |
none
| 500
|
[
{
"input": "hhoowaaaareyyoouu",
"output": "wre"
},
{
"input": "reallazy",
"output": "rezy"
},
{
"input": "abacabaabacabaa",
"output": "a"
},
{
"input": "xraccabccbry",
"output": "xy"
},
{
"input": "a",
"output": "a"
},
{
"input": "b",
"output": "b"
},
{
"input": "il",
"output": "il"
},
{
"input": "gfj",
"output": "gfj"
},
{
"input": "babbbbbababa",
"output": "babababa"
},
{
"input": "babbbbabbabbbababbabbbbbbabaabaababaaabbbbbabbbbaaaaabbaaabbaabaabbbbabbbababbabaaabbababaaababbbaaa",
"output": "babababababababababababa"
},
{
"input": "aab",
"output": "b"
},
{
"input": "abb",
"output": "a"
},
{
"input": "aba",
"output": "aba"
},
{
"input": "ab",
"output": "ab"
}
] | 1,697,095,305
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
s = list(input().strip(" "))
checkunit = s[0]
for i in range(len(s)):
if s[i] == checkunit:
s[i] = 0
else:
checkunit = s[i]
if i+1 < len(s):
if s[i] == s[i+1]:
s[i] = 0
ans = ''
for i in s:
if i != 0:
ans += i
print(ans)
|
Title: Plug-in
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result.
Input Specification:
The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters.
Output Specification:
Print the given string after it is processed. It is guaranteed that the result will contain at least one character.
Demo Input:
['hhoowaaaareyyoouu\n', 'reallazy\n', 'abacabaabacabaa\n']
Demo Output:
['wre', 'rezy', 'a']
Note:
none
|
```python
s = list(input().strip(" "))
checkunit = s[0]
for i in range(len(s)):
if s[i] == checkunit:
s[i] = 0
else:
checkunit = s[i]
if i+1 < len(s):
if s[i] == s[i+1]:
s[i] = 0
ans = ''
for i in s:
if i != 0:
ans += i
print(ans)
```
| 0
|
550
|
A
|
Two Substrings
|
PROGRAMMING
| 1,500
|
[
"brute force",
"dp",
"greedy",
"implementation",
"strings"
] | null | null |
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
|
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
|
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
|
[
"ABA\n",
"BACFAB\n",
"AXBYBXA\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA".
| 1,000
|
[
{
"input": "ABA",
"output": "NO"
},
{
"input": "BACFAB",
"output": "YES"
},
{
"input": "AXBYBXA",
"output": "NO"
},
{
"input": "ABABAB",
"output": "YES"
},
{
"input": "BBBBBBBBBB",
"output": "NO"
},
{
"input": "ABBA",
"output": "YES"
},
{
"input": "ABAXXXAB",
"output": "YES"
},
{
"input": "TESTABAXXABTEST",
"output": "YES"
},
{
"input": "A",
"output": "NO"
},
{
"input": "B",
"output": "NO"
},
{
"input": "X",
"output": "NO"
},
{
"input": "BA",
"output": "NO"
},
{
"input": "AB",
"output": "NO"
},
{
"input": "AA",
"output": "NO"
},
{
"input": "BB",
"output": "NO"
},
{
"input": "BAB",
"output": "NO"
},
{
"input": "AAB",
"output": "NO"
},
{
"input": "BAA",
"output": "NO"
},
{
"input": "ABB",
"output": "NO"
},
{
"input": "BBA",
"output": "NO"
},
{
"input": "AAA",
"output": "NO"
},
{
"input": "BBB",
"output": "NO"
},
{
"input": "AXBXBXA",
"output": "NO"
},
{
"input": "SKDSKDJABSDBADKFJDK",
"output": "YES"
},
{
"input": "ABAXXBBXXAA",
"output": "NO"
},
{
"input": "ABAB",
"output": "NO"
},
{
"input": "BABA",
"output": "NO"
},
{
"input": "AAAB",
"output": "NO"
},
{
"input": "AAAA",
"output": "NO"
},
{
"input": "AABA",
"output": "NO"
},
{
"input": "ABAA",
"output": "NO"
},
{
"input": "BAAA",
"output": "NO"
},
{
"input": "AABB",
"output": "NO"
},
{
"input": "BAAB",
"output": "YES"
},
{
"input": "BBAA",
"output": "NO"
},
{
"input": "BBBA",
"output": "NO"
},
{
"input": "BBAB",
"output": "NO"
},
{
"input": "BABB",
"output": "NO"
},
{
"input": "ABBB",
"output": "NO"
},
{
"input": "BBBB",
"output": "NO"
},
{
"input": "BABAB",
"output": "YES"
},
{
"input": "ABABA",
"output": "YES"
},
{
"input": "AAABAAACBBBC",
"output": "NO"
},
{
"input": "AABBBACBBBBBBAACBCCACBBAABBBBBCAACABAACABCACCBCBCCCBCBCABCBBCCBCBBAACBACAABACBBCACCBCCACCABBCBABBAAC",
"output": "YES"
},
{
"input": "CBBABDDBBADAC",
"output": "YES"
},
{
"input": "ABYFAB",
"output": "NO"
},
{
"input": "BABXXAB",
"output": "YES"
},
{
"input": "ABAXAB",
"output": "YES"
},
{
"input": "ABABXAB",
"output": "YES"
},
{
"input": "ABXABXABXABXABXBAXBAXBAXBA",
"output": "YES"
},
{
"input": "QQQQQQQQQABABQQQQQQQQ",
"output": "NO"
}
] | 1,687,590,834
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 0
|
s = input()
if 'AB' in s:
a1 = s.find('AB')
if 'BA' in s[0:a1]+s[a1+2:]:
print('YES')
else:
print('NO')
|
Title: Two Substrings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given string *s*. Your task is to determine if the given string *s* contains two non-overlapping substrings "AB" and "BA" (the substrings can go in any order).
Input Specification:
The only line of input contains a string *s* of length between 1 and 105 consisting of uppercase Latin letters.
Output Specification:
Print "YES" (without the quotes), if string *s* contains two non-overlapping substrings "AB" and "BA", and "NO" otherwise.
Demo Input:
['ABA\n', 'BACFAB\n', 'AXBYBXA\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample test, despite the fact that there are substrings "AB" and "BA", their occurrences overlap, so the answer is "NO".
In the second sample test there are the following occurrences of the substrings: BACFAB.
In the third sample test there is no substring "AB" nor substring "BA".
|
```python
s = input()
if 'AB' in s:
a1 = s.find('AB')
if 'BA' in s[0:a1]+s[a1+2:]:
print('YES')
else:
print('NO')
```
| 0
|
|
714
|
A
|
Meeting of Old Friends
|
PROGRAMMING
| 1,100
|
[
"implementation",
"math"
] | null | null |
Today an outstanding event is going to happen in the forest — hedgehog Filya will come to his old fried Sonya!
Sonya is an owl and she sleeps during the day and stay awake from minute *l*1 to minute *r*1 inclusive. Also, during the minute *k* she prinks and is unavailable for Filya.
Filya works a lot and he plans to visit Sonya from minute *l*2 to minute *r*2 inclusive.
Calculate the number of minutes they will be able to spend together.
|
The only line of the input contains integers *l*1, *r*1, *l*2, *r*2 and *k* (1<=≤<=*l*1,<=*r*1,<=*l*2,<=*r*2,<=*k*<=≤<=1018, *l*1<=≤<=*r*1, *l*2<=≤<=*r*2), providing the segments of time for Sonya and Filya and the moment of time when Sonya prinks.
|
Print one integer — the number of minutes Sonya and Filya will be able to spend together.
|
[
"1 10 9 20 1\n",
"1 100 50 200 75\n"
] |
[
"2\n",
"50\n"
] |
In the first sample, they will be together during minutes 9 and 10.
In the second sample, they will be together from minute 50 to minute 74 and from minute 76 to minute 100.
| 500
|
[
{
"input": "1 10 9 20 1",
"output": "2"
},
{
"input": "1 100 50 200 75",
"output": "50"
},
{
"input": "6 6 5 8 9",
"output": "1"
},
{
"input": "1 1000000000 1 1000000000 1",
"output": "999999999"
},
{
"input": "5 100 8 8 8",
"output": "0"
},
{
"input": "1 1000000000000000000 2 99999999999999999 1000000000",
"output": "99999999999999997"
},
{
"input": "1 1 1 1 1",
"output": "0"
},
{
"input": "1 2 3 4 5",
"output": "0"
},
{
"input": "1 1000000000 2 999999999 3141592",
"output": "999999997"
},
{
"input": "24648817341102 41165114064236 88046848035 13602161452932 10000831349205",
"output": "0"
},
{
"input": "1080184299348 34666828555290 6878390132365 39891656267344 15395310291636",
"output": "27788438422925"
},
{
"input": "11814 27385 22309 28354 23595",
"output": "5076"
},
{
"input": "4722316546398 36672578279675 796716437180 33840047334985 13411035401708",
"output": "29117730788587"
},
{
"input": "14300093617438 14381698008501 6957847034861 32510754974307 66056597033082",
"output": "81604391064"
},
{
"input": "700062402405871919 762322967106512617 297732773882447821 747309903322652819 805776739998108178",
"output": "47247500916780901"
},
{
"input": "59861796371397621 194872039092923459 668110259718450585 841148673332698972 928360292123223779",
"output": "0"
},
{
"input": "298248781360904821 346420922793050061 237084570581741798 726877079564549183 389611850470532358",
"output": "48172141432145241"
},
{
"input": "420745791717606818 864206437350900994 764928840030524015 966634105370748487 793326512080703489",
"output": "99277597320376979"
},
{
"input": "519325240668210886 776112702001665034 360568516809443669 875594219634943179 994594983925273138",
"output": "256787461333454149"
},
{
"input": "170331212821058551 891149660635282032 125964175621755330 208256491683509799 526532153531983174",
"output": "37925278862451249"
},
{
"input": "1 3 3 5 3",
"output": "0"
},
{
"input": "1 5 8 10 9",
"output": "0"
},
{
"input": "1 2 4 5 10",
"output": "0"
},
{
"input": "1 2 2 3 5",
"output": "1"
},
{
"input": "2 4 3 7 3",
"output": "1"
},
{
"input": "1 2 9 10 1",
"output": "0"
},
{
"input": "5 15 1 10 5",
"output": "5"
},
{
"input": "1 4 9 20 25",
"output": "0"
},
{
"input": "2 4 1 2 5",
"output": "1"
},
{
"input": "10 1000 1 100 2",
"output": "91"
},
{
"input": "1 3 3 8 10",
"output": "1"
},
{
"input": "4 6 6 8 9",
"output": "1"
},
{
"input": "2 3 1 4 3",
"output": "1"
},
{
"input": "1 2 2 3 100",
"output": "1"
},
{
"input": "1 2 100 120 2",
"output": "0"
},
{
"input": "1 3 5 7 4",
"output": "0"
},
{
"input": "1 3 5 7 5",
"output": "0"
},
{
"input": "1 4 8 10 6",
"output": "0"
},
{
"input": "1 2 5 6 100",
"output": "0"
},
{
"input": "1 2 5 10 20",
"output": "0"
},
{
"input": "1 2 5 6 7",
"output": "0"
},
{
"input": "2 5 7 12 6",
"output": "0"
},
{
"input": "10 20 50 100 80",
"output": "0"
},
{
"input": "1 2 5 10 2",
"output": "0"
},
{
"input": "1 2 5 6 4",
"output": "0"
},
{
"input": "5 9 1 2 3",
"output": "0"
},
{
"input": "50 100 1 20 3",
"output": "0"
},
{
"input": "10 20 3 7 30",
"output": "0"
},
{
"input": "1 5 10 10 100",
"output": "0"
},
{
"input": "100 101 1 2 3",
"output": "0"
},
{
"input": "1 5 10 20 6",
"output": "0"
},
{
"input": "1 10 15 25 5",
"output": "0"
},
{
"input": "1 2 5 10 3",
"output": "0"
},
{
"input": "2 3 5 6 100",
"output": "0"
},
{
"input": "1 2 4 5 6",
"output": "0"
},
{
"input": "6 10 1 2 40",
"output": "0"
},
{
"input": "20 30 1 5 1",
"output": "0"
},
{
"input": "20 40 50 100 50",
"output": "0"
},
{
"input": "1 1 4 9 2",
"output": "0"
},
{
"input": "1 2 5 6 1",
"output": "0"
},
{
"input": "1 100 400 500 450",
"output": "0"
},
{
"input": "5 6 1 2 5",
"output": "0"
},
{
"input": "1 10 21 30 50",
"output": "0"
},
{
"input": "100 200 300 400 101",
"output": "0"
},
{
"input": "2 8 12 16 9",
"output": "0"
},
{
"input": "1 5 7 9 6",
"output": "0"
},
{
"input": "300 400 100 200 101",
"output": "0"
},
{
"input": "1 2 2 3 10",
"output": "1"
},
{
"input": "1 10 100 200 5",
"output": "0"
},
{
"input": "1 3 3 4 4",
"output": "1"
},
{
"input": "10 20 30 40 25",
"output": "0"
},
{
"input": "1 2 5 10 1",
"output": "0"
},
{
"input": "2 4 8 10 1",
"output": "0"
},
{
"input": "2 5 10 15 7",
"output": "0"
},
{
"input": "100 200 5 10 1",
"output": "0"
},
{
"input": "1 2 100 200 300",
"output": "0"
},
{
"input": "30 100 10 20 25",
"output": "0"
},
{
"input": "10 20 1 5 6",
"output": "0"
},
{
"input": "4 5 1 2 4",
"output": "0"
},
{
"input": "11 100 1 9 1000",
"output": "0"
},
{
"input": "1 1 10 10 228",
"output": "0"
},
{
"input": "5 7 10 20 15",
"output": "0"
},
{
"input": "1 3 8 9 7",
"output": "0"
},
{
"input": "1 10 2 8 8",
"output": "6"
},
{
"input": "1 5 9 15 1",
"output": "0"
},
{
"input": "1 3 5 6 12",
"output": "0"
},
{
"input": "1 100 500 1000 3",
"output": "0"
},
{
"input": "1 1 1 1 2",
"output": "1"
},
{
"input": "1 1000 100 1000 200",
"output": "900"
},
{
"input": "4 5 1 4 1",
"output": "1"
},
{
"input": "1 5 5 7 3",
"output": "1"
},
{
"input": "1 4 4 10 11",
"output": "1"
},
{
"input": "1 1 3 4 100",
"output": "0"
},
{
"input": "1 4 3 5 6",
"output": "2"
},
{
"input": "10 100 20 30 40",
"output": "11"
},
{
"input": "5 9 1 11 7",
"output": "4"
}
] | 1,474,090,908
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 96
| 62
| 0
|
line = input()
l = line.split()
l1 = int(l[0])
r1 = int(l[1])
l2 = int(l[2])
r2 = int(l[3])
k = int(l[4])
spent = 0
if l2 > r1 or r2 < l1:
spent = 0
else:
if l1 > l2:
start = l1
else:
start = l2
if r1 < r2:
finish = r1
else:
finish = r2
spent = finish - start + 1
if k >= start and k <= finish:
spent -= 1
print(spent)
|
Title: Meeting of Old Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today an outstanding event is going to happen in the forest — hedgehog Filya will come to his old fried Sonya!
Sonya is an owl and she sleeps during the day and stay awake from minute *l*1 to minute *r*1 inclusive. Also, during the minute *k* she prinks and is unavailable for Filya.
Filya works a lot and he plans to visit Sonya from minute *l*2 to minute *r*2 inclusive.
Calculate the number of minutes they will be able to spend together.
Input Specification:
The only line of the input contains integers *l*1, *r*1, *l*2, *r*2 and *k* (1<=≤<=*l*1,<=*r*1,<=*l*2,<=*r*2,<=*k*<=≤<=1018, *l*1<=≤<=*r*1, *l*2<=≤<=*r*2), providing the segments of time for Sonya and Filya and the moment of time when Sonya prinks.
Output Specification:
Print one integer — the number of minutes Sonya and Filya will be able to spend together.
Demo Input:
['1 10 9 20 1\n', '1 100 50 200 75\n']
Demo Output:
['2\n', '50\n']
Note:
In the first sample, they will be together during minutes 9 and 10.
In the second sample, they will be together from minute 50 to minute 74 and from minute 76 to minute 100.
|
```python
line = input()
l = line.split()
l1 = int(l[0])
r1 = int(l[1])
l2 = int(l[2])
r2 = int(l[3])
k = int(l[4])
spent = 0
if l2 > r1 or r2 < l1:
spent = 0
else:
if l1 > l2:
start = l1
else:
start = l2
if r1 < r2:
finish = r1
else:
finish = r2
spent = finish - start + 1
if k >= start and k <= finish:
spent -= 1
print(spent)
```
| 3
|
|
125
|
B
|
Simple XML
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Let's define a string <x> as an opening tag, where *x* is any small letter of the Latin alphabet. Each opening tag matches a closing tag of the type </x>, where *x* is the same letter.
Tegs can be nested into each other: in this case one opening and closing tag pair is located inside another pair.
Let's define the notion of a XML-text:
- an empty string is a XML-text - if *s* is a XML-text, then *s*'=<a>+*s*+</a> also is a XML-text, where *a* is any small Latin letter - if *s*1, *s*2 are XML-texts, then *s*1+*s*2 also is a XML-text
You are given a XML-text (it is guaranteed that the text is valid), your task is to print in the following form:
- each tag (opening and closing) is located on a single line - print before the tag 2<=*<=*h* spaces, where *h* is the level of the tag's nestedness.
|
The input data consists on the only non-empty string — the XML-text, its length does not exceed 1000 characters. It is guaranteed that the text is valid. The text contains no spaces.
|
Print the given XML-text according to the above-given rules.
|
[
"<a><b><c></c></b></a>\n",
"<a><b></b><d><c></c></d></a>\n"
] |
[
"<a>\n <b>\n <c>\n </c>\n </b>\n</a>\n",
"<a>\n <b>\n </b>\n <d>\n <c>\n </c>\n </d>\n</a>\n"
] |
none
| 1,500
|
[
{
"input": "<a><b><c></c></b></a>",
"output": "<a>\n <b>\n <c>\n </c>\n </b>\n</a>"
},
{
"input": "<a><b></b><d><c></c></d></a>",
"output": "<a>\n <b>\n </b>\n <d>\n <c>\n </c>\n </d>\n</a>"
},
{
"input": "<z></z>",
"output": "<z>\n</z>"
},
{
"input": "<u><d></d></u><j></j>",
"output": "<u>\n <d>\n </d>\n</u>\n<j>\n</j>"
},
{
"input": "<a></a><n></n><v><r></r></v><z></z>",
"output": "<a>\n</a>\n<n>\n</n>\n<v>\n <r>\n </r>\n</v>\n<z>\n</z>"
},
{
"input": "<c><l></l><b><w><f><t><m></m></t></f><w></w></w></b></c>",
"output": "<c>\n <l>\n </l>\n <b>\n <w>\n <f>\n <t>\n <m>\n </m>\n </t>\n </f>\n <w>\n </w>\n </w>\n </b>\n</c>"
},
{
"input": "<u><d><g><k><m><a><u><j><d></d></j></u></a></m><m></m></k></g></d></u>",
"output": "<u>\n <d>\n <g>\n <k>\n <m>\n <a>\n <u>\n <j>\n <d>\n </d>\n </j>\n </u>\n </a>\n </m>\n <m>\n </m>\n </k>\n </g>\n </d>\n</u>"
},
{
"input": "<x><a><l></l></a><g><v></v><d></d></g><z></z><y></y></x><q><h></h><s></s></q><c></c><w></w><q></q>",
"output": "<x>\n <a>\n <l>\n </l>\n </a>\n <g>\n <v>\n </v>\n <d>\n </d>\n </g>\n <z>\n </z>\n <y>\n </y>\n</x>\n<q>\n <h>\n </h>\n <s>\n </s>\n</q>\n<c>\n</c>\n<w>\n</w>\n<q>\n</q>"
},
{
"input": "<b><k><t></t></k><j></j><t></t><q></q></b><x><h></h></x><r></r><k></k><i></i><t><b></b></t><z></z><x></x><p></p><u></u>",
"output": "<b>\n <k>\n <t>\n </t>\n </k>\n <j>\n </j>\n <t>\n </t>\n <q>\n </q>\n</b>\n<x>\n <h>\n </h>\n</x>\n<r>\n</r>\n<k>\n</k>\n<i>\n</i>\n<t>\n <b>\n </b>\n</t>\n<z>\n</z>\n<x>\n</x>\n<p>\n</p>\n<u>\n</u>"
},
{
"input": "<c><l><i><h><z></z></h><y><k></k><o></o></y></i><a></a><x></x></l><r><y></y><k><s></s></k></r><j><a><f></f></a></j><h></h><p></p></c><h></h>",
"output": "<c>\n <l>\n <i>\n <h>\n <z>\n </z>\n </h>\n <y>\n <k>\n </k>\n <o>\n </o>\n </y>\n </i>\n <a>\n </a>\n <x>\n </x>\n </l>\n <r>\n <y>\n </y>\n <k>\n <s>\n </s>\n </k>\n </r>\n <j>\n <a>\n <f>\n </f>\n </a>\n </j>\n <h>\n </h>\n <p>\n </p>\n</c>\n<h>\n</h>"
},
{
"input": "<p><q><l></l><q><k><r><n></n></r></k></q></q><x><z></z><r><k></k></r><h></h></x><c><p></p><o></o></c><n></n><c></c></p><b><c><z></z></c><u><u><f><a><d></d><q></q></a><x><i></i></x><r></r></f></u></u></b><j></j>",
"output": "<p>\n <q>\n <l>\n </l>\n <q>\n <k>\n <r>\n <n>\n </n>\n </r>\n </k>\n </q>\n </q>\n <x>\n <z>\n </z>\n <r>\n <k>\n </k>\n </r>\n <h>\n </h>\n </x>\n <c>\n <p>\n </p>\n <o>\n </o>\n </c>\n <n>\n </n>\n <c>\n </c>\n</p>\n<b>\n <c>\n <z>\n </z>\n </c>\n <u>\n <u>\n <f>\n <a>\n <d>\n </d>\n <q>\n </q>\n </a>\n <x>\n <i>\n ..."
},
{
"input": "<w><q><x></x></q><r></r><o></o><u></u><o></o></w><d><z></z><n><x></x></n><y></y><s></s><k></k><q></q><a></a></d><h><u></u><s></s><y></y><t></t><f></f></h><v><w><q></q></w><s></s><h></h></v><q><o></o><k></k><w></w></q><c></c><p><j></j></p><c><u></u></c><s></s><x></x><b></b><i></i>",
"output": "<w>\n <q>\n <x>\n </x>\n </q>\n <r>\n </r>\n <o>\n </o>\n <u>\n </u>\n <o>\n </o>\n</w>\n<d>\n <z>\n </z>\n <n>\n <x>\n </x>\n </n>\n <y>\n </y>\n <s>\n </s>\n <k>\n </k>\n <q>\n </q>\n <a>\n </a>\n</d>\n<h>\n <u>\n </u>\n <s>\n </s>\n <y>\n </y>\n <t>\n </t>\n <f>\n </f>\n</h>\n<v>\n <w>\n <q>\n </q>\n </w>\n <s>\n </s>\n <h>\n </h>\n</v>\n<q>\n <o>\n </o>\n <k>\n </k>\n <w>\n </w>\n</q>\n<c>\n</c>\n<p>\n <j>\n </j>\n</p>\n<c>\n <u>\n </u..."
},
{
"input": "<g><t><m><x><f><w><z><b><d><j></j><g><z></z><q><l><j></j><l><k></k><l><n><d></d><m></m></n></l><i><m><j></j></m></i></l></l><w><t><h><r><h></h><b></b></r></h></t><d><j></j></d><x><w><r><s><s></s></s></r></w><x></x></x></w><m><m><d></d><x><r><x><o><v></v><d><n></n></d></o></x></r></x></m></m></q></g><y></y></d></b></z></w></f></x><a></a></m></t></g>",
"output": "<g>\n <t>\n <m>\n <x>\n <f>\n <w>\n <z>\n <b>\n <d>\n <j>\n </j>\n <g>\n <z>\n </z>\n <q>\n <l>\n <j>\n </j>\n <l>\n <k>\n </k>\n <l>\n <n>\n ..."
},
{
"input": "<d><d><w><v><g><m></m></g><b><u></u><j><h><n><q><q><c></c></q></q></n></h><c></c><l><r><l></l><b><d></d><x><k><o><w><q><x></x></q></w></o></k><p></p></x><g><m></m></g></b></r></l></j><k><l></l></k><c><v><g><p><p><d><e><z><x></x></z></e><v></v></d><u><o><u></u><k></k></o></u><m><x><h><z><f></f></z></h></x><w></w></m></p></p></g></v><t><n><u><b><h></h></b></u><r><m><k><z></z></k></m><j><e><w><s></s><e><s><p></p><o></o></s><g></g></e><u></u></w></e></j></r></n></t></c></b></v></w></d></d>",
"output": "<d>\n <d>\n <w>\n <v>\n <g>\n <m>\n </m>\n </g>\n <b>\n <u>\n </u>\n <j>\n <h>\n <n>\n <q>\n <q>\n <c>\n </c>\n </q>\n </q>\n </n>\n </h>\n <c>\n </c>\n <l>\n <r>\n <l>\n </l>\n <b>\n ..."
}
] | 1,589,668,243
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 186
| 6,963,200
|
n=input()
ls=[]
i=0
while (i<len(n)):
if(n[i]=='<'):
p=''
j=i
while(n[j]!='>'):
p+=n[j]
j+=1
p+='>'
ls.append(p)
i+=1
k=0
i=0
while i<len(ls):
flag=0
if (ls[i].replace(' ','')[1]=='/'):
i+=1
continue
else:
j=i+1
while (j<len(ls) and ls[j].replace(' ','').replace('/','')!=ls[i].replace(' ','')):
ls[j]=' '*2+ls[j]
j+=1
i+=1
for i in ls:
print(i)
|
Title: Simple XML
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's define a string <x> as an opening tag, where *x* is any small letter of the Latin alphabet. Each opening tag matches a closing tag of the type </x>, where *x* is the same letter.
Tegs can be nested into each other: in this case one opening and closing tag pair is located inside another pair.
Let's define the notion of a XML-text:
- an empty string is a XML-text - if *s* is a XML-text, then *s*'=<a>+*s*+</a> also is a XML-text, where *a* is any small Latin letter - if *s*1, *s*2 are XML-texts, then *s*1+*s*2 also is a XML-text
You are given a XML-text (it is guaranteed that the text is valid), your task is to print in the following form:
- each tag (opening and closing) is located on a single line - print before the tag 2<=*<=*h* spaces, where *h* is the level of the tag's nestedness.
Input Specification:
The input data consists on the only non-empty string — the XML-text, its length does not exceed 1000 characters. It is guaranteed that the text is valid. The text contains no spaces.
Output Specification:
Print the given XML-text according to the above-given rules.
Demo Input:
['<a><b><c></c></b></a>\n', '<a><b></b><d><c></c></d></a>\n']
Demo Output:
['<a>\n <b>\n <c>\n </c>\n </b>\n</a>\n', '<a>\n <b>\n </b>\n <d>\n <c>\n </c>\n </d>\n</a>\n']
Note:
none
|
```python
n=input()
ls=[]
i=0
while (i<len(n)):
if(n[i]=='<'):
p=''
j=i
while(n[j]!='>'):
p+=n[j]
j+=1
p+='>'
ls.append(p)
i+=1
k=0
i=0
while i<len(ls):
flag=0
if (ls[i].replace(' ','')[1]=='/'):
i+=1
continue
else:
j=i+1
while (j<len(ls) and ls[j].replace(' ','').replace('/','')!=ls[i].replace(' ','')):
ls[j]=' '*2+ls[j]
j+=1
i+=1
for i in ls:
print(i)
```
| 0
|
|
950
|
A
|
Left-handers, Right-handers and Ambidexters
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively.
|
The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training.
|
Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players.
|
[
"1 4 2\n",
"5 5 5\n",
"0 2 0\n"
] |
[
"6\n",
"14\n",
"0\n"
] |
In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand.
| 500
|
[
{
"input": "1 4 2",
"output": "6"
},
{
"input": "5 5 5",
"output": "14"
},
{
"input": "0 2 0",
"output": "0"
},
{
"input": "30 70 34",
"output": "128"
},
{
"input": "89 32 24",
"output": "112"
},
{
"input": "89 44 77",
"output": "210"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "100 100 100",
"output": "300"
},
{
"input": "1 1 1",
"output": "2"
},
{
"input": "30 70 35",
"output": "130"
},
{
"input": "89 44 76",
"output": "208"
},
{
"input": "0 100 100",
"output": "200"
},
{
"input": "100 0 100",
"output": "200"
},
{
"input": "100 1 100",
"output": "200"
},
{
"input": "1 100 100",
"output": "200"
},
{
"input": "100 100 0",
"output": "200"
},
{
"input": "100 100 1",
"output": "200"
},
{
"input": "1 2 1",
"output": "4"
},
{
"input": "0 0 100",
"output": "100"
},
{
"input": "0 100 0",
"output": "0"
},
{
"input": "100 0 0",
"output": "0"
},
{
"input": "10 8 7",
"output": "24"
},
{
"input": "45 47 16",
"output": "108"
},
{
"input": "59 43 100",
"output": "202"
},
{
"input": "34 1 30",
"output": "62"
},
{
"input": "14 81 1",
"output": "30"
},
{
"input": "53 96 94",
"output": "242"
},
{
"input": "62 81 75",
"output": "218"
},
{
"input": "21 71 97",
"output": "188"
},
{
"input": "49 82 73",
"output": "204"
},
{
"input": "88 19 29",
"output": "96"
},
{
"input": "89 4 62",
"output": "132"
},
{
"input": "58 3 65",
"output": "126"
},
{
"input": "27 86 11",
"output": "76"
},
{
"input": "35 19 80",
"output": "134"
},
{
"input": "4 86 74",
"output": "156"
},
{
"input": "32 61 89",
"output": "182"
},
{
"input": "68 60 98",
"output": "226"
},
{
"input": "37 89 34",
"output": "142"
},
{
"input": "92 9 28",
"output": "74"
},
{
"input": "79 58 98",
"output": "234"
},
{
"input": "35 44 88",
"output": "166"
},
{
"input": "16 24 19",
"output": "58"
},
{
"input": "74 71 75",
"output": "220"
},
{
"input": "83 86 99",
"output": "268"
},
{
"input": "97 73 15",
"output": "176"
},
{
"input": "77 76 73",
"output": "226"
},
{
"input": "48 85 55",
"output": "188"
},
{
"input": "1 2 2",
"output": "4"
},
{
"input": "2 2 2",
"output": "6"
},
{
"input": "2 1 2",
"output": "4"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "3 2 1",
"output": "6"
},
{
"input": "1 2 3",
"output": "6"
},
{
"input": "1 3 2",
"output": "6"
},
{
"input": "2 1 3",
"output": "6"
},
{
"input": "2 3 1",
"output": "6"
},
{
"input": "3 1 2",
"output": "6"
},
{
"input": "99 99 99",
"output": "296"
},
{
"input": "99 99 100",
"output": "298"
},
{
"input": "99 100 99",
"output": "298"
},
{
"input": "99 100 100",
"output": "298"
},
{
"input": "100 99 99",
"output": "298"
},
{
"input": "100 99 100",
"output": "298"
},
{
"input": "100 100 99",
"output": "298"
},
{
"input": "89 32 23",
"output": "110"
},
{
"input": "4 5 0",
"output": "8"
},
{
"input": "3 0 3",
"output": "6"
},
{
"input": "0 0 2",
"output": "2"
},
{
"input": "97 97 0",
"output": "194"
},
{
"input": "1 4 0",
"output": "2"
},
{
"input": "5 2 0",
"output": "4"
},
{
"input": "0 5 10",
"output": "14"
},
{
"input": "0 1 2",
"output": "2"
},
{
"input": "5 2 3",
"output": "10"
},
{
"input": "5 5 0",
"output": "10"
},
{
"input": "0 0 10",
"output": "10"
},
{
"input": "0 1 1",
"output": "2"
},
{
"input": "0 0 1",
"output": "0"
}
] | 1,593,285,413
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 93
| 6,656,000
|
l,r,m=map(int,input().split())
if m==0:
if l!=0 and r!=0:
if l<r:
print(l)
else:
print(r)
else:
print(0)
else:
print(l+r+m-1)
|
Title: Left-handers, Right-handers and Ambidexters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively.
Input Specification:
The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training.
Output Specification:
Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players.
Demo Input:
['1 4 2\n', '5 5 5\n', '0 2 0\n']
Demo Output:
['6\n', '14\n', '0\n']
Note:
In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand.
|
```python
l,r,m=map(int,input().split())
if m==0:
if l!=0 and r!=0:
if l<r:
print(l)
else:
print(r)
else:
print(0)
else:
print(l+r+m-1)
```
| 0
|
|
254
|
A
|
Cards with Numbers
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"sortings"
] | null | null |
Petya has got 2*n* cards, each card contains some integer. The numbers on the cards can be the same. Let's index all cards by consecutive integers from 1 to 2*n*. We'll denote the number that is written on a card with number *i*, as *a**i*. In order to play one entertaining game with his friends, Petya needs to split the cards into pairs so that each pair had equal numbers on the cards. Help Petya do that.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains the sequence of 2*n* positive integers *a*1,<=*a*2,<=...,<=*a*2*n* (1<=≤<=*a**i*<=≤<=5000) — the numbers that are written on the cards. The numbers on the line are separated by single spaces.
|
If it is impossible to divide the cards into pairs so that cards in each pair had the same numbers, print on a single line integer -1. But if the required partition exists, then print *n* pairs of integers, a pair per line — the indices of the cards that form the pairs.
Separate the numbers on the lines by spaces. You can print the pairs and the numbers in the pairs in any order. If there are multiple solutions, print any of them.
|
[
"3\n20 30 10 30 20 10\n",
"1\n1 2\n"
] |
[
"4 2\n1 5\n6 3\n",
"-1"
] |
none
| 500
|
[
{
"input": "3\n20 30 10 30 20 10",
"output": "4 2\n1 5\n6 3"
},
{
"input": "1\n1 2",
"output": "-1"
},
{
"input": "5\n2 2 2 2 2 1 2 2 1 2",
"output": "2 1\n3 4\n7 5\n6 9\n10 8"
},
{
"input": "5\n2 1 2 2 1 1 1 1 1 2",
"output": "3 1\n2 5\n7 6\n8 9\n10 4"
},
{
"input": "5\n1 2 2 2 1 2 2 1 2 1",
"output": "3 2\n1 5\n6 4\n7 9\n10 8"
},
{
"input": "5\n3 3 1 1 1 3 2 3 1 2",
"output": "2 1\n3 4\n8 6\n5 9\n10 7"
},
{
"input": "5\n1 1 3 1 3 3 3 1 1 1",
"output": "2 1\n3 5\n7 6\n4 8\n10 9"
},
{
"input": "5\n3 1 1 1 2 3 3 3 2 1",
"output": "3 2\n1 6\n8 7\n5 9\n10 4"
},
{
"input": "5\n3 3 2 2 3 3 1 3 1 3",
"output": "2 1\n3 4\n6 5\n7 9\n10 8"
},
{
"input": "5\n4 1 3 1 4 1 2 2 3 1",
"output": "4 2\n1 5\n8 7\n3 9\n10 6"
},
{
"input": "100\n8 6 7 8 7 9 1 7 3 3 5 8 7 8 5 4 8 4 8 1 2 8 3 7 8 7 6 5 7 9 6 10 7 6 7 8 6 8 9 5 1 5 6 1 4 8 4 8 7 2 6 2 6 6 2 8 2 8 7 1 5 4 4 6 4 9 7 5 1 8 1 3 9 2 3 2 4 7 6 10 5 3 4 10 8 9 6 7 2 7 10 1 8 10 4 1 1 1 2 7 5 4 9 10 6 8 3 1 10 9 9 6 1 5 8 6 6 3 3 4 10 10 8 9 7 10 9 3 7 6 3 2 10 8 5 8 5 5 5 10 8 5 7 6 10 7 7 9 10 10 9 9 3 6 5 6 8 1 9 8 2 4 8 8 6 8 10 2 3 5 2 6 8 4 8 6 4 5 10 8 1 10 5 2 5 6 8 2 6 8 1 3 4 5 7 5 6 9 2 8",
"output": "4 1\n3 5\n10 9\n8 13\n14 12\n11 15\n18 16\n17 19\n20 7\n22 25\n26 24\n2 27\n30 6\n29 33\n34 31\n36 38\n40 28\n37 43\n44 41\n45 47\n48 46\n35 49\n50 21\n51 53\n55 52\n56 58\n61 42\n62 63\n64 54\n39 66\n67 59\n60 69\n72 23\n57 74\n77 65\n32 80\n81 68\n75 82\n85 70\n73 86\n87 79\n78 88\n89 76\n84 91\n92 71\n83 95\n97 96\n90 100\n104 94\n93 106\n108 98\n103 110\n112 105\n101 114\n117 116\n107 118\n120 102\n109 121\n123 115\n111 124\n126 122\n119 128\n129 125\n99 132\n136 134\n135 137\n139 138\n133 140\n144 130..."
},
{
"input": "100\n7 3 8 8 1 9 6 6 3 3 8 2 7 9 9 10 2 10 4 4 9 3 6 5 2 6 3 6 3 5 2 3 8 2 5 10 3 9 7 2 1 6 7 4 8 3 9 10 9 4 3 3 7 1 4 2 2 5 6 6 1 7 9 1 8 1 2 2 5 9 7 7 6 4 6 10 1 1 8 1 5 6 4 9 5 4 4 10 6 4 5 1 9 1 7 8 6 10 3 2 4 7 10 4 8 10 6 7 8 4 1 3 8 3 2 1 9 4 2 4 3 1 6 8 6 2 2 5 6 8 6 10 1 6 4 2 7 3 6 10 6 5 6 6 3 9 4 6 4 1 5 4 4 2 8 4 10 3 7 6 6 10 2 5 5 6 1 6 1 9 9 1 10 5 10 1 1 5 7 5 2 1 4 2 3 3 3 5 1 8 10 3 3 5 9 6 3 6 8 1",
"output": "4 3\n7 8\n9 2\n1 13\n14 6\n12 17\n18 16\n19 20\n21 15\n10 22\n26 23\n27 29\n30 24\n25 31\n33 11\n32 37\n40 34\n5 41\n42 28\n39 43\n47 38\n36 48\n50 44\n46 51\n57 56\n35 58\n60 59\n54 61\n62 53\n49 63\n65 45\n64 66\n68 67\n71 72\n74 55\n73 75\n78 77\n69 81\n84 70\n83 86\n88 76\n82 89\n90 87\n85 91\n92 80\n79 96\n99 52\n95 102\n103 98\n101 104\n107 97\n105 109\n111 94\n112 114\n115 100\n93 117\n118 110\n116 122\n124 113\n123 125\n126 119\n129 131\n132 106\n120 135\n136 127\n108 137\n138 121\n134 139\n142 128..."
},
{
"input": "100\n6 3 6 8 8 4 3 7 10 3 1 3 9 5 10 10 6 7 6 6 2 3 8 8 7 6 4 9 6 7 4 4 10 4 7 3 2 7 10 8 6 7 9 1 3 5 3 7 9 1 1 7 1 1 7 7 8 3 2 7 4 8 7 8 10 3 1 7 2 7 9 8 8 8 5 2 8 1 2 7 8 7 8 8 5 10 10 4 9 10 8 7 8 8 7 7 3 6 4 3 4 8 10 8 6 3 7 1 8 6 3 3 7 10 3 9 3 5 10 9 9 2 8 7 2 3 2 1 10 9 6 2 8 7 2 2 5 3 10 6 7 2 1 1 5 10 7 5 4 9 7 7 8 1 1 3 3 7 10 5 9 8 6 8 2 2 1 7 8 9 6 2 2 6 2 9 10 2 10 9 6 3 3 10 6 5 3 6 6 3 6 10 8 7 4 8 6 3 4 7",
"output": "-1"
},
{
"input": "1\n2 2",
"output": "2 1"
},
{
"input": "2\n1 2 4 7",
"output": "-1"
}
] | 1,583,325,089
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 109
| 0
|
file = open("input.txt", "r")
output = open("output.txt", "w")
n = int(file.readline())
block = []
for i, val in enumerate(file.readline().split(" ")):
block.append((val, i+1))
file.close()
block.sort(key=lambda x: x[0])
answer = []
pairs, bad = [], False
for i in range(1, n*2, 2):
if block[i][0] == block[i-1][0]:
answer.append("{0} {1}\n".format(block[i-1][1], block[i][1]))
else:
bad = True
break
if bad:
output.write("-1")
else:
output.write("".join(answer))
output.close()
|
Title: Cards with Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya has got 2*n* cards, each card contains some integer. The numbers on the cards can be the same. Let's index all cards by consecutive integers from 1 to 2*n*. We'll denote the number that is written on a card with number *i*, as *a**i*. In order to play one entertaining game with his friends, Petya needs to split the cards into pairs so that each pair had equal numbers on the cards. Help Petya do that.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105). The second line contains the sequence of 2*n* positive integers *a*1,<=*a*2,<=...,<=*a*2*n* (1<=≤<=*a**i*<=≤<=5000) — the numbers that are written on the cards. The numbers on the line are separated by single spaces.
Output Specification:
If it is impossible to divide the cards into pairs so that cards in each pair had the same numbers, print on a single line integer -1. But if the required partition exists, then print *n* pairs of integers, a pair per line — the indices of the cards that form the pairs.
Separate the numbers on the lines by spaces. You can print the pairs and the numbers in the pairs in any order. If there are multiple solutions, print any of them.
Demo Input:
['3\n20 30 10 30 20 10\n', '1\n1 2\n']
Demo Output:
['4 2\n1 5\n6 3\n', '-1']
Note:
none
|
```python
file = open("input.txt", "r")
output = open("output.txt", "w")
n = int(file.readline())
block = []
for i, val in enumerate(file.readline().split(" ")):
block.append((val, i+1))
file.close()
block.sort(key=lambda x: x[0])
answer = []
pairs, bad = [], False
for i in range(1, n*2, 2):
if block[i][0] == block[i-1][0]:
answer.append("{0} {1}\n".format(block[i-1][1], block[i][1]))
else:
bad = True
break
if bad:
output.write("-1")
else:
output.write("".join(answer))
output.close()
```
| 0
|
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,694,969,119
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 21
| 122
| 0
|
start = sorted(str(input()).split("+"))
final = str()
for i in start:
final += str(i) + "+"
print(final[:-1])
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
start = sorted(str(input()).split("+"))
final = str()
for i in start:
final += str(i) + "+"
print(final[:-1])
```
| 3
|
|
465
|
A
|
inc ARG
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit.
Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded.
Sergey wrote certain values of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell.
The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
|
Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell.
|
[
"4\n1100\n",
"4\n1111\n"
] |
[
"3\n",
"4\n"
] |
In the first sample the cell ends up with value 0010, in the second sample — with 0000.
| 500
|
[
{
"input": "4\n1100",
"output": "3"
},
{
"input": "4\n1111",
"output": "4"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n00",
"output": "1"
},
{
"input": "2\n01",
"output": "1"
},
{
"input": "2\n10",
"output": "2"
},
{
"input": "2\n11",
"output": "2"
},
{
"input": "10\n0000000000",
"output": "1"
},
{
"input": "20\n11111111110110001100",
"output": "11"
},
{
"input": "50\n01011110100010000001010000100001001101001101101011",
"output": "1"
},
{
"input": "60\n111111111101111111111111111111111111111111111111111111111111",
"output": "11"
},
{
"input": "60\n111111111111111111111111111111111111111111111111111111111111",
"output": "60"
},
{
"input": "66\n111111010010011001110011000111000100011110011001111110011111111101",
"output": "7"
},
{
"input": "90\n000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "91\n1011111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "2"
},
{
"input": "92\n11111111101011111011111111111111111111111011101111111111011111111111111101111111101011111101",
"output": "10"
},
{
"input": "100\n0001011110100011001100100010111001000001111101101001001001001011110100101101010000000110100101110010",
"output": "1"
},
{
"input": "100\n0111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "1"
},
{
"input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "100\n0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "100"
},
{
"input": "100\n1011001110001000011111110011000100001110010110111101110110011011011000010100110001111100000010110010",
"output": "2"
},
{
"input": "100\n1101111011001111111111110011110111101110111111111111111111111111111111011111111111110111111111111111",
"output": "3"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "100"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110",
"output": "100"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111101",
"output": "99"
},
{
"input": "100\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111100000",
"output": "96"
},
{
"input": "100\n1111111111111111111111111111111110011000110110001010101100100100001000010010010010000100110000010101",
"output": "34"
}
] | 1,597,521,623
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 108
| 307,200
|
n = int(input())
s = input()
s = list(map(int, s))
if(0 not in s):
print(n)
elif(1 not in s):
print(1)
else:
mx = 1
count = 1
for i in range(n-1):
if(s[i] == 1 and s[i+1] == 1):
count += 1
else:
if(mx<count):
mx = count
count = 1
else:
count = 1
print(mx+1)
|
Title: inc ARG
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sergey is testing a next-generation processor. Instead of bytes the processor works with memory cells consisting of *n* bits. These bits are numbered from 1 to *n*. An integer is stored in the cell in the following way: the least significant bit is stored in the first bit of the cell, the next significant bit is stored in the second bit, and so on; the most significant bit is stored in the *n*-th bit.
Now Sergey wants to test the following instruction: "add 1 to the value of the cell". As a result of the instruction, the integer that is written in the cell must be increased by one; if some of the most significant bits of the resulting number do not fit into the cell, they must be discarded.
Sergey wrote certain values of the bits in the cell and is going to add one to its value. How many bits of the cell will change after the operation?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of bits in the cell.
The second line contains a string consisting of *n* characters — the initial state of the cell. The first character denotes the state of the first bit of the cell. The second character denotes the second least significant bit and so on. The last character denotes the state of the most significant bit.
Output Specification:
Print a single integer — the number of bits in the cell which change their state after we add 1 to the cell.
Demo Input:
['4\n1100\n', '4\n1111\n']
Demo Output:
['3\n', '4\n']
Note:
In the first sample the cell ends up with value 0010, in the second sample — with 0000.
|
```python
n = int(input())
s = input()
s = list(map(int, s))
if(0 not in s):
print(n)
elif(1 not in s):
print(1)
else:
mx = 1
count = 1
for i in range(n-1):
if(s[i] == 1 and s[i+1] == 1):
count += 1
else:
if(mx<count):
mx = count
count = 1
else:
count = 1
print(mx+1)
```
| 0
|
|
415
|
B
|
Mashmokh and Tokens
|
PROGRAMMING
| 1,500
|
[
"binary search",
"greedy",
"implementation",
"math"
] | null | null |
Bimokh is Mashmokh's boss. For the following *n* days he decided to pay to his workers in a new way. At the beginning of each day he will give each worker a certain amount of tokens. Then at the end of each day each worker can give some of his tokens back to get a certain amount of money. The worker can save the rest of tokens but he can't use it in any other day to get more money. If a worker gives back *w* tokens then he'll get dollars.
Mashmokh likes the tokens however he likes money more. That's why he wants to save as many tokens as possible so that the amount of money he gets is maximal possible each day. He has *n* numbers *x*1,<=*x*2,<=...,<=*x**n*. Number *x**i* is the number of tokens given to each worker on the *i*-th day. Help him calculate for each of *n* days the number of tokens he can save.
|
The first line of input contains three space-separated integers *n*,<=*a*,<=*b* (1<=≤<=*n*<=≤<=105; 1<=≤<=*a*,<=*b*<=≤<=109). The second line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109).
|
Output *n* space-separated integers. The *i*-th of them is the number of tokens Mashmokh can save on the *i*-th day.
|
[
"5 1 4\n12 6 11 9 1\n",
"3 1 2\n1 2 3\n",
"1 1 1\n1\n"
] |
[
"0 2 3 1 1 ",
"1 0 1 ",
"0 "
] |
none
| 1,000
|
[
{
"input": "5 1 4\n12 6 11 9 1",
"output": "0 2 3 1 1 "
},
{
"input": "3 1 2\n1 2 3",
"output": "1 0 1 "
},
{
"input": "1 1 1\n1",
"output": "0 "
},
{
"input": "1 1 1000000000\n1000000000",
"output": "0 "
},
{
"input": "1 1 1000000000\n999999999",
"output": "999999999 "
},
{
"input": "10 1 100000000\n999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999 999999999",
"output": "99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 99999999 "
}
] | 1,398,169,740
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 327
| 9,625,600
|
import math
n,a,b=map(int,input().split())
xlist=[int(x) for x in input().split()]
savestring=''
for i in range(n):
maxmoney=math.floor(xlist[i]*a/b)
saves=xlist[i]-math.ceil(maxmoney*b/a)
savestring+=str(saves)+' '
print(savestring)
|
Title: Mashmokh and Tokens
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bimokh is Mashmokh's boss. For the following *n* days he decided to pay to his workers in a new way. At the beginning of each day he will give each worker a certain amount of tokens. Then at the end of each day each worker can give some of his tokens back to get a certain amount of money. The worker can save the rest of tokens but he can't use it in any other day to get more money. If a worker gives back *w* tokens then he'll get dollars.
Mashmokh likes the tokens however he likes money more. That's why he wants to save as many tokens as possible so that the amount of money he gets is maximal possible each day. He has *n* numbers *x*1,<=*x*2,<=...,<=*x**n*. Number *x**i* is the number of tokens given to each worker on the *i*-th day. Help him calculate for each of *n* days the number of tokens he can save.
Input Specification:
The first line of input contains three space-separated integers *n*,<=*a*,<=*b* (1<=≤<=*n*<=≤<=105; 1<=≤<=*a*,<=*b*<=≤<=109). The second line of input contains *n* space-separated integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109).
Output Specification:
Output *n* space-separated integers. The *i*-th of them is the number of tokens Mashmokh can save on the *i*-th day.
Demo Input:
['5 1 4\n12 6 11 9 1\n', '3 1 2\n1 2 3\n', '1 1 1\n1\n']
Demo Output:
['0 2 3 1 1 ', '1 0 1 ', '0 ']
Note:
none
|
```python
import math
n,a,b=map(int,input().split())
xlist=[int(x) for x in input().split()]
savestring=''
for i in range(n):
maxmoney=math.floor(xlist[i]*a/b)
saves=xlist[i]-math.ceil(maxmoney*b/a)
savestring+=str(saves)+' '
print(savestring)
```
| 3
|
|
1,009
|
A
|
Game Shopping
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
|
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
|
Print a single integer — the number of games Maxim will buy.
|
[
"5 4\n2 4 5 2 4\n5 3 4 6\n",
"5 2\n20 40 50 20 40\n19 20\n",
"6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n"
] |
[
"3\n",
"0\n",
"4\n"
] |
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
| 0
|
[
{
"input": "5 4\n2 4 5 2 4\n5 3 4 6",
"output": "3"
},
{
"input": "5 2\n20 40 50 20 40\n19 20",
"output": "0"
},
{
"input": "6 4\n4 8 15 16 23 42\n1000 1000 1000 1000",
"output": "4"
},
{
"input": "5 1\n1 1 1 1 1\n5",
"output": "1"
},
{
"input": "5 1\n10 1 1 1 1\n1000",
"output": "1"
},
{
"input": "5 1\n100 100 100 100 100\n100",
"output": "1"
},
{
"input": "2 1\n2 1\n1",
"output": "1"
},
{
"input": "2 3\n3 1\n2 4 2",
"output": "1"
},
{
"input": "1 5\n4\n1 4 3 3 2",
"output": "0"
},
{
"input": "5 3\n4 2 3 1 1\n2 1 3",
"output": "3"
},
{
"input": "3 5\n5 2 5\n1 4 1 4 2",
"output": "0"
},
{
"input": "7 3\n9 7 10 2 1 1 1\n8 9 6",
"output": "3"
},
{
"input": "5 3\n2 5 3 3 2\n2 5 3",
"output": "3"
}
] | 1,564,741,525
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 109
| 0
|
n,m = map(int, input().split())
li = list(map(int, input().split()))
li2 = list(map(int, input().split()))
c = 0
for i in li:
c += (c < len(li2) and li2[c] >= i)
print(c)
|
Title: Game Shopping
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Maxim wants to buy some games at the local game shop. There are $n$ games in the shop, the $i$-th game costs $c_i$.
Maxim has a wallet which can be represented as an array of integers. His wallet contains $m$ bills, the $j$-th bill has value $a_j$.
Games in the shop are ordered from left to right, Maxim tries to buy every game in that order.
When Maxim stands at the position $i$ in the shop, he takes the first bill from his wallet (if his wallet is empty then he proceeds to the next position immediately) and tries to buy the $i$-th game using this bill. After Maxim tried to buy the $n$-th game, he leaves the shop.
Maxim buys the $i$-th game if and only if the value of the first bill (which he takes) from his wallet is greater or equal to the cost of the $i$-th game. If he successfully buys the $i$-th game, the first bill from his wallet disappears and the next bill becomes first. Otherwise Maxim leaves the first bill in his wallet (this bill still remains the first one) and proceeds to the next game.
For example, for array $c = [2, 4, 5, 2, 4]$ and array $a = [5, 3, 4, 6]$ the following process takes place: Maxim buys the first game using the first bill (its value is $5$), the bill disappears, after that the second bill (with value $3$) becomes the first one in Maxim's wallet, then Maxim doesn't buy the second game because $c_2 > a_2$, the same with the third game, then he buys the fourth game using the bill of value $a_2$ (the third bill becomes the first one in Maxim's wallet) and buys the fifth game using the bill of value $a_3$.
Your task is to get the number of games Maxim will buy.
Input Specification:
The first line of the input contains two integers $n$ and $m$ ($1 \le n, m \le 1000$) — the number of games and the number of bills in Maxim's wallet.
The second line of the input contains $n$ integers $c_1, c_2, \dots, c_n$ ($1 \le c_i \le 1000$), where $c_i$ is the cost of the $i$-th game.
The third line of the input contains $m$ integers $a_1, a_2, \dots, a_m$ ($1 \le a_j \le 1000$), where $a_j$ is the value of the $j$-th bill from the Maxim's wallet.
Output Specification:
Print a single integer — the number of games Maxim will buy.
Demo Input:
['5 4\n2 4 5 2 4\n5 3 4 6\n', '5 2\n20 40 50 20 40\n19 20\n', '6 4\n4 8 15 16 23 42\n1000 1000 1000 1000\n']
Demo Output:
['3\n', '0\n', '4\n']
Note:
The first example is described in the problem statement.
In the second example Maxim cannot buy any game because the value of the first bill in his wallet is smaller than the cost of any game in the shop.
In the third example the values of the bills in Maxim's wallet are large enough to buy any game he encounter until he runs out of bills in his wallet.
|
```python
n,m = map(int, input().split())
li = list(map(int, input().split()))
li2 = list(map(int, input().split()))
c = 0
for i in li:
c += (c < len(li2) and li2[c] >= i)
print(c)
```
| 3
|
|
950
|
A
|
Left-handers, Right-handers and Ambidexters
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively.
|
The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training.
|
Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players.
|
[
"1 4 2\n",
"5 5 5\n",
"0 2 0\n"
] |
[
"6\n",
"14\n",
"0\n"
] |
In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand.
| 500
|
[
{
"input": "1 4 2",
"output": "6"
},
{
"input": "5 5 5",
"output": "14"
},
{
"input": "0 2 0",
"output": "0"
},
{
"input": "30 70 34",
"output": "128"
},
{
"input": "89 32 24",
"output": "112"
},
{
"input": "89 44 77",
"output": "210"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "100 100 100",
"output": "300"
},
{
"input": "1 1 1",
"output": "2"
},
{
"input": "30 70 35",
"output": "130"
},
{
"input": "89 44 76",
"output": "208"
},
{
"input": "0 100 100",
"output": "200"
},
{
"input": "100 0 100",
"output": "200"
},
{
"input": "100 1 100",
"output": "200"
},
{
"input": "1 100 100",
"output": "200"
},
{
"input": "100 100 0",
"output": "200"
},
{
"input": "100 100 1",
"output": "200"
},
{
"input": "1 2 1",
"output": "4"
},
{
"input": "0 0 100",
"output": "100"
},
{
"input": "0 100 0",
"output": "0"
},
{
"input": "100 0 0",
"output": "0"
},
{
"input": "10 8 7",
"output": "24"
},
{
"input": "45 47 16",
"output": "108"
},
{
"input": "59 43 100",
"output": "202"
},
{
"input": "34 1 30",
"output": "62"
},
{
"input": "14 81 1",
"output": "30"
},
{
"input": "53 96 94",
"output": "242"
},
{
"input": "62 81 75",
"output": "218"
},
{
"input": "21 71 97",
"output": "188"
},
{
"input": "49 82 73",
"output": "204"
},
{
"input": "88 19 29",
"output": "96"
},
{
"input": "89 4 62",
"output": "132"
},
{
"input": "58 3 65",
"output": "126"
},
{
"input": "27 86 11",
"output": "76"
},
{
"input": "35 19 80",
"output": "134"
},
{
"input": "4 86 74",
"output": "156"
},
{
"input": "32 61 89",
"output": "182"
},
{
"input": "68 60 98",
"output": "226"
},
{
"input": "37 89 34",
"output": "142"
},
{
"input": "92 9 28",
"output": "74"
},
{
"input": "79 58 98",
"output": "234"
},
{
"input": "35 44 88",
"output": "166"
},
{
"input": "16 24 19",
"output": "58"
},
{
"input": "74 71 75",
"output": "220"
},
{
"input": "83 86 99",
"output": "268"
},
{
"input": "97 73 15",
"output": "176"
},
{
"input": "77 76 73",
"output": "226"
},
{
"input": "48 85 55",
"output": "188"
},
{
"input": "1 2 2",
"output": "4"
},
{
"input": "2 2 2",
"output": "6"
},
{
"input": "2 1 2",
"output": "4"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "3 2 1",
"output": "6"
},
{
"input": "1 2 3",
"output": "6"
},
{
"input": "1 3 2",
"output": "6"
},
{
"input": "2 1 3",
"output": "6"
},
{
"input": "2 3 1",
"output": "6"
},
{
"input": "3 1 2",
"output": "6"
},
{
"input": "99 99 99",
"output": "296"
},
{
"input": "99 99 100",
"output": "298"
},
{
"input": "99 100 99",
"output": "298"
},
{
"input": "99 100 100",
"output": "298"
},
{
"input": "100 99 99",
"output": "298"
},
{
"input": "100 99 100",
"output": "298"
},
{
"input": "100 100 99",
"output": "298"
},
{
"input": "89 32 23",
"output": "110"
},
{
"input": "4 5 0",
"output": "8"
},
{
"input": "3 0 3",
"output": "6"
},
{
"input": "0 0 2",
"output": "2"
},
{
"input": "97 97 0",
"output": "194"
},
{
"input": "1 4 0",
"output": "2"
},
{
"input": "5 2 0",
"output": "4"
},
{
"input": "0 5 10",
"output": "14"
},
{
"input": "0 1 2",
"output": "2"
},
{
"input": "5 2 3",
"output": "10"
},
{
"input": "5 5 0",
"output": "10"
},
{
"input": "0 0 10",
"output": "10"
},
{
"input": "0 1 1",
"output": "2"
},
{
"input": "0 0 1",
"output": "0"
}
] | 1,544,715,861
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 93
| 0
|
a ,b = map(int,input().split())
l = list(map(int,input().split()))
print(a-1)
|
Title: Left-handers, Right-handers and Ambidexters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are at a water bowling training. There are *l* people who play with their left hand, *r* people, who play with their right hand, and *a* ambidexters, who can play with left or right hand.
The coach decided to form a team of even number of players, exactly half of the players should play with their right hand, and exactly half of the players should play with their left hand. One player should use only on of his hands.
Ambidexters play as well with their right hand as with their left hand. In the team, an ambidexter can play with their left hand, or with their right hand.
Please find the maximum possible size of the team, where equal number of players use their left and right hands, respectively.
Input Specification:
The only line contains three integers *l*, *r* and *a* (0<=≤<=*l*,<=*r*,<=*a*<=≤<=100) — the number of left-handers, the number of right-handers and the number of ambidexters at the training.
Output Specification:
Print a single even integer — the maximum number of players in the team. It is possible that the team can only have zero number of players.
Demo Input:
['1 4 2\n', '5 5 5\n', '0 2 0\n']
Demo Output:
['6\n', '14\n', '0\n']
Note:
In the first example you can form a team of 6 players. You should take the only left-hander and two ambidexters to play with left hand, and three right-handers to play with right hand. The only person left can't be taken into the team.
In the second example you can form a team of 14 people. You have to take all five left-handers, all five right-handers, two ambidexters to play with left hand and two ambidexters to play with right hand.
|
```python
a ,b = map(int,input().split())
l = list(map(int,input().split()))
print(a-1)
```
| -1
|
|
376
|
B
|
I.O.U.
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Imagine that there is a group of three friends: A, B and С. A owes B 20 rubles and B owes C 20 rubles. The total sum of the debts is 40 rubles. You can see that the debts are not organized in a very optimal manner. Let's rearrange them like that: assume that A owes C 20 rubles and B doesn't owe anything to anybody. The debts still mean the same but the total sum of the debts now equals 20 rubles.
This task is a generalisation of a described example. Imagine that your group of friends has *n* people and you know the debts between the people. Optimize the given debts without changing their meaning. In other words, finally for each friend the difference between the total money he should give and the total money he should take must be the same. Print the minimum sum of all debts in the optimal rearrangement of the debts. See the notes to the test samples to better understand the problem.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 0<=≤<=*m*<=≤<=104). The next *m* lines contain the debts. The *i*-th line contains three integers *a**i*,<=*b**i*,<=*c**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*; 1<=≤<=*c**i*<=≤<=100), which mean that person *a**i* owes person *b**i* *c**i* rubles.
Assume that the people are numbered by integers from 1 to *n*.
It is guaranteed that the same pair of people occurs at most once in the input. The input doesn't simultaneously contain pair of people (*x*,<=*y*) and pair of people (*y*,<=*x*).
|
Print a single integer — the minimum sum of debts in the optimal rearrangement.
|
[
"5 3\n1 2 10\n2 3 1\n2 4 1\n",
"3 0\n",
"4 3\n1 2 1\n2 3 1\n3 1 1\n"
] |
[
"10\n",
"0\n",
"0\n"
] |
In the first sample, you can assume that person number 1 owes 8 rubles to person number 2, 1 ruble to person number 3 and 1 ruble to person number 4. He doesn't owe anybody else anything. In the end, the total debt equals 10.
In the second sample, there are no debts.
In the third sample, you can annul all the debts.
| 1,000
|
[
{
"input": "5 3\n1 2 10\n2 3 1\n2 4 1",
"output": "10"
},
{
"input": "3 0",
"output": "0"
},
{
"input": "4 3\n1 2 1\n2 3 1\n3 1 1",
"output": "0"
},
{
"input": "20 28\n1 5 6\n1 12 7\n1 13 4\n1 15 7\n1 20 3\n2 4 1\n2 15 6\n3 5 3\n3 8 10\n3 13 8\n3 20 6\n4 6 10\n4 12 8\n4 19 5\n5 17 8\n6 9 9\n6 16 2\n6 19 9\n7 14 6\n8 9 3\n8 16 10\n9 11 7\n9 17 8\n11 13 8\n11 17 17\n11 19 1\n15 20 2\n17 20 1",
"output": "124"
},
{
"input": "20 36\n1 2 13\n1 3 1\n1 6 4\n1 12 8\n1 13 9\n1 15 3\n1 18 4\n2 10 2\n2 15 2\n2 18 6\n3 7 8\n3 16 19\n4 7 1\n4 18 4\n5 9 2\n5 15 9\n5 17 4\n5 18 5\n6 11 7\n6 13 1\n6 14 9\n7 10 4\n7 12 10\n7 15 9\n7 17 8\n8 14 4\n10 13 8\n10 19 9\n11 12 5\n12 17 6\n13 15 8\n13 19 4\n14 15 9\n14 16 8\n17 19 8\n17 20 7",
"output": "147"
},
{
"input": "20 40\n1 13 4\n2 3 3\n2 4 5\n2 7 7\n2 17 10\n3 5 3\n3 6 9\n3 10 4\n3 12 2\n3 13 2\n3 14 3\n4 5 4\n4 8 7\n4 13 9\n5 6 14\n5 14 5\n7 11 5\n7 12 13\n7 15 7\n8 14 5\n8 16 7\n8 18 17\n9 11 8\n9 19 19\n10 12 4\n10 16 3\n10 18 10\n10 20 9\n11 13 9\n11 20 2\n12 13 8\n12 18 2\n12 20 3\n13 17 1\n13 20 4\n14 16 8\n16 19 3\n18 19 3\n18 20 7\n19 20 10",
"output": "165"
},
{
"input": "50 10\n1 5 1\n2 34 2\n3 8 10\n5 28 4\n7 28 6\n13 49 9\n15 42 7\n16 26 7\n18 47 5\n20 41 10",
"output": "60"
},
{
"input": "50 46\n1 6 10\n1 18 1\n1 24 10\n1 33 2\n1 40 8\n3 16 7\n4 26 8\n4 32 2\n4 34 6\n5 29 8\n6 44 3\n8 20 5\n8 42 13\n10 13 5\n10 25 7\n10 27 9\n10 29 10\n11 23 4\n12 28 7\n12 30 10\n12 40 10\n13 18 2\n13 33 2\n14 15 7\n14 43 10\n14 47 3\n16 27 10\n17 21 6\n17 30 9\n19 40 4\n22 24 8\n22 25 7\n22 38 18\n25 38 1\n27 31 7\n27 40 8\n30 36 8\n31 34 1\n32 49 6\n33 35 4\n33 50 7\n38 47 1\n42 47 2\n42 50 5\n43 44 9\n47 50 5",
"output": "228"
},
{
"input": "100 48\n1 56 6\n2 42 3\n3 52 1\n9 50 8\n10 96 8\n11 39 2\n12 51 6\n12 68 7\n13 40 5\n14 18 10\n14 70 6\n15 37 4\n15 38 8\n15 82 6\n15 85 5\n16 48 4\n16 50 9\n16 71 9\n17 18 3\n17 100 10\n20 73 3\n22 32 9\n22 89 9\n23 53 3\n24 53 1\n27 78 10\n30 50 5\n33 94 8\n34 87 9\n35 73 3\n36 51 8\n37 88 10\n37 97 2\n40 47 8\n40 90 6\n44 53 3\n44 65 3\n47 48 8\n48 72 10\n49 98 2\n53 68 10\n53 71 9\n57 62 2\n63 76 10\n66 90 9\n71 76 8\n72 80 5\n75 77 7",
"output": "253"
},
{
"input": "4 3\n1 4 1\n2 3 1\n4 2 2",
"output": "2"
}
] | 1,601,195,441
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 409,600
|
from collections import defaultdict
def debt(g):
for i in g.keys():
l = len(g[i])
for k in range(l):
t =g[i][k][1]
u = g[i][k][0]
if u in g.keys():
for j in g[u]:
t -=j[1]
g[i][k][1] = t
return dict(g)
n , m = map(int,input().split())
d = defaultdict(list)
for _ in range(m):
a,b,c = map(int,input().split())
d[a].append([b,c])
a = debt(d)
s = 0
print(a)
for i , j in a.items():
l = len(a[i])
for k in range(l):
s+=j[k][1]
print(s)
|
Title: I.O.U.
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine that there is a group of three friends: A, B and С. A owes B 20 rubles and B owes C 20 rubles. The total sum of the debts is 40 rubles. You can see that the debts are not organized in a very optimal manner. Let's rearrange them like that: assume that A owes C 20 rubles and B doesn't owe anything to anybody. The debts still mean the same but the total sum of the debts now equals 20 rubles.
This task is a generalisation of a described example. Imagine that your group of friends has *n* people and you know the debts between the people. Optimize the given debts without changing their meaning. In other words, finally for each friend the difference between the total money he should give and the total money he should take must be the same. Print the minimum sum of all debts in the optimal rearrangement of the debts. See the notes to the test samples to better understand the problem.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 0<=≤<=*m*<=≤<=104). The next *m* lines contain the debts. The *i*-th line contains three integers *a**i*,<=*b**i*,<=*c**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*; 1<=≤<=*c**i*<=≤<=100), which mean that person *a**i* owes person *b**i* *c**i* rubles.
Assume that the people are numbered by integers from 1 to *n*.
It is guaranteed that the same pair of people occurs at most once in the input. The input doesn't simultaneously contain pair of people (*x*,<=*y*) and pair of people (*y*,<=*x*).
Output Specification:
Print a single integer — the minimum sum of debts in the optimal rearrangement.
Demo Input:
['5 3\n1 2 10\n2 3 1\n2 4 1\n', '3 0\n', '4 3\n1 2 1\n2 3 1\n3 1 1\n']
Demo Output:
['10\n', '0\n', '0\n']
Note:
In the first sample, you can assume that person number 1 owes 8 rubles to person number 2, 1 ruble to person number 3 and 1 ruble to person number 4. He doesn't owe anybody else anything. In the end, the total debt equals 10.
In the second sample, there are no debts.
In the third sample, you can annul all the debts.
|
```python
from collections import defaultdict
def debt(g):
for i in g.keys():
l = len(g[i])
for k in range(l):
t =g[i][k][1]
u = g[i][k][0]
if u in g.keys():
for j in g[u]:
t -=j[1]
g[i][k][1] = t
return dict(g)
n , m = map(int,input().split())
d = defaultdict(list)
for _ in range(m):
a,b,c = map(int,input().split())
d[a].append([b,c])
a = debt(d)
s = 0
print(a)
for i , j in a.items():
l = len(a[i])
for k in range(l):
s+=j[k][1]
print(s)
```
| 0
|
|
320
|
A
|
Magic Numbers
|
PROGRAMMING
| 900
|
[
"brute force",
"greedy"
] | null | null |
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
|
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
|
Print "YES" if *n* is a magic number or print "NO" if it's not.
|
[
"114114\n",
"1111\n",
"441231\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "114114",
"output": "YES"
},
{
"input": "1111",
"output": "YES"
},
{
"input": "441231",
"output": "NO"
},
{
"input": "1",
"output": "YES"
},
{
"input": "14",
"output": "YES"
},
{
"input": "114",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "414",
"output": "NO"
},
{
"input": "1000000000",
"output": "NO"
},
{
"input": "144144144",
"output": "YES"
},
{
"input": "1444",
"output": "NO"
},
{
"input": "11",
"output": "YES"
},
{
"input": "141414141",
"output": "YES"
},
{
"input": "11110111",
"output": "NO"
},
{
"input": "114114144",
"output": "YES"
},
{
"input": "444",
"output": "NO"
},
{
"input": "9999",
"output": "NO"
},
{
"input": "111444",
"output": "NO"
},
{
"input": "11114",
"output": "YES"
},
{
"input": "41111",
"output": "NO"
},
{
"input": "114414441",
"output": "NO"
},
{
"input": "144414441",
"output": "NO"
},
{
"input": "144244144",
"output": "NO"
},
{
"input": "111111111",
"output": "YES"
},
{
"input": "144444444",
"output": "NO"
},
{
"input": "444444444",
"output": "NO"
},
{
"input": "141441441",
"output": "YES"
},
{
"input": "441",
"output": "NO"
},
{
"input": "15",
"output": "NO"
},
{
"input": "14444",
"output": "NO"
},
{
"input": "11444",
"output": "NO"
},
{
"input": "144",
"output": "YES"
},
{
"input": "1414414",
"output": "YES"
},
{
"input": "141444",
"output": "NO"
},
{
"input": "14144",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "1144",
"output": "YES"
},
{
"input": "141111444",
"output": "NO"
},
{
"input": "14414414",
"output": "YES"
},
{
"input": "141414144",
"output": "YES"
},
{
"input": "1414",
"output": "YES"
},
{
"input": "1441",
"output": "YES"
},
{
"input": "12",
"output": "NO"
},
{
"input": "144144141",
"output": "YES"
},
{
"input": "144144",
"output": "YES"
},
{
"input": "14414411",
"output": "YES"
},
{
"input": "14414",
"output": "YES"
}
] | 1,674,190,027
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 47
| 122
| 0
|
str_num = input()
store = ['1', '14', '141']
temp = ""
found = False
for i, n in enumerate(str_num):
temp += n
if temp == '1':
if i < len(str_num) - 1 and str_num[i + 1] != '4':
temp = ""
elif temp == '14':
if i < len(str_num) - 1 and str_num[i + 1] != '4':
temp = ""
elif temp == '144':
temp = ""
else:
print("NO")
found = True
break
if not found:
print("YES")
|
Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
Input Specification:
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Output Specification:
Print "YES" if *n* is a magic number or print "NO" if it's not.
Demo Input:
['114114\n', '1111\n', '441231\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none
|
```python
str_num = input()
store = ['1', '14', '141']
temp = ""
found = False
for i, n in enumerate(str_num):
temp += n
if temp == '1':
if i < len(str_num) - 1 and str_num[i + 1] != '4':
temp = ""
elif temp == '14':
if i < len(str_num) - 1 and str_num[i + 1] != '4':
temp = ""
elif temp == '144':
temp = ""
else:
print("NO")
found = True
break
if not found:
print("YES")
```
| 3
|
|
467
|
A
|
George and Accommodation
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
|
Print a single integer — the number of rooms where George and Alex can move in.
|
[
"3\n1 1\n2 2\n3 3\n",
"3\n1 10\n0 10\n10 10\n"
] |
[
"0\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3\n1 1\n2 2\n3 3",
"output": "0"
},
{
"input": "3\n1 10\n0 10\n10 10",
"output": "2"
},
{
"input": "2\n36 67\n61 69",
"output": "2"
},
{
"input": "3\n21 71\n10 88\n43 62",
"output": "3"
},
{
"input": "3\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "10\n0 10\n0 20\n0 30\n0 40\n0 50\n0 60\n0 70\n0 80\n0 90\n0 100",
"output": "10"
},
{
"input": "13\n14 16\n30 31\n45 46\n19 20\n15 17\n66 67\n75 76\n95 97\n29 30\n37 38\n0 2\n36 37\n8 9",
"output": "4"
},
{
"input": "19\n66 67\n97 98\n89 91\n67 69\n67 68\n18 20\n72 74\n28 30\n91 92\n27 28\n75 77\n17 18\n74 75\n28 30\n16 18\n90 92\n9 11\n22 24\n52 54",
"output": "12"
},
{
"input": "15\n55 57\n95 97\n57 59\n34 36\n50 52\n96 98\n39 40\n13 15\n13 14\n74 76\n47 48\n56 58\n24 25\n11 13\n67 68",
"output": "10"
},
{
"input": "17\n68 69\n47 48\n30 31\n52 54\n41 43\n33 35\n38 40\n56 58\n45 46\n92 93\n73 74\n61 63\n65 66\n37 39\n67 68\n77 78\n28 30",
"output": "8"
},
{
"input": "14\n64 66\n43 44\n10 12\n76 77\n11 12\n25 27\n87 88\n62 64\n39 41\n58 60\n10 11\n28 29\n57 58\n12 14",
"output": "7"
},
{
"input": "38\n74 76\n52 54\n78 80\n48 49\n40 41\n64 65\n28 30\n6 8\n49 51\n68 70\n44 45\n57 59\n24 25\n46 48\n49 51\n4 6\n63 64\n76 78\n57 59\n18 20\n63 64\n71 73\n88 90\n21 22\n89 90\n65 66\n89 91\n96 98\n42 44\n1 1\n74 76\n72 74\n39 40\n75 76\n29 30\n48 49\n87 89\n27 28",
"output": "22"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "26\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2",
"output": "0"
},
{
"input": "68\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2\n0 2",
"output": "68"
},
{
"input": "7\n0 1\n1 5\n2 4\n3 5\n4 6\n5 6\n6 8",
"output": "5"
},
{
"input": "1\n0 0",
"output": "0"
},
{
"input": "1\n100 100",
"output": "0"
},
{
"input": "44\n0 8\n1 11\n2 19\n3 5\n4 29\n5 45\n6 6\n7 40\n8 19\n9 22\n10 18\n11 26\n12 46\n13 13\n14 27\n15 48\n16 25\n17 20\n18 29\n19 27\n20 45\n21 39\n22 29\n23 39\n24 42\n25 37\n26 52\n27 36\n28 43\n29 35\n30 38\n31 70\n32 47\n33 38\n34 61\n35 71\n36 51\n37 71\n38 59\n39 77\n40 70\n41 80\n42 77\n43 73",
"output": "42"
},
{
"input": "3\n1 3\n2 7\n8 9",
"output": "2"
},
{
"input": "53\n0 1\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 10\n10 11\n11 12\n12 13\n13 14\n14 15\n15 16\n16 17\n17 18\n18 19\n19 20\n20 21\n21 22\n22 23\n23 24\n24 25\n25 26\n26 27\n27 28\n28 29\n29 30\n30 31\n31 32\n32 33\n33 34\n34 35\n35 36\n36 37\n37 38\n38 39\n39 40\n40 41\n41 42\n42 43\n43 44\n44 45\n45 46\n46 47\n47 48\n48 49\n49 50\n50 51\n51 52\n52 53",
"output": "0"
},
{
"input": "55\n0 0\n1 1\n2 2\n3 3\n4 4\n5 5\n6 6\n7 7\n8 8\n9 9\n10 10\n11 11\n12 12\n13 13\n14 14\n15 15\n16 16\n17 17\n18 18\n19 19\n20 20\n21 21\n22 22\n23 23\n24 24\n25 25\n26 26\n27 27\n28 28\n29 29\n30 30\n31 31\n32 32\n33 33\n34 34\n35 35\n36 36\n37 37\n38 38\n39 39\n40 40\n41 41\n42 42\n43 43\n44 44\n45 45\n46 46\n47 47\n48 48\n49 49\n50 50\n51 51\n52 52\n53 53\n54 54",
"output": "0"
},
{
"input": "51\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 62\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 82\n55 68\n55 70\n55 63\n55 55\n55 55\n55 55\n55 75\n55 75\n55 55\n55 55\n55 55\n55 55\n55 55\n55 55\n55 73\n55 55\n55 82\n55 99\n55 60",
"output": "12"
},
{
"input": "14\n1 1\n1 1\n1 55\n1 16\n1 1\n1 1\n1 55\n1 62\n1 53\n1 26\n1 1\n1 36\n1 2\n1 3",
"output": "8"
}
] | 1,693,326,816
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <iostream>
int main() {
int num,ans=0;
std::cin >>num;
int p,r;
std::cin>>p>>r;
for (int i =1;r-p>=2;i++)
ans++;
std::cout<<ans;
return 0;
}
|
Title: George and Accommodation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George has recently entered the BSUCP (Berland State University for Cool Programmers). George has a friend Alex who has also entered the university. Now they are moving into a dormitory.
George and Alex want to live in the same room. The dormitory has *n* rooms in total. At the moment the *i*-th room has *p**i* people living in it and the room can accommodate *q**i* people in total (*p**i*<=≤<=*q**i*). Your task is to count how many rooms has free place for both George and Alex.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of rooms.
The *i*-th of the next *n* lines contains two integers *p**i* and *q**i* (0<=≤<=*p**i*<=≤<=*q**i*<=≤<=100) — the number of people who already live in the *i*-th room and the room's capacity.
Output Specification:
Print a single integer — the number of rooms where George and Alex can move in.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '3\n1 10\n0 10\n10 10\n']
Demo Output:
['0\n', '2\n']
Note:
none
|
```python
#include <iostream>
int main() {
int num,ans=0;
std::cin >>num;
int p,r;
std::cin>>p>>r;
for (int i =1;r-p>=2;i++)
ans++;
std::cout<<ans;
return 0;
}
```
| -1
|
|
43
|
A
|
Football
|
PROGRAMMING
| 1,000
|
[
"strings"
] |
A. Football
|
2
|
256
|
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
|
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
|
[
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] |
[
"ABC\n",
"A\n"
] |
none
| 500
|
[
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,623,660,373
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 92
| 0
|
n = int(input())
d = {}
while n > 0:
s = input()
if s not in d:
d[s] = 0
d[s] += 1
s = ""
mx = 0
ans = ""
for i in d:
if d[i] > mx:
mx = d[i]
ans = i
print(ans)
|
Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none
|
```python
n = int(input())
d = {}
while n > 0:
s = input()
if s not in d:
d[s] = 0
d[s] += 1
s = ""
mx = 0
ans = ""
for i in d:
if d[i] > mx:
mx = d[i]
ans = i
print(ans)
```
| -1
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,548,417,071
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 218
| 0
|
s = input()
lw = 0
up = 0
for i in range(len(s)):
if s[i].isupper():
up += 1
else:
lw += 1
if up <= lw:
print(s.lower())
else:
print(s.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s = input()
lw = 0
up = 0
for i in range(len(s)):
if s[i].isupper():
up += 1
else:
lw += 1
if up <= lw:
print(s.lower())
else:
print(s.upper())
```
| 3.9455
|
237
|
A
|
Free Cash
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
|
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
|
[
"4\n8 0\n8 10\n8 10\n8 45\n",
"3\n0 12\n10 11\n22 22\n"
] |
[
"2\n",
"1\n"
] |
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash.
| 500
|
[
{
"input": "4\n8 0\n8 10\n8 10\n8 45",
"output": "2"
},
{
"input": "3\n0 12\n10 11\n22 22",
"output": "1"
},
{
"input": "5\n12 8\n15 27\n15 27\n16 2\n19 52",
"output": "2"
},
{
"input": "7\n5 6\n7 34\n7 34\n7 34\n12 29\n15 19\n20 23",
"output": "3"
},
{
"input": "8\n0 36\n4 7\n4 7\n4 7\n11 46\n12 4\n15 39\n18 6",
"output": "3"
},
{
"input": "20\n4 12\n4 21\n4 27\n4 56\n5 55\n7 56\n11 28\n11 36\n14 58\n15 59\n16 8\n17 12\n17 23\n17 23\n17 23\n17 23\n17 23\n17 23\n20 50\n22 32",
"output": "6"
},
{
"input": "10\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30",
"output": "10"
},
{
"input": "50\n0 23\n1 21\n2 8\n2 45\n3 1\n4 19\n4 37\n7 7\n7 40\n8 43\n9 51\n10 13\n11 2\n11 19\n11 30\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 54\n13 32\n13 42\n14 29\n14 34\n14 48\n15 0\n15 27\n16 22\n16 31\n17 25\n17 26\n17 33\n18 14\n18 16\n18 20\n19 0\n19 5\n19 56\n20 22\n21 26\n22 0\n22 10\n22 11\n22 36\n23 17\n23 20",
"output": "8"
},
{
"input": "10\n0 39\n1 35\n1 49\n1 51\n5 24\n7 40\n7 56\n16 42\n23 33\n23 49",
"output": "1"
},
{
"input": "15\n0 16\n6 15\n8 2\n8 6\n8 7\n10 1\n10 1\n10 3\n10 12\n13 5\n14 16\n14 16\n14 16\n14 16\n14 16",
"output": "5"
},
{
"input": "2\n0 24\n1 0",
"output": "1"
},
{
"input": "1\n0 0",
"output": "1"
},
{
"input": "1\n1 5",
"output": "1"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "3"
},
{
"input": "1\n5 0",
"output": "1"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "5"
},
{
"input": "1\n10 10",
"output": "1"
},
{
"input": "1\n8 0",
"output": "1"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "10"
},
{
"input": "2\n0 0\n0 1",
"output": "1"
},
{
"input": "2\n8 5\n8 5",
"output": "2"
}
] | 1,593,118,699
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 9
| 2,000
| 10,752,000
|
n = int(input())
L = []
while n > 0:
h, m = list(map(int,input().split()))
L.append((h,m))
n -= 1
L2 = list(set(L))
L3 = []
for i in range (len(L2)):
L3.append(L.count((L2[i][0], L2[i][1])))
print(max(L3))
|
Title: Free Cash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
Output Specification:
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
Demo Input:
['4\n8 0\n8 10\n8 10\n8 45\n', '3\n0 12\n10 11\n22 22\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash.
|
```python
n = int(input())
L = []
while n > 0:
h, m = list(map(int,input().split()))
L.append((h,m))
n -= 1
L2 = list(set(L))
L3 = []
for i in range (len(L2)):
L3.append(L.count((L2[i][0], L2[i][1])))
print(max(L3))
```
| 0
|
|
2
|
A
|
Winner
|
PROGRAMMING
| 1,500
|
[
"hashing",
"implementation"
] |
A. Winner
|
1
|
64
|
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
|
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
|
Print the name of the winner.
|
[
"3\nmike 3\nandrew 5\nmike 2\n",
"3\nandrew 3\nandrew 2\nmike 5\n"
] |
[
"andrew\n",
"andrew\n"
] |
none
| 0
|
[
{
"input": "3\nmike 3\nandrew 5\nmike 2",
"output": "andrew"
},
{
"input": "3\nandrew 3\nandrew 2\nmike 5",
"output": "andrew"
},
{
"input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303",
"output": "kaxqybeultn"
},
{
"input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734",
"output": "ksjuuerbnlklcfdjeyq"
},
{
"input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879",
"output": "fcgslzkicjrpbqaifgweyzreajjfdo"
},
{
"input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735",
"output": "aawtvezfntstrcpgbzjbf"
},
{
"input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158",
"output": "ivhgbxiv"
}
] | 1,616,253,899
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 9
| 186
| 0
|
d = dict()
ans = ''
ans_val = -1
n = int(input())
for i in range(n):
name, score = input().split()
score = int(score)
if name in d:
d[name] += score
else:
d[name] = score
if d[name] > ans_val:
ans = name
ans_val = d[name]
print(ans)
if n == 50:
print(d)
|
Title: Winner
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
Input Specification:
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Output Specification:
Print the name of the winner.
Demo Input:
['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n']
Demo Output:
['andrew\n', 'andrew\n']
Note:
none
|
```python
d = dict()
ans = ''
ans_val = -1
n = int(input())
for i in range(n):
name, score = input().split()
score = int(score)
if name in d:
d[name] += score
else:
d[name] = score
if d[name] > ans_val:
ans = name
ans_val = d[name]
print(ans)
if n == 50:
print(d)
```
| 0
|
869
|
C
|
The Intriguing Obsession
|
PROGRAMMING
| 1,800
|
[
"combinatorics",
"dp",
"math"
] | null | null |
— This is not playing but duty as allies of justice, Nii-chan!
— Not allies but justice itself, Onii-chan!
With hands joined, go everywhere at a speed faster than our thoughts! This time, the Fire Sisters — Karen and Tsukihi — is heading for somewhere they've never reached — water-surrounded islands!
There are three clusters of islands, conveniently coloured red, blue and purple. The clusters consist of *a*, *b* and *c* distinct islands respectively.
Bridges have been built between some (possibly all or none) of the islands. A bridge bidirectionally connects two different islands and has length 1. For any two islands of the same colour, either they shouldn't be reached from each other through bridges, or the shortest distance between them is at least 3, apparently in order to prevent oddities from spreading quickly inside a cluster.
The Fire Sisters are ready for the unknown, but they'd also like to test your courage. And you're here to figure out the number of different ways to build all bridges under the constraints, and give the answer modulo 998<=244<=353. Two ways are considered different if a pair of islands exist, such that there's a bridge between them in one of them, but not in the other.
|
The first and only line of input contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=5<=000) — the number of islands in the red, blue and purple clusters, respectively.
|
Output one line containing an integer — the number of different ways to build bridges, modulo 998<=244<=353.
|
[
"1 1 1\n",
"1 2 2\n",
"1 3 5\n",
"6 2 9\n"
] |
[
"8\n",
"63\n",
"3264\n",
"813023575\n"
] |
In the first example, there are 3 bridges that can possibly be built, and no setup of bridges violates the restrictions. Thus the answer is 2<sup class="upper-index">3</sup> = 8.
In the second example, the upper two structures in the figure below are instances of valid ones, while the lower two are invalid due to the blue and purple clusters, respectively.
| 1,500
|
[
{
"input": "1 1 1",
"output": "8"
},
{
"input": "1 2 2",
"output": "63"
},
{
"input": "1 3 5",
"output": "3264"
},
{
"input": "6 2 9",
"output": "813023575"
},
{
"input": "7 3 7",
"output": "807577560"
},
{
"input": "135 14 39",
"output": "414849507"
},
{
"input": "5000 5000 5000",
"output": "986778560"
},
{
"input": "2 1 1",
"output": "18"
},
{
"input": "1 1 3",
"output": "32"
},
{
"input": "1 2 3",
"output": "156"
},
{
"input": "4 1 2",
"output": "315"
},
{
"input": "5 9 4",
"output": "661093467"
},
{
"input": "4 2 5",
"output": "326151"
},
{
"input": "9 4 10",
"output": "391175867"
},
{
"input": "16 8 29",
"output": "349763770"
},
{
"input": "17 46 45",
"output": "518654435"
},
{
"input": "28 47 1",
"output": "517406193"
},
{
"input": "94 87 10",
"output": "846321893"
},
{
"input": "84 29 61",
"output": "391253501"
},
{
"input": "179 856 377",
"output": "518957210"
},
{
"input": "1925 1009 273",
"output": "207866159"
},
{
"input": "1171 2989 2853",
"output": "234725427"
},
{
"input": "3238 2923 4661",
"output": "636587126"
},
{
"input": "1158 506 4676",
"output": "6109065"
},
{
"input": "4539 2805 2702",
"output": "356944655"
},
{
"input": "4756 775 3187",
"output": "56242066"
},
{
"input": "4998 4998 4998",
"output": "259368717"
},
{
"input": "4996 1 5000",
"output": "196902859"
},
{
"input": "2048 4096 1024",
"output": "445542375"
},
{
"input": "5000 1 1",
"output": "50020002"
}
] | 1,585,230,888
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 6
| 1,000
| 3,174,400
|
def f(a):
M = 998244353
an = 1
for i in range(1, a + 1):
an = ((an % M) * (i % M)) % M
return an
def ncr(n, r):
M = 998244353
t1 = f(n)
t2 = (f(r) % M * f(n - r) % M) % M
return t1 * pow(t2, M - 2, M)
a, b, c = map(int, input().split())
ans = 1
def func(a, b):
global ans
M = 998244353
if a > b: a, b = b, a
count = 0
for i in range(a + 1):
t1 = ncr(a, i) % M
t2 = (f(b) * pow(f(b - i), M - 2, M)) % M
count += ((t1 * t2) % M)
ans = ((ans % M) * (count % M)) % M
func(a, b)
func(b, c)
func(c, a)
print(int(ans))
|
Title: The Intriguing Obsession
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
— This is not playing but duty as allies of justice, Nii-chan!
— Not allies but justice itself, Onii-chan!
With hands joined, go everywhere at a speed faster than our thoughts! This time, the Fire Sisters — Karen and Tsukihi — is heading for somewhere they've never reached — water-surrounded islands!
There are three clusters of islands, conveniently coloured red, blue and purple. The clusters consist of *a*, *b* and *c* distinct islands respectively.
Bridges have been built between some (possibly all or none) of the islands. A bridge bidirectionally connects two different islands and has length 1. For any two islands of the same colour, either they shouldn't be reached from each other through bridges, or the shortest distance between them is at least 3, apparently in order to prevent oddities from spreading quickly inside a cluster.
The Fire Sisters are ready for the unknown, but they'd also like to test your courage. And you're here to figure out the number of different ways to build all bridges under the constraints, and give the answer modulo 998<=244<=353. Two ways are considered different if a pair of islands exist, such that there's a bridge between them in one of them, but not in the other.
Input Specification:
The first and only line of input contains three space-separated integers *a*, *b* and *c* (1<=≤<=*a*,<=*b*,<=*c*<=≤<=5<=000) — the number of islands in the red, blue and purple clusters, respectively.
Output Specification:
Output one line containing an integer — the number of different ways to build bridges, modulo 998<=244<=353.
Demo Input:
['1 1 1\n', '1 2 2\n', '1 3 5\n', '6 2 9\n']
Demo Output:
['8\n', '63\n', '3264\n', '813023575\n']
Note:
In the first example, there are 3 bridges that can possibly be built, and no setup of bridges violates the restrictions. Thus the answer is 2<sup class="upper-index">3</sup> = 8.
In the second example, the upper two structures in the figure below are instances of valid ones, while the lower two are invalid due to the blue and purple clusters, respectively.
|
```python
def f(a):
M = 998244353
an = 1
for i in range(1, a + 1):
an = ((an % M) * (i % M)) % M
return an
def ncr(n, r):
M = 998244353
t1 = f(n)
t2 = (f(r) % M * f(n - r) % M) % M
return t1 * pow(t2, M - 2, M)
a, b, c = map(int, input().split())
ans = 1
def func(a, b):
global ans
M = 998244353
if a > b: a, b = b, a
count = 0
for i in range(a + 1):
t1 = ncr(a, i) % M
t2 = (f(b) * pow(f(b - i), M - 2, M)) % M
count += ((t1 * t2) % M)
ans = ((ans % M) * (count % M)) % M
func(a, b)
func(b, c)
func(c, a)
print(int(ans))
```
| 0
|
|
296
|
A
|
Yaroslav and Permutations
|
PROGRAMMING
| 1,100
|
[
"greedy",
"math"
] | null | null |
Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time.
Help Yaroslav.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000) — the array elements.
|
In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise.
|
[
"1\n1\n",
"3\n1 1 2\n",
"4\n7 7 7 7\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
In the first sample the initial array fits well.
In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it.
In the third sample Yarosav can't get the array he needs.
| 500
|
[
{
"input": "1\n1",
"output": "YES"
},
{
"input": "3\n1 1 2",
"output": "YES"
},
{
"input": "4\n7 7 7 7",
"output": "NO"
},
{
"input": "4\n479 170 465 146",
"output": "YES"
},
{
"input": "5\n996 437 605 996 293",
"output": "YES"
},
{
"input": "6\n727 539 896 668 36 896",
"output": "YES"
},
{
"input": "7\n674 712 674 674 674 674 674",
"output": "NO"
},
{
"input": "8\n742 742 742 742 742 289 742 742",
"output": "NO"
},
{
"input": "9\n730 351 806 806 806 630 85 757 967",
"output": "YES"
},
{
"input": "10\n324 539 83 440 834 640 440 440 440 440",
"output": "YES"
},
{
"input": "7\n925 830 925 98 987 162 356",
"output": "YES"
},
{
"input": "68\n575 32 53 351 151 942 725 967 431 108 192 8 338 458 288 754 384 946 910 210 759 222 589 423 947 507 31 414 169 901 592 763 656 411 360 625 538 549 484 596 42 603 351 292 837 375 21 597 22 349 200 669 485 282 735 54 1000 419 939 901 789 128 468 729 894 649 484 808",
"output": "YES"
},
{
"input": "22\n618 814 515 310 617 936 452 601 250 520 557 799 304 225 9 845 610 990 703 196 486 94",
"output": "YES"
},
{
"input": "44\n459 581 449 449 449 449 449 449 449 623 449 449 449 449 449 449 449 449 889 449 203 273 329 449 449 449 449 449 449 845 882 323 22 449 449 893 449 449 449 449 449 870 449 402",
"output": "NO"
},
{
"input": "90\n424 3 586 183 286 89 427 618 758 833 933 170 155 722 190 977 330 369 693 426 556 435 550 442 513 146 61 719 754 140 424 280 997 688 530 550 438 867 950 194 196 298 417 287 106 489 283 456 735 115 702 317 672 787 264 314 356 186 54 913 809 833 946 314 757 322 559 647 983 482 145 197 223 130 162 536 451 174 467 45 660 293 440 254 25 155 511 746 650 187",
"output": "YES"
},
{
"input": "14\n959 203 478 315 788 788 373 834 488 519 774 764 193 103",
"output": "YES"
},
{
"input": "81\n544 528 528 528 528 4 506 528 32 528 528 528 528 528 528 528 528 975 528 528 528 528 528 528 528 528 528 528 528 528 528 20 528 528 528 528 528 528 528 528 852 528 528 120 528 528 61 11 528 528 528 228 528 165 883 528 488 475 628 528 528 528 528 528 528 597 528 528 528 528 528 528 528 528 528 528 528 412 528 521 925",
"output": "NO"
},
{
"input": "89\n354 356 352 355 355 355 352 354 354 352 355 356 355 352 354 356 354 355 355 354 353 352 352 355 355 356 352 352 353 356 352 353 354 352 355 352 353 353 353 354 353 354 354 353 356 353 353 354 354 354 354 353 352 353 355 356 356 352 356 354 353 352 355 354 356 356 356 354 354 356 354 355 354 355 353 352 354 355 352 355 355 354 356 353 353 352 356 352 353",
"output": "YES"
},
{
"input": "71\n284 284 285 285 285 284 285 284 284 285 284 285 284 284 285 284 285 285 285 285 284 284 285 285 284 284 284 285 284 285 284 285 285 284 284 284 285 284 284 285 285 285 284 284 285 284 285 285 284 285 285 284 285 284 284 284 285 285 284 285 284 285 285 285 285 284 284 285 285 284 285",
"output": "NO"
},
{
"input": "28\n602 216 214 825 814 760 814 28 76 814 814 288 814 814 222 707 11 490 814 543 914 705 814 751 976 814 814 99",
"output": "YES"
},
{
"input": "48\n546 547 914 263 986 945 914 914 509 871 324 914 153 571 914 914 914 528 970 566 544 914 914 914 410 914 914 589 609 222 914 889 691 844 621 68 914 36 914 39 630 749 914 258 945 914 727 26",
"output": "YES"
},
{
"input": "56\n516 76 516 197 516 427 174 516 706 813 94 37 516 815 516 516 937 483 16 516 842 516 638 691 516 635 516 516 453 263 516 516 635 257 125 214 29 81 516 51 362 516 677 516 903 516 949 654 221 924 516 879 516 516 972 516",
"output": "YES"
},
{
"input": "46\n314 723 314 314 314 235 314 314 314 314 270 314 59 972 314 216 816 40 314 314 314 314 314 314 314 381 314 314 314 314 314 314 314 789 314 957 114 942 314 314 29 314 314 72 314 314",
"output": "NO"
},
{
"input": "72\n169 169 169 599 694 81 250 529 865 406 817 169 667 169 965 169 169 663 65 169 903 169 942 763 169 807 169 603 169 169 13 169 169 810 169 291 169 169 169 169 169 169 169 713 169 440 169 169 169 169 169 480 169 169 867 169 169 169 169 169 169 169 169 393 169 169 459 169 99 169 601 800",
"output": "NO"
},
{
"input": "100\n317 316 317 316 317 316 317 316 317 316 316 317 317 316 317 316 316 316 317 316 317 317 316 317 316 316 316 316 316 316 317 316 317 317 317 317 317 317 316 316 316 317 316 317 316 317 316 317 317 316 317 316 317 317 316 317 316 317 316 317 316 316 316 317 317 317 317 317 316 317 317 316 316 316 316 317 317 316 317 316 316 316 316 316 316 317 316 316 317 317 317 317 317 317 317 317 317 316 316 317",
"output": "NO"
},
{
"input": "100\n510 510 510 162 969 32 510 511 510 510 911 183 496 875 903 461 510 510 123 578 510 510 510 510 510 755 510 673 510 510 763 510 510 909 510 435 487 959 807 510 368 788 557 448 284 332 510 949 510 510 777 112 857 926 487 510 510 510 678 510 510 197 829 427 698 704 409 509 510 238 314 851 510 651 510 455 682 510 714 635 973 510 443 878 510 510 510 591 510 24 596 510 43 183 510 510 671 652 214 784",
"output": "YES"
},
{
"input": "100\n476 477 474 476 476 475 473 476 474 475 473 477 476 476 474 476 474 475 476 477 473 473 473 474 474 476 473 473 476 476 475 476 473 474 473 473 477 475 475 475 476 475 477 477 477 476 475 475 475 473 476 477 475 476 477 473 474 477 473 475 476 476 474 477 476 474 473 477 473 475 477 473 476 474 477 473 475 477 473 476 476 475 476 475 474 473 477 473 475 473 477 473 473 474 475 473 477 476 477 474",
"output": "YES"
},
{
"input": "100\n498 498 498 498 498 499 498 499 499 499 498 498 498 498 499 498 499 499 498 499 498 498 498 499 499 499 498 498 499 499 498 498 498 499 498 499 498 498 498 499 498 499 498 498 498 498 499 498 498 499 498 498 499 498 499 499 498 499 499 499 498 498 498 498 499 498 499 498 499 499 499 499 498 498 499 499 498 499 499 498 498 499 499 498 498 499 499 499 498 498 499 498 498 498 499 499 499 498 498 499",
"output": "NO"
},
{
"input": "100\n858 53 816 816 816 816 816 816 816 181 816 816 816 816 579 879 816 948 171 816 816 150 866 816 816 816 897 816 816 816 816 816 816 706 816 539 816 816 816 816 816 816 423 487 816 615 254 816 816 816 816 83 816 816 816 816 816 816 816 816 816 816 816 136 775 999 816 816 816 644 816 816 816 816 927 816 802 816 856 816 816 816 816 816 816 816 816 816 816 700 816 816 816 816 982 477 816 891 806 816",
"output": "NO"
},
{
"input": "100\n167 169 169 167 169 169 167 167 167 167 168 166 170 170 169 170 170 170 169 168 166 167 170 169 167 169 168 169 166 170 166 167 170 166 166 167 169 166 166 169 166 167 168 168 170 167 168 166 168 170 167 168 167 169 169 166 168 167 170 168 167 169 168 169 166 168 168 169 169 166 170 168 167 169 170 168 167 169 168 167 168 168 166 169 170 170 166 166 167 170 167 168 167 167 169 169 166 166 169 167",
"output": "YES"
},
{
"input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "NO"
},
{
"input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "NO"
},
{
"input": "100\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "2\n1 1",
"output": "NO"
},
{
"input": "1\n1000",
"output": "YES"
},
{
"input": "12\n2 2 4 4 4 4 6 6 6 6 6 6",
"output": "YES"
}
] | 1,628,325,275
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 8
| 124
| 6,963,200
|
n = int(input())
g = input()
arr = [int(a) for a in g.split()]
i = 0
f = 1
def swapPositions(list, pos1, pos2):
list[pos1], list[pos2] = list[pos2], list[pos1]
return list
while i < n-1:
q = 0
while len(set([arr[i], arr[i+1]])) == 1:
i += 1
arr = swapPositions(arr, i, i+1)
q += 1
if q == 2:
f = 0
break
continue
else:
i += 1
if f == 0:
break
if f == 0:
print("NO")
else:
print("YES")
|
Title: Yaroslav and Permutations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Yaroslav has an array that consists of *n* integers. In one second Yaroslav can swap two neighboring array elements. Now Yaroslav is wondering if he can obtain an array where any two neighboring elements would be distinct in a finite time.
Help Yaroslav.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in the array. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000) — the array elements.
Output Specification:
In the single line print "YES" (without the quotes) if Yaroslav can obtain the array he needs, and "NO" (without the quotes) otherwise.
Demo Input:
['1\n1\n', '3\n1 1 2\n', '4\n7 7 7 7\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first sample the initial array fits well.
In the second sample Yaroslav can get array: 1, 2, 1. He can swap the last and the second last elements to obtain it.
In the third sample Yarosav can't get the array he needs.
|
```python
n = int(input())
g = input()
arr = [int(a) for a in g.split()]
i = 0
f = 1
def swapPositions(list, pos1, pos2):
list[pos1], list[pos2] = list[pos2], list[pos1]
return list
while i < n-1:
q = 0
while len(set([arr[i], arr[i+1]])) == 1:
i += 1
arr = swapPositions(arr, i, i+1)
q += 1
if q == 2:
f = 0
break
continue
else:
i += 1
if f == 0:
break
if f == 0:
print("NO")
else:
print("YES")
```
| 0
|
|
734
|
A
|
Anton and Danik
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
|
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
|
[
"6\nADAAAA\n",
"7\nDDDAADA\n",
"6\nDADADA\n"
] |
[
"Anton\n",
"Danik\n",
"Friendship\n"
] |
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
| 500
|
[
{
"input": "6\nADAAAA",
"output": "Anton"
},
{
"input": "7\nDDDAADA",
"output": "Danik"
},
{
"input": "6\nDADADA",
"output": "Friendship"
},
{
"input": "10\nDDDDADDADD",
"output": "Danik"
},
{
"input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA",
"output": "Anton"
},
{
"input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD",
"output": "Friendship"
},
{
"input": "1\nA",
"output": "Anton"
},
{
"input": "1\nD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "4\nDADA",
"output": "Friendship"
},
{
"input": "4\nDAAD",
"output": "Friendship"
},
{
"input": "3\nADD",
"output": "Danik"
},
{
"input": "3\nDAD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA",
"output": "Anton"
}
] | 1,698,685,558
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 46
| 102,400
|
n=int(input())
m=input()
a=0
d=0
for i in range(n):
if m[i]=="A":
a+=1
else:
d+=1
if a>d:
print("Anton")
elif a==d:
print("Friendship")
else:
print("Danik")
|
Title: Anton and Danik
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
Output Specification:
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
Demo Input:
['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n']
Demo Output:
['Anton\n', 'Danik\n', 'Friendship\n']
Note:
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship".
|
```python
n=int(input())
m=input()
a=0
d=0
for i in range(n):
if m[i]=="A":
a+=1
else:
d+=1
if a>d:
print("Anton")
elif a==d:
print("Friendship")
else:
print("Danik")
```
| 3
|
|
893
|
A
|
Chess For Three
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Alex, Bob and Carl will soon participate in a team chess tournament. Since they are all in the same team, they have decided to practise really hard before the tournament. But it's a bit difficult for them because chess is a game for two players, not three.
So they play with each other according to following rules:
- Alex and Bob play the first game, and Carl is spectating; - When the game ends, the one who lost the game becomes the spectator in the next game, and the one who was spectating plays against the winner.
Alex, Bob and Carl play in such a way that there are no draws.
Today they have played *n* games, and for each of these games they remember who was the winner. They decided to make up a log of games describing who won each game. But now they doubt if the information in the log is correct, and they want to know if the situation described in the log they made up was possible (that is, no game is won by someone who is spectating if Alex, Bob and Carl play according to the rules). Help them to check it!
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of games Alex, Bob and Carl played.
Then *n* lines follow, describing the game log. *i*-th line contains one integer *a**i* (1<=≤<=*a**i*<=≤<=3) which is equal to 1 if Alex won *i*-th game, to 2 if Bob won *i*-th game and 3 if Carl won *i*-th game.
|
Print YES if the situation described in the log was possible. Otherwise print NO.
|
[
"3\n1\n1\n2\n",
"2\n1\n2\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example the possible situation is:
1. Alex wins, Carl starts playing instead of Bob; 1. Alex wins, Bob replaces Carl; 1. Bob wins.
The situation in the second example is impossible because Bob loses the first game, so he cannot win the second one.
| 0
|
[
{
"input": "3\n1\n1\n2",
"output": "YES"
},
{
"input": "2\n1\n2",
"output": "NO"
},
{
"input": "100\n2\n3\n1\n2\n3\n3\n3\n1\n1\n1\n1\n3\n3\n3\n3\n1\n2\n3\n3\n3\n3\n3\n3\n3\n1\n2\n2\n2\n3\n1\n1\n3\n3\n3\n3\n3\n3\n3\n3\n1\n2\n3\n3\n3\n1\n1\n1\n1\n3\n3\n3\n3\n1\n2\n3\n1\n2\n2\n2\n3\n3\n2\n1\n3\n3\n1\n2\n3\n1\n1\n1\n2\n2\n2\n3\n1\n1\n1\n1\n1\n1\n3\n2\n2\n2\n2\n2\n2\n3\n1\n2\n2\n2\n2\n2\n3\n3\n2\n1\n1",
"output": "YES"
},
{
"input": "99\n1\n3\n2\n2\n3\n1\n1\n3\n3\n3\n3\n3\n3\n1\n1\n3\n3\n3\n3\n1\n1\n3\n2\n1\n1\n1\n1\n1\n1\n1\n3\n2\n2\n2\n1\n3\n3\n1\n1\n3\n2\n1\n3\n3\n1\n2\n3\n3\n3\n1\n2\n2\n2\n3\n3\n3\n3\n3\n3\n2\n2\n2\n2\n3\n3\n3\n1\n1\n3\n2\n1\n1\n2\n2\n2\n3\n3\n2\n1\n1\n2\n2\n1\n3\n2\n1\n1\n2\n3\n3\n3\n3\n2\n2\n2\n2\n2\n1\n3",
"output": "YES"
},
{
"input": "100\n2\n2\n1\n3\n1\n3\n3\n1\n1\n3\n1\n1\n3\n2\n1\n3\n1\n1\n3\n3\n2\n2\n3\n1\n1\n2\n3\n2\n2\n3\n1\n1\n2\n3\n2\n1\n2\n2\n3\n3\n1\n1\n3\n1\n2\n1\n3\n1\n1\n3\n2\n2\n2\n1\n1\n1\n3\n1\n3\n2\n1\n2\n2\n2\n3\n3\n2\n1\n1\n3\n3\n2\n1\n2\n1\n1\n3\n1\n2\n3\n2\n3\n3\n3\n2\n2\n1\n3\n1\n2\n3\n1\n2\n3\n3\n1\n2\n1\n3\n1",
"output": "NO"
},
{
"input": "10\n2\n3\n3\n3\n3\n2\n2\n2\n3\n2",
"output": "NO"
},
{
"input": "100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "YES"
},
{
"input": "1\n3",
"output": "NO"
},
{
"input": "1\n2",
"output": "YES"
},
{
"input": "42\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "YES"
},
{
"input": "4\n2\n3\n3\n3",
"output": "YES"
},
{
"input": "3\n1\n2\n3",
"output": "NO"
},
{
"input": "5\n1\n1\n1\n1\n3",
"output": "NO"
},
{
"input": "5\n2\n3\n3\n3\n3",
"output": "YES"
},
{
"input": "2\n3\n3",
"output": "NO"
},
{
"input": "4\n1\n2\n2\n1",
"output": "NO"
},
{
"input": "3\n2\n2\n3",
"output": "NO"
},
{
"input": "5\n2\n3\n3\n1\n1",
"output": "NO"
},
{
"input": "3\n3\n1\n3",
"output": "NO"
},
{
"input": "3\n3\n3\n1",
"output": "NO"
},
{
"input": "2\n2\n1",
"output": "NO"
},
{
"input": "3\n1\n1\n3",
"output": "NO"
},
{
"input": "6\n2\n2\n2\n3\n1\n3",
"output": "NO"
},
{
"input": "2\n3\n1",
"output": "NO"
},
{
"input": "2\n3\n2",
"output": "NO"
},
{
"input": "2\n1\n3",
"output": "YES"
},
{
"input": "3\n1\n3\n1",
"output": "NO"
},
{
"input": "5\n1\n1\n2\n2\n3",
"output": "NO"
},
{
"input": "3\n2\n1\n1",
"output": "NO"
},
{
"input": "2\n2\n2",
"output": "YES"
},
{
"input": "3\n2\n2\n1",
"output": "YES"
},
{
"input": "5\n2\n2\n2\n2\n2",
"output": "YES"
},
{
"input": "8\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "YES"
},
{
"input": "3\n3\n2\n2",
"output": "NO"
},
{
"input": "3\n3\n2\n3",
"output": "NO"
},
{
"input": "7\n2\n2\n2\n2\n2\n2\n2",
"output": "YES"
},
{
"input": "3\n2\n2\n2",
"output": "YES"
}
] | 1,669,745,216
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 0
|
xf,yf=map(int,input().split())
xe,ye=map(int,input().split())
print(max(abs(xf-xe),abs(yf-ye)))
|
Title: Chess For Three
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alex, Bob and Carl will soon participate in a team chess tournament. Since they are all in the same team, they have decided to practise really hard before the tournament. But it's a bit difficult for them because chess is a game for two players, not three.
So they play with each other according to following rules:
- Alex and Bob play the first game, and Carl is spectating; - When the game ends, the one who lost the game becomes the spectator in the next game, and the one who was spectating plays against the winner.
Alex, Bob and Carl play in such a way that there are no draws.
Today they have played *n* games, and for each of these games they remember who was the winner. They decided to make up a log of games describing who won each game. But now they doubt if the information in the log is correct, and they want to know if the situation described in the log they made up was possible (that is, no game is won by someone who is spectating if Alex, Bob and Carl play according to the rules). Help them to check it!
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of games Alex, Bob and Carl played.
Then *n* lines follow, describing the game log. *i*-th line contains one integer *a**i* (1<=≤<=*a**i*<=≤<=3) which is equal to 1 if Alex won *i*-th game, to 2 if Bob won *i*-th game and 3 if Carl won *i*-th game.
Output Specification:
Print YES if the situation described in the log was possible. Otherwise print NO.
Demo Input:
['3\n1\n1\n2\n', '2\n1\n2\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example the possible situation is:
1. Alex wins, Carl starts playing instead of Bob; 1. Alex wins, Bob replaces Carl; 1. Bob wins.
The situation in the second example is impossible because Bob loses the first game, so he cannot win the second one.
|
```python
xf,yf=map(int,input().split())
xe,ye=map(int,input().split())
print(max(abs(xf-xe),abs(yf-ye)))
```
| -1
|
|
735
|
A
|
Ostap and Grasshopper
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
On the way to Rio de Janeiro Ostap kills time playing with a grasshopper he took with him in a special box. Ostap builds a line of length *n* such that some cells of this line are empty and some contain obstacles. Then, he places his grasshopper to one of the empty cells and a small insect in another empty cell. The grasshopper wants to eat the insect.
Ostap knows that grasshopper is able to jump to any empty cell that is exactly *k* cells away from the current (to the left or to the right). Note that it doesn't matter whether intermediate cells are empty or not as the grasshopper makes a jump over them. For example, if *k*<==<=1 the grasshopper can jump to a neighboring cell only, and if *k*<==<=2 the grasshopper can jump over a single cell.
Your goal is to determine whether there is a sequence of jumps such that grasshopper will get from his initial position to the cell with an insect.
|
The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1) — the number of cells in the line and the length of one grasshopper's jump.
The second line contains a string of length *n* consisting of characters '.', '#', 'G' and 'T'. Character '.' means that the corresponding cell is empty, character '#' means that the corresponding cell contains an obstacle and grasshopper can't jump there. Character 'G' means that the grasshopper starts at this position and, finally, 'T' means that the target insect is located at this cell. It's guaranteed that characters 'G' and 'T' appear in this line exactly once.
|
If there exists a sequence of jumps (each jump of length *k*), such that the grasshopper can get from his initial position to the cell with the insect, print "YES" (without quotes) in the only line of the input. Otherwise, print "NO" (without quotes).
|
[
"5 2\n#G#T#\n",
"6 1\nT....G\n",
"7 3\nT..#..G\n",
"6 2\n..GT..\n"
] |
[
"YES\n",
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample, the grasshopper can make one jump to the right in order to get from cell 2 to cell 4.
In the second sample, the grasshopper is only able to jump to neighboring cells but the way to the insect is free — he can get there by jumping left 5 times.
In the third sample, the grasshopper can't make a single jump.
In the fourth sample, the grasshopper can only jump to the cells with odd indices, thus he won't be able to reach the insect.
| 500
|
[
{
"input": "5 2\n#G#T#",
"output": "YES"
},
{
"input": "6 1\nT....G",
"output": "YES"
},
{
"input": "7 3\nT..#..G",
"output": "NO"
},
{
"input": "6 2\n..GT..",
"output": "NO"
},
{
"input": "2 1\nGT",
"output": "YES"
},
{
"input": "100 5\nG####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####.####T####",
"output": "YES"
},
{
"input": "100 5\nG####.####.####.####.####.####.####.####.####.####.####.####.####.#########.####.####.####.####T####",
"output": "NO"
},
{
"input": "2 1\nTG",
"output": "YES"
},
{
"input": "99 1\n...T.............................................................................................G.",
"output": "YES"
},
{
"input": "100 2\nG............#.....#...........#....#...........##............#............#......................T.",
"output": "NO"
},
{
"input": "100 1\n#.#.#.##..#..##.#....##.##.##.#....####..##.#.##..GT..##...###.#.##.#..#..##.###..#.####..#.#.##..##",
"output": "YES"
},
{
"input": "100 2\n..#####.#.#.......#.#.#...##..####..###..#.#######GT####.#.#...##...##.#..###....##.#.#..#.###....#.",
"output": "NO"
},
{
"input": "100 3\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 3\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 3\nG..................................#......#......#.......#.#..........#........#......#..........#.T",
"output": "NO"
},
{
"input": "100 3\nG..............#..........#...#..............#.#.....................#......#........#.........#...T",
"output": "NO"
},
{
"input": "100 3\nG##################################################################################################T",
"output": "NO"
},
{
"input": "100 33\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 33\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 33\nG.........#........#..........#..............#.................#............................#.#....T",
"output": "YES"
},
{
"input": "100 33\nG.......#..................#..............................#............................#..........T.",
"output": "NO"
},
{
"input": "100 33\nG#..........##...#.#.....................#.#.#.........##..#...........#....#...........##...#..###T",
"output": "YES"
},
{
"input": "100 33\nG..#.#..#..####......#......##...##...#.##........#...#...#.##....###..#...###..##.#.....#......#.T.",
"output": "NO"
},
{
"input": "100 33\nG#....#..#..##.##..#.##.#......#.#.##..##.#.#.##.##....#.#.....####..##...#....##..##..........#...T",
"output": "NO"
},
{
"input": "100 33\nG#######.#..##.##.#...#..#.###.#.##.##.#..#.###..####.##.#.##....####...##..####.#..##.##.##.#....#T",
"output": "NO"
},
{
"input": "100 33\nG#####.#.##.###########.##..##..#######..########..###.###..#.####.######.############..####..#####T",
"output": "NO"
},
{
"input": "100 99\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 99\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 99\nT.#...............................#............#..............................##...................G",
"output": "YES"
},
{
"input": "100 99\nT..#....#.##...##########.#.#.#.#...####..#.....#..##..#######.######..#.....###..###...#.......#.#G",
"output": "YES"
},
{
"input": "100 99\nG##################################################################################################T",
"output": "YES"
},
{
"input": "100 9\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 9\nT.................................................................................................G.",
"output": "NO"
},
{
"input": "100 9\nT................................................................................................G..",
"output": "NO"
},
{
"input": "100 1\nG..................................................................................................T",
"output": "YES"
},
{
"input": "100 1\nT..................................................................................................G",
"output": "YES"
},
{
"input": "100 1\n##########G.........T###############################################################################",
"output": "YES"
},
{
"input": "100 1\n#################################################################################################G.T",
"output": "YES"
},
{
"input": "100 17\n##########G################.################.################.################T#####################",
"output": "YES"
},
{
"input": "100 17\n####.#..#.G######.#########.##..##########.#.################.################T######.####.#########",
"output": "YES"
},
{
"input": "100 17\n.########.G##.####.#.######.###############..#.###########.##.#####.##.#####.#T.###..###.########.##",
"output": "YES"
},
{
"input": "100 1\nG.............................................#....................................................T",
"output": "NO"
},
{
"input": "100 1\nT.#................................................................................................G",
"output": "NO"
},
{
"input": "100 1\n##########G....#....T###############################################################################",
"output": "NO"
},
{
"input": "100 1\n#################################################################################################G#T",
"output": "NO"
},
{
"input": "100 17\nG################.#################################.################T###############################",
"output": "NO"
},
{
"input": "100 17\nG################.###############..###.######.#######.###.#######.##T######################.###.####",
"output": "NO"
},
{
"input": "100 17\nG####.##.##.#####.####....##.####.#########.##.#..#.###############.T############.#########.#.####.#",
"output": "NO"
},
{
"input": "48 1\nT..............................................G",
"output": "YES"
},
{
"input": "23 1\nT.....................G",
"output": "YES"
},
{
"input": "49 1\nG...............................................T",
"output": "YES"
},
{
"input": "3 1\nTG#",
"output": "YES"
},
{
"input": "6 2\n..TG..",
"output": "NO"
},
{
"input": "14 3\n...G.....#..T.",
"output": "NO"
},
{
"input": "5 4\n##GT#",
"output": "NO"
},
{
"input": "6 2\nT#..G.",
"output": "YES"
},
{
"input": "5 2\nT.G.#",
"output": "YES"
},
{
"input": "6 1\nT...G#",
"output": "YES"
},
{
"input": "5 1\nTG###",
"output": "YES"
},
{
"input": "5 4\n.G..T",
"output": "NO"
},
{
"input": "7 2\nT#...#G",
"output": "YES"
},
{
"input": "7 1\n##TG###",
"output": "YES"
},
{
"input": "7 1\n###GT##",
"output": "YES"
},
{
"input": "5 2\nG..T.",
"output": "NO"
},
{
"input": "5 1\nG.T##",
"output": "YES"
},
{
"input": "6 2\nG.T###",
"output": "YES"
},
{
"input": "6 2\nG#T###",
"output": "YES"
},
{
"input": "10 2\n####T..G..",
"output": "NO"
},
{
"input": "3 1\nGT#",
"output": "YES"
},
{
"input": "4 1\nTG##",
"output": "YES"
},
{
"input": "6 1\n.G..T.",
"output": "YES"
},
{
"input": "10 3\n......G..T",
"output": "YES"
},
{
"input": "3 2\nG.T",
"output": "YES"
},
{
"input": "4 1\n#G.T",
"output": "YES"
},
{
"input": "5 2\nT#G##",
"output": "YES"
},
{
"input": "4 2\nG#.T",
"output": "NO"
},
{
"input": "4 1\nGT##",
"output": "YES"
}
] | 1,480,949,104
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 0
|
n, k = map(int, input().split())
s = input()
print('NO' if l % k or '#' in s[0:(len(s)-1):k] else 'YES')
|
Title: Ostap and Grasshopper
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On the way to Rio de Janeiro Ostap kills time playing with a grasshopper he took with him in a special box. Ostap builds a line of length *n* such that some cells of this line are empty and some contain obstacles. Then, he places his grasshopper to one of the empty cells and a small insect in another empty cell. The grasshopper wants to eat the insect.
Ostap knows that grasshopper is able to jump to any empty cell that is exactly *k* cells away from the current (to the left or to the right). Note that it doesn't matter whether intermediate cells are empty or not as the grasshopper makes a jump over them. For example, if *k*<==<=1 the grasshopper can jump to a neighboring cell only, and if *k*<==<=2 the grasshopper can jump over a single cell.
Your goal is to determine whether there is a sequence of jumps such that grasshopper will get from his initial position to the cell with an insect.
Input Specification:
The first line of the input contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1) — the number of cells in the line and the length of one grasshopper's jump.
The second line contains a string of length *n* consisting of characters '.', '#', 'G' and 'T'. Character '.' means that the corresponding cell is empty, character '#' means that the corresponding cell contains an obstacle and grasshopper can't jump there. Character 'G' means that the grasshopper starts at this position and, finally, 'T' means that the target insect is located at this cell. It's guaranteed that characters 'G' and 'T' appear in this line exactly once.
Output Specification:
If there exists a sequence of jumps (each jump of length *k*), such that the grasshopper can get from his initial position to the cell with the insect, print "YES" (without quotes) in the only line of the input. Otherwise, print "NO" (without quotes).
Demo Input:
['5 2\n#G#T#\n', '6 1\nT....G\n', '7 3\nT..#..G\n', '6 2\n..GT..\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n', 'NO\n']
Note:
In the first sample, the grasshopper can make one jump to the right in order to get from cell 2 to cell 4.
In the second sample, the grasshopper is only able to jump to neighboring cells but the way to the insect is free — he can get there by jumping left 5 times.
In the third sample, the grasshopper can't make a single jump.
In the fourth sample, the grasshopper can only jump to the cells with odd indices, thus he won't be able to reach the insect.
|
```python
n, k = map(int, input().split())
s = input()
print('NO' if l % k or '#' in s[0:(len(s)-1):k] else 'YES')
```
| -1
|
|
443
|
A
|
Anton and Letters
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation"
] | null | null |
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
|
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
|
Print a single number — the number of distinct letters in Anton's set.
|
[
"{a, b, c}\n",
"{b, a, b, a}\n",
"{}\n"
] |
[
"3\n",
"2\n",
"0\n"
] |
none
| 500
|
[
{
"input": "{a, b, c}",
"output": "3"
},
{
"input": "{b, a, b, a}",
"output": "2"
},
{
"input": "{}",
"output": "0"
},
{
"input": "{a, a, c, b, b, b, c, c, c, c}",
"output": "3"
},
{
"input": "{a, c, b, b}",
"output": "3"
},
{
"input": "{a, b}",
"output": "2"
},
{
"input": "{a}",
"output": "1"
},
{
"input": "{b, a, b, a, b, c, c, b, c, b}",
"output": "3"
},
{
"input": "{e, g, c, e}",
"output": "3"
},
{
"input": "{a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a}",
"output": "1"
},
{
"input": "{a, a, b}",
"output": "2"
},
{
"input": "{a, b, b, b, a, b, a, a, a, a, a, a, b, a, b, a, a, a, a, a, b, a, b, a}",
"output": "2"
},
{
"input": "{j, u, a, c, f, w, e, w, x, t, h, p, v, n, i, l, x, n, i, b, u, c, a, a}",
"output": "16"
},
{
"input": "{x, i, w, c, p, e, h, z, k, i}",
"output": "9"
},
{
"input": "{t, k, o, x, r, d, q, j, k, e, z, w, y, r, z, s, s, e, s, b, k, i}",
"output": "15"
},
{
"input": "{y}",
"output": "1"
},
{
"input": "{x}",
"output": "1"
},
{
"input": "{b, z, a, z}",
"output": "3"
},
{
"input": "{z}",
"output": "1"
},
{
"input": "{a, z}",
"output": "2"
},
{
"input": "{a, b, z}",
"output": "3"
},
{
"input": "{s, q, z, r, t, a, b, h, j, i, o, z, r, q}",
"output": "11"
}
] | 1,692,158,586
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 27
| 109
| 0
|
a = input()
if a=='{}':
print(0)
else:
print(abs(len(set(a))-4))
|
Title: Anton and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
Input Specification:
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
Output Specification:
Print a single number — the number of distinct letters in Anton's set.
Demo Input:
['{a, b, c}\n', '{b, a, b, a}\n', '{}\n']
Demo Output:
['3\n', '2\n', '0\n']
Note:
none
|
```python
a = input()
if a=='{}':
print(0)
else:
print(abs(len(set(a))-4))
```
| 3
|
|
417
|
C
|
Football
|
PROGRAMMING
| 1,400
|
[
"constructive algorithms",
"graphs",
"implementation"
] | null | null |
One day, at the "Russian Code Cup" event it was decided to play football as an out of competition event. All participants was divided into *n* teams and played several matches, two teams could not play against each other more than once.
The appointed Judge was the most experienced member — Pavel. But since he was the wisest of all, he soon got bored of the game and fell asleep. Waking up, he discovered that the tournament is over and the teams want to know the results of all the matches.
Pavel didn't want anyone to discover about him sleeping and not keeping an eye on the results, so he decided to recover the results of all games. To do this, he asked all the teams and learned that the real winner was friendship, that is, each team beat the other teams exactly *k* times. Help Pavel come up with chronology of the tournir that meets all the conditions, or otherwise report that there is no such table.
|
The first line contains two integers — *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1000).
|
In the first line print an integer *m* — number of the played games. The following *m* lines should contain the information about all the matches, one match per line. The *i*-th line should contain two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*). The numbers *a**i* and *b**i* mean, that in the *i*-th match the team with number *a**i* won against the team with number *b**i*. You can assume, that the teams are numbered from 1 to *n*.
If a tournir that meets the conditions of the problem does not exist, then print -1.
|
[
"3 1\n"
] |
[
"3\n1 2\n2 3\n3 1\n"
] |
none
| 1,500
|
[
{
"input": "3 1",
"output": "3\n1 2\n2 3\n3 1"
},
{
"input": "7 3",
"output": "21\n1 2\n1 3\n1 4\n2 3\n2 4\n2 5\n3 4\n3 5\n3 6\n4 5\n4 6\n4 7\n5 6\n5 7\n5 1\n6 7\n6 1\n6 2\n7 1\n7 2\n7 3"
},
{
"input": "4 1",
"output": "4\n1 2\n2 3\n3 4\n4 1"
},
{
"input": "5 2",
"output": "10\n1 2\n1 3\n2 3\n2 4\n3 4\n3 5\n4 5\n4 1\n5 1\n5 2"
},
{
"input": "5 2",
"output": "10\n1 2\n1 3\n2 3\n2 4\n3 4\n3 5\n4 5\n4 1\n5 1\n5 2"
},
{
"input": "11 6",
"output": "-1"
},
{
"input": "11 5",
"output": "55\n1 2\n1 3\n1 4\n1 5\n1 6\n2 3\n2 4\n2 5\n2 6\n2 7\n3 4\n3 5\n3 6\n3 7\n3 8\n4 5\n4 6\n4 7\n4 8\n4 9\n5 6\n5 7\n5 8\n5 9\n5 10\n6 7\n6 8\n6 9\n6 10\n6 11\n7 8\n7 9\n7 10\n7 11\n7 1\n8 9\n8 10\n8 11\n8 1\n8 2\n9 10\n9 11\n9 1\n9 2\n9 3\n10 11\n10 1\n10 2\n10 3\n10 4\n11 1\n11 2\n11 3\n11 4\n11 5"
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "2 1",
"output": "-1"
},
{
"input": "3 1",
"output": "3\n1 2\n2 3\n3 1"
},
{
"input": "1 2",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "3 2",
"output": "-1"
},
{
"input": "531 265",
"output": "140715\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "775 388",
"output": "-1"
},
{
"input": "648 581",
"output": "-1"
},
{
"input": "57 13",
"output": "741\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n3 4\n3 5\n3 6\n3 7\n3 8\n3 9\n3 10\n3 11\n3 12\n3 13\n3 14\n3 15\n3 16\n4 5\n4 6\n4 7\n4 8\n4 9\n4 10\n4 11\n4 12\n4 13\n4 14\n4 15\n4 16\n4 17\n5 6\n5 7\n5 8\n5 9\n5 10\n5 11\n5 12\n5 13\n5 14\n5 15\n5 16\n5 17\n5 18\n6 7\n6 8\n6 9\n6 10\n6 11\n6 12\n6 13\n6 14\n6 15\n6 16\n6 17\n6 18\n6 19\n7 8\n7 9\n7 10\n7 11\n7 12\n7 13\n7 14\n7 15\n7 16\n7 17\n7 18\n7 19\n7..."
},
{
"input": "131 65",
"output": "8515\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24..."
},
{
"input": "609 305",
"output": "-1"
},
{
"input": "197 182",
"output": "-1"
},
{
"input": "248 54",
"output": "13392\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31\n2 32\n2 33\n2 34\n2 3..."
},
{
"input": "137 68",
"output": "9316\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21..."
},
{
"input": "47 24",
"output": "-1"
},
{
"input": "947 868",
"output": "-1"
},
{
"input": "205 50",
"output": "10250\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31\n2 32\n2 33\n2 34\n2 35\n2 36\n2 37\n2 38\n2 3..."
},
{
"input": "863 431",
"output": "371953\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "445 223",
"output": "-1"
},
{
"input": "786 393",
"output": "-1"
},
{
"input": "122 52",
"output": "6344\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31\n2 32\n2 33\n2 34\n2 35\n2 36\n2 37..."
},
{
"input": "629 314",
"output": "197506\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "571 286",
"output": "-1"
},
{
"input": "980 680",
"output": "-1"
},
{
"input": "869 239",
"output": "207691\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "999 499",
"output": "498501\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "999 500",
"output": "-1"
},
{
"input": "1000 751",
"output": "-1"
},
{
"input": "1000 162",
"output": "162000\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "1000 936",
"output": "-1"
},
{
"input": "1000 178",
"output": "178000\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "1000 499",
"output": "499000\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "999 499",
"output": "498501\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "2 1",
"output": "-1"
},
{
"input": "4 2",
"output": "-1"
},
{
"input": "6 3",
"output": "-1"
},
{
"input": "10 5",
"output": "-1"
},
{
"input": "999 2",
"output": "1998\n1 2\n1 3\n2 3\n2 4\n3 4\n3 5\n4 5\n4 6\n5 6\n5 7\n6 7\n6 8\n7 8\n7 9\n8 9\n8 10\n9 10\n9 11\n10 11\n10 12\n11 12\n11 13\n12 13\n12 14\n13 14\n13 15\n14 15\n14 16\n15 16\n15 17\n16 17\n16 18\n17 18\n17 19\n18 19\n18 20\n19 20\n19 21\n20 21\n20 22\n21 22\n21 23\n22 23\n22 24\n23 24\n23 25\n24 25\n24 26\n25 26\n25 27\n26 27\n26 28\n27 28\n27 29\n28 29\n28 30\n29 30\n29 31\n30 31\n30 32\n31 32\n31 33\n32 33\n32 34\n33 34\n33 35\n34 35\n34 36\n35 36\n35 37\n36 37\n36 38\n37 38\n37 39\n38 39\n38 40\n39 40\n..."
},
{
"input": "1000 490",
"output": "490000\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1..."
}
] | 1,398,698,409
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 25
| 1,000
| 22,937,600
|
def commandScore(i, j, n):
if (i+j) > n:
return(i, (i+j)-n)
else:
return(i, i+j)
n, k = list(map(int, input().split()))
res = []
if k*2 >= n:
print(-1)
else:
print(n*k)
res = [commandScore(x, y, n) for x in range(1, n+1) for y in range(1, k+1)]
for item in res:
print(item[0], item[1])
|
Title: Football
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day, at the "Russian Code Cup" event it was decided to play football as an out of competition event. All participants was divided into *n* teams and played several matches, two teams could not play against each other more than once.
The appointed Judge was the most experienced member — Pavel. But since he was the wisest of all, he soon got bored of the game and fell asleep. Waking up, he discovered that the tournament is over and the teams want to know the results of all the matches.
Pavel didn't want anyone to discover about him sleeping and not keeping an eye on the results, so he decided to recover the results of all games. To do this, he asked all the teams and learned that the real winner was friendship, that is, each team beat the other teams exactly *k* times. Help Pavel come up with chronology of the tournir that meets all the conditions, or otherwise report that there is no such table.
Input Specification:
The first line contains two integers — *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=1000).
Output Specification:
In the first line print an integer *m* — number of the played games. The following *m* lines should contain the information about all the matches, one match per line. The *i*-th line should contain two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*; *a**i*<=≠<=*b**i*). The numbers *a**i* and *b**i* mean, that in the *i*-th match the team with number *a**i* won against the team with number *b**i*. You can assume, that the teams are numbered from 1 to *n*.
If a tournir that meets the conditions of the problem does not exist, then print -1.
Demo Input:
['3 1\n']
Demo Output:
['3\n1 2\n2 3\n3 1\n']
Note:
none
|
```python
def commandScore(i, j, n):
if (i+j) > n:
return(i, (i+j)-n)
else:
return(i, i+j)
n, k = list(map(int, input().split()))
res = []
if k*2 >= n:
print(-1)
else:
print(n*k)
res = [commandScore(x, y, n) for x in range(1, n+1) for y in range(1, k+1)]
for item in res:
print(item[0], item[1])
```
| 0
|
|
255
|
A
|
Greg's Workout
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
|
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
|
[
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] |
[
"biceps\n",
"back\n",
"chest\n"
] |
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
| 500
|
[
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,655,064,780
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 61
| 92
| 0
|
u = int(input())
u2 = input()
u2 = u2.split(" ")
ch = 0
ba = 0
bi = 0
for i in range(0,u,3):
ch += int(u2[i])
for i in range(1,u,3):
bi += int(u2[i])
for i in range(2,u,3):
ba += int(u2[i])
if (ch >= ba and ch > bi) or (ch >= bi and ch > ba) :
print('chest')
elif (ba >= ch and ba > bi) or (ba >= bi and ba > ch):
print('back')
else:
print('biceps')
|
Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise.
|
```python
u = int(input())
u2 = input()
u2 = u2.split(" ")
ch = 0
ba = 0
bi = 0
for i in range(0,u,3):
ch += int(u2[i])
for i in range(1,u,3):
bi += int(u2[i])
for i in range(2,u,3):
ba += int(u2[i])
if (ch >= ba and ch > bi) or (ch >= bi and ch > ba) :
print('chest')
elif (ba >= ch and ba > bi) or (ba >= bi and ba > ch):
print('back')
else:
print('biceps')
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
It is a balmy spring afternoon, and Farmer John's *n* cows are ruminating about link-cut cacti in their stalls. The cows, labeled 1 through *n*, are arranged so that the *i*-th cow occupies the *i*-th stall from the left. However, Elsie, after realizing that she will forever live in the shadows beyond Bessie's limelight, has formed the Mischievous Mess Makers and is plotting to disrupt this beautiful pastoral rhythm. While Farmer John takes his *k* minute long nap, Elsie and the Mess Makers plan to repeatedly choose two distinct stalls and swap the cows occupying those stalls, making no more than one swap each minute.
Being the meticulous pranksters that they are, the Mischievous Mess Makers would like to know the maximum messiness attainable in the *k* minutes that they have. We denote as *p**i* the label of the cow in the *i*-th stall. The messiness of an arrangement of cows is defined as the number of pairs (*i*,<=*j*) such that *i*<=<<=*j* and *p**i*<=><=*p**j*.
|
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100<=000) — the number of cows and the length of Farmer John's nap, respectively.
|
Output a single integer, the maximum messiness that the Mischievous Mess Makers can achieve by performing no more than *k* swaps.
|
[
"5 2\n",
"1 10\n"
] |
[
"10\n",
"0\n"
] |
In the first sample, the Mischievous Mess Makers can swap the cows in the stalls 1 and 5 during the first minute, then the cows in stalls 2 and 4 during the second minute. This reverses the arrangement of cows, giving us a total messiness of 10.
In the second sample, there is only one cow, so the maximum possible messiness is 0.
| 0
|
[
{
"input": "5 2",
"output": "10"
},
{
"input": "1 10",
"output": "0"
},
{
"input": "100000 2",
"output": "399990"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "8 3",
"output": "27"
},
{
"input": "7 1",
"output": "11"
},
{
"input": "100000 40000",
"output": "4799960000"
},
{
"input": "1 1000",
"output": "0"
},
{
"input": "100 45",
"output": "4905"
},
{
"input": "9 2",
"output": "26"
},
{
"input": "456 78",
"output": "58890"
},
{
"input": "100000 50000",
"output": "4999950000"
},
{
"input": "100000 50001",
"output": "4999950000"
},
{
"input": "100000 50002",
"output": "4999950000"
},
{
"input": "100000 50003",
"output": "4999950000"
},
{
"input": "100000 49998",
"output": "4999949994"
},
{
"input": "100000 49997",
"output": "4999949985"
},
{
"input": "99999 49998",
"output": "4999849998"
},
{
"input": "99999 49997",
"output": "4999849991"
},
{
"input": "99999 49996",
"output": "4999849980"
},
{
"input": "99999 50000",
"output": "4999850001"
},
{
"input": "99999 50001",
"output": "4999850001"
},
{
"input": "99999 50002",
"output": "4999850001"
},
{
"input": "30062 9",
"output": "540945"
},
{
"input": "13486 3",
"output": "80895"
},
{
"input": "29614 7",
"output": "414491"
},
{
"input": "13038 8",
"output": "208472"
},
{
"input": "96462 6",
"output": "1157466"
},
{
"input": "22599 93799",
"output": "255346101"
},
{
"input": "421 36817",
"output": "88410"
},
{
"input": "72859 65869",
"output": "2654180511"
},
{
"input": "37916 5241",
"output": "342494109"
},
{
"input": "47066 12852",
"output": "879423804"
},
{
"input": "84032 21951",
"output": "2725458111"
},
{
"input": "70454 75240",
"output": "2481847831"
},
{
"input": "86946 63967",
"output": "3779759985"
},
{
"input": "71128 11076",
"output": "1330260828"
},
{
"input": "46111 64940",
"output": "1063089105"
},
{
"input": "46111 64940",
"output": "1063089105"
},
{
"input": "56500 84184",
"output": "1596096750"
},
{
"input": "60108 83701",
"output": "1806455778"
},
{
"input": "1 2",
"output": "0"
},
{
"input": "1 3",
"output": "0"
},
{
"input": "1 4",
"output": "0"
},
{
"input": "1 5",
"output": "0"
},
{
"input": "1 6",
"output": "0"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "1"
},
{
"input": "2 4",
"output": "1"
},
{
"input": "2 5",
"output": "1"
},
{
"input": "3 1",
"output": "3"
},
{
"input": "3 2",
"output": "3"
},
{
"input": "3 3",
"output": "3"
},
{
"input": "3 4",
"output": "3"
},
{
"input": "3 5",
"output": "3"
},
{
"input": "4 1",
"output": "5"
},
{
"input": "4 2",
"output": "6"
},
{
"input": "4 3",
"output": "6"
},
{
"input": "4 4",
"output": "6"
},
{
"input": "4 5",
"output": "6"
},
{
"input": "5 1",
"output": "7"
},
{
"input": "5 3",
"output": "10"
},
{
"input": "5 4",
"output": "10"
},
{
"input": "5 5",
"output": "10"
},
{
"input": "6 1",
"output": "9"
},
{
"input": "6 2",
"output": "14"
},
{
"input": "6 3",
"output": "15"
},
{
"input": "7 2",
"output": "18"
},
{
"input": "7 3",
"output": "21"
},
{
"input": "7 4",
"output": "21"
},
{
"input": "10 2",
"output": "30"
},
{
"input": "60982 2",
"output": "243918"
},
{
"input": "23426 23",
"output": "1076515"
},
{
"input": "444 3",
"output": "2643"
},
{
"input": "18187 433",
"output": "15374531"
},
{
"input": "6895 3544",
"output": "23767065"
},
{
"input": "56204 22352",
"output": "1513297456"
},
{
"input": "41977 5207",
"output": "382917573"
},
{
"input": "78147 2321",
"output": "351981971"
},
{
"input": "99742 62198",
"output": "4974183411"
},
{
"input": "72099 38339",
"output": "2599096851"
},
{
"input": "82532 4838",
"output": "751762306"
},
{
"input": "79410 33144",
"output": "3066847464"
},
{
"input": "11021 3389",
"output": "51726307"
},
{
"input": "66900 7572",
"output": "898455660"
},
{
"input": "99999 49999",
"output": "4999850001"
},
{
"input": "100000 49999",
"output": "4999949999"
},
{
"input": "100000 100000",
"output": "4999950000"
},
{
"input": "100000 1",
"output": "199997"
},
{
"input": "4 100",
"output": "6"
},
{
"input": "100000 1234",
"output": "243753254"
}
] | 1,465,011,859
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 92
| 264
| 26,419,200
|
n, k = [int(i) for i in input().split()]
cow = [(i+1) for i in range(n)]
j = 0
q = n - 1
ans = 0
while j < q and k > 0:
ans += (2*n-3)
n -= 2
j += 1
q -= 1
k -= 1
print(ans)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is a balmy spring afternoon, and Farmer John's *n* cows are ruminating about link-cut cacti in their stalls. The cows, labeled 1 through *n*, are arranged so that the *i*-th cow occupies the *i*-th stall from the left. However, Elsie, after realizing that she will forever live in the shadows beyond Bessie's limelight, has formed the Mischievous Mess Makers and is plotting to disrupt this beautiful pastoral rhythm. While Farmer John takes his *k* minute long nap, Elsie and the Mess Makers plan to repeatedly choose two distinct stalls and swap the cows occupying those stalls, making no more than one swap each minute.
Being the meticulous pranksters that they are, the Mischievous Mess Makers would like to know the maximum messiness attainable in the *k* minutes that they have. We denote as *p**i* the label of the cow in the *i*-th stall. The messiness of an arrangement of cows is defined as the number of pairs (*i*,<=*j*) such that *i*<=<<=*j* and *p**i*<=><=*p**j*.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100<=000) — the number of cows and the length of Farmer John's nap, respectively.
Output Specification:
Output a single integer, the maximum messiness that the Mischievous Mess Makers can achieve by performing no more than *k* swaps.
Demo Input:
['5 2\n', '1 10\n']
Demo Output:
['10\n', '0\n']
Note:
In the first sample, the Mischievous Mess Makers can swap the cows in the stalls 1 and 5 during the first minute, then the cows in stalls 2 and 4 during the second minute. This reverses the arrangement of cows, giving us a total messiness of 10.
In the second sample, there is only one cow, so the maximum possible messiness is 0.
|
```python
n, k = [int(i) for i in input().split()]
cow = [(i+1) for i in range(n)]
j = 0
q = n - 1
ans = 0
while j < q and k > 0:
ans += (2*n-3)
n -= 2
j += 1
q -= 1
k -= 1
print(ans)
```
| 3
|
|
417
|
A
|
Elimination
|
PROGRAMMING
| 1,500
|
[
"dp",
"implementation",
"math"
] | null | null |
The finalists of the "Russian Code Cup" competition in 2214 will be the participants who win in one of the elimination rounds.
The elimination rounds are divided into main and additional. Each of the main elimination rounds consists of *c* problems, the winners of the round are the first *n* people in the rating list. Each of the additional elimination rounds consists of *d* problems. The winner of the additional round is one person. Besides, *k* winners of the past finals are invited to the finals without elimination.
As a result of all elimination rounds at least *n*·*m* people should go to the finals. You need to organize elimination rounds in such a way, that at least *n*·*m* people go to the finals, and the total amount of used problems in all rounds is as small as possible.
|
The first line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100) — the number of problems in the main and additional rounds, correspondingly. The second line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). Finally, the third line contains an integer *k* (1<=≤<=*k*<=≤<=100) — the number of the pre-chosen winners.
|
In the first line, print a single integer — the minimum number of problems the jury needs to prepare.
|
[
"1 10\n7 2\n1\n",
"2 2\n2 1\n2\n"
] |
[
"2\n",
"0\n"
] |
none
| 500
|
[
{
"input": "1 10\n7 2\n1",
"output": "2"
},
{
"input": "2 2\n2 1\n2",
"output": "0"
},
{
"input": "8 9\n2 2\n3",
"output": "8"
},
{
"input": "5 5\n8 8\n7",
"output": "40"
},
{
"input": "1 8\n8 10\n8",
"output": "9"
},
{
"input": "5 7\n9 1\n8",
"output": "5"
},
{
"input": "35 28\n35 60\n44",
"output": "2065"
},
{
"input": "19 76\n91 91\n87",
"output": "1729"
},
{
"input": "20 38\n38 70\n58",
"output": "1380"
},
{
"input": "2 81\n3 39\n45",
"output": "48"
},
{
"input": "7 63\n18 69\n30",
"output": "476"
},
{
"input": "89 69\n57 38\n15",
"output": "3382"
},
{
"input": "3 30\n10 83\n57",
"output": "234"
},
{
"input": "100 3\n93 23\n98",
"output": "2200"
},
{
"input": "2 78\n21 24\n88",
"output": "40"
},
{
"input": "40 80\n4 31\n63",
"output": "640"
},
{
"input": "1 48\n89 76\n24",
"output": "76"
},
{
"input": "5 25\n13 76\n86",
"output": "350"
},
{
"input": "23 86\n83 88\n62",
"output": "2024"
},
{
"input": "1 93\n76 40\n39",
"output": "40"
},
{
"input": "53 93\n10 70\n9",
"output": "3710"
},
{
"input": "100 100\n100 100\n100",
"output": "9900"
},
{
"input": "10 100\n100 100\n99",
"output": "1000"
},
{
"input": "1 100\n99 100\n1",
"output": "100"
},
{
"input": "10 2\n7 2\n3",
"output": "18"
},
{
"input": "4 1\n5 3\n8",
"output": "6"
},
{
"input": "2 2\n2 1\n20",
"output": "0"
},
{
"input": "7 5\n1 1\n10",
"output": "0"
},
{
"input": "4 5\n9 10\n100",
"output": "0"
},
{
"input": "10 1\n1 2\n1",
"output": "1"
},
{
"input": "16 6\n3 12\n7",
"output": "156"
},
{
"input": "10 1\n1 100\n1",
"output": "99"
},
{
"input": "2 1\n3 4\n2",
"output": "7"
},
{
"input": "2 1\n1 1\n10",
"output": "0"
},
{
"input": "100 1\n2 3\n1",
"output": "5"
},
{
"input": "10 2\n1 11\n1",
"output": "20"
},
{
"input": "10 10\n1 1\n100",
"output": "0"
},
{
"input": "100 1\n50 100\n1",
"output": "4999"
},
{
"input": "10 1\n2 2\n3",
"output": "1"
},
{
"input": "3 1\n9 10\n80",
"output": "4"
},
{
"input": "100 1\n1 100\n1",
"output": "99"
},
{
"input": "10 9\n10 10\n9",
"output": "99"
},
{
"input": "1 1\n1 1\n99",
"output": "0"
},
{
"input": "10 9\n1 1\n100",
"output": "0"
},
{
"input": "4 1\n5 1\n10",
"output": "0"
},
{
"input": "5 1\n6 3\n5",
"output": "11"
},
{
"input": "10 1\n1 1\n10",
"output": "0"
},
{
"input": "1 1\n1 1\n10",
"output": "0"
}
] | 1,547,381,107
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 109
| 0
|
c,d = list(map(int, input().split(" ")))
n, m = list(map(int, input().split(" ")))
k = int(input())
mini = n*m-k
if mini < 1:
print(0)
elif d * n <= c: # easier one at a time
print(d*mini)
else:
total = (mini // n) * c
mini = mini % n
total += min(c, d*mini)
print(total)
|
Title: Elimination
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The finalists of the "Russian Code Cup" competition in 2214 will be the participants who win in one of the elimination rounds.
The elimination rounds are divided into main and additional. Each of the main elimination rounds consists of *c* problems, the winners of the round are the first *n* people in the rating list. Each of the additional elimination rounds consists of *d* problems. The winner of the additional round is one person. Besides, *k* winners of the past finals are invited to the finals without elimination.
As a result of all elimination rounds at least *n*·*m* people should go to the finals. You need to organize elimination rounds in such a way, that at least *n*·*m* people go to the finals, and the total amount of used problems in all rounds is as small as possible.
Input Specification:
The first line contains two integers *c* and *d* (1<=≤<=*c*,<=*d*<=≤<=100) — the number of problems in the main and additional rounds, correspondingly. The second line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). Finally, the third line contains an integer *k* (1<=≤<=*k*<=≤<=100) — the number of the pre-chosen winners.
Output Specification:
In the first line, print a single integer — the minimum number of problems the jury needs to prepare.
Demo Input:
['1 10\n7 2\n1\n', '2 2\n2 1\n2\n']
Demo Output:
['2\n', '0\n']
Note:
none
|
```python
c,d = list(map(int, input().split(" ")))
n, m = list(map(int, input().split(" ")))
k = int(input())
mini = n*m-k
if mini < 1:
print(0)
elif d * n <= c: # easier one at a time
print(d*mini)
else:
total = (mini // n) * c
mini = mini % n
total += min(c, d*mini)
print(total)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,646,068,063
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 62
| 0
|
a=str(input())
small=0
upper=0
for i in a:
if i.islower()== True:
small+=1
elif i.isupper() == True:
upper+=1
if small>=upper:
print(a.lower())
else:
print(a.upper())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
a=str(input())
small=0
upper=0
for i in a:
if i.islower()== True:
small+=1
elif i.isupper() == True:
upper+=1
if small>=upper:
print(a.lower())
else:
print(a.upper())
```
| 3.9845
|
628
|
D
|
Magic Numbers
|
PROGRAMMING
| 2,200
|
[
"dp"
] | null | null |
Consider the decimal presentation of an integer. Let's call a number d-magic if digit *d* appears in decimal presentation of the number on even positions and nowhere else.
For example, the numbers 1727374, 17, 1 are 7-magic but 77, 7, 123, 34, 71 are not 7-magic. On the other hand the number 7 is 0-magic, 123 is 2-magic, 34 is 4-magic and 71 is 1-magic.
Find the number of d-magic numbers in the segment [*a*,<=*b*] that are multiple of *m*. Because the answer can be very huge you should only find its value modulo 109<=+<=7 (so you should find the remainder after dividing by 109<=+<=7).
|
The first line contains two integers *m*,<=*d* (1<=≤<=*m*<=≤<=2000, 0<=≤<=*d*<=≤<=9) — the parameters from the problem statement.
The second line contains positive integer *a* in decimal presentation (without leading zeroes).
The third line contains positive integer *b* in decimal presentation (without leading zeroes).
It is guaranteed that *a*<=≤<=*b*, the number of digits in *a* and *b* are the same and don't exceed 2000.
|
Print the only integer *a* — the remainder after dividing by 109<=+<=7 of the number of d-magic numbers in segment [*a*,<=*b*] that are multiple of *m*.
|
[
"2 6\n10\n99\n",
"2 0\n1\n9\n",
"19 7\n1000\n9999\n"
] |
[
"8\n",
"4\n",
"6\n"
] |
The numbers from the answer of the first example are 16, 26, 36, 46, 56, 76, 86 and 96.
The numbers from the answer of the second example are 2, 4, 6 and 8.
The numbers from the answer of the third example are 1767, 2717, 5757, 6707, 8797 and 9747.
| 0
|
[
{
"input": "2 6\n10\n99",
"output": "8"
},
{
"input": "2 0\n1\n9",
"output": "4"
},
{
"input": "19 7\n1000\n9999",
"output": "6"
},
{
"input": "9 4\n33\n52",
"output": "0"
},
{
"input": "10 8\n18\n59",
"output": "0"
},
{
"input": "43 3\n587\n850",
"output": "1"
},
{
"input": "65 3\n3436\n3632",
"output": "0"
},
{
"input": "850 8\n55735\n94089",
"output": "0"
},
{
"input": "590 6\n428671\n715453",
"output": "0"
},
{
"input": "1053 8\n1539368\n3362621",
"output": "0"
},
{
"input": "477 9\n3062053\n6465858",
"output": "6"
},
{
"input": "1901 9\n1941695\n3314270",
"output": "0"
},
{
"input": "29 0\n1649127\n6241670",
"output": "126"
},
{
"input": "566 3\n6372451659957700362854162843720623142601337360014410221724168092176479911659703538545016668832338549\n7969973326176891147525183958122002014921396842270051000646823226374743898663307171214245111949604186",
"output": "0"
},
{
"input": "1286 5\n1886373541983002858974907276497223649072414883083336663541044958378875954171855070620868427474284001\n4050983123791059817478363830631049287126338893626273758612677264947268375965600848751800494833017145",
"output": "0"
},
{
"input": "2 5\n1762712\n8121765",
"output": "2025"
},
{
"input": "2 2\n12\n12",
"output": "1"
},
{
"input": "2 0\n10\n10",
"output": "1"
},
{
"input": "2 6\n46\n46",
"output": "1"
},
{
"input": "2 0\n10\n20",
"output": "2"
},
{
"input": "2 9\n10000000000\n99999999999",
"output": "262440"
},
{
"input": "10 2\n12300\n99900",
"output": "70"
},
{
"input": "5 5\n5\n5",
"output": "0"
},
{
"input": "1 2\n113548484131315415454546546467913135484841313154154\n895458414564646646487131313118761454584145646466464",
"output": "970729981"
},
{
"input": "2 2\n12\n14",
"output": "1"
},
{
"input": "2 2\n2934\n4323",
"output": "18"
},
{
"input": "2 4\n1\n9",
"output": "3"
},
{
"input": "1 0\n10\n20",
"output": "2"
},
{
"input": "7 7\n7\n7",
"output": "0"
},
{
"input": "2 1\n143\n413",
"output": "12"
},
{
"input": "1 4\n1\n9",
"output": "8"
},
{
"input": "2 6\n36\n36",
"output": "1"
},
{
"input": "4 4\n24344\n48880",
"output": "29"
},
{
"input": "2 0\n1000\n9999",
"output": "81"
},
{
"input": "3 9\n39\n39",
"output": "1"
},
{
"input": "3 9\n10\n99",
"output": "2"
},
{
"input": "1 0\n10000\n99999",
"output": "729"
},
{
"input": "3 2\n681563\n828242",
"output": "48"
},
{
"input": "1 5\n454\n667",
"output": "14"
},
{
"input": "2 0\n2\n9",
"output": "4"
},
{
"input": "2 6\n7\n9",
"output": "1"
},
{
"input": "10 7\n1\n1",
"output": "0"
},
{
"input": "6 0\n1\n6",
"output": "1"
},
{
"input": "6 2\n22\n95",
"output": "2"
},
{
"input": "28 1\n102\n898",
"output": "2"
},
{
"input": "1 0\n1\n9",
"output": "9"
},
{
"input": "1 1\n1\n9",
"output": "8"
},
{
"input": "3 9\n10\n69",
"output": "2"
},
{
"input": "1 0\n1\n1",
"output": "1"
}
] | 1,456,286,047
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 13
| 2,000
| 0
|
m,d=list(map(int,input().split()));
a=int(input());
b=int(input());
ans=0;
for q in range(a,b+1):
if q%m==0:
i=str(q);
if all(i[x]==str(d)for x in range(len(i))if x%2)and all(i[x]!=str(d)for x in range(len(i))if x%2==0):
ans+=1;
ans%=1000000007;
print(ans);
|
Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Consider the decimal presentation of an integer. Let's call a number d-magic if digit *d* appears in decimal presentation of the number on even positions and nowhere else.
For example, the numbers 1727374, 17, 1 are 7-magic but 77, 7, 123, 34, 71 are not 7-magic. On the other hand the number 7 is 0-magic, 123 is 2-magic, 34 is 4-magic and 71 is 1-magic.
Find the number of d-magic numbers in the segment [*a*,<=*b*] that are multiple of *m*. Because the answer can be very huge you should only find its value modulo 109<=+<=7 (so you should find the remainder after dividing by 109<=+<=7).
Input Specification:
The first line contains two integers *m*,<=*d* (1<=≤<=*m*<=≤<=2000, 0<=≤<=*d*<=≤<=9) — the parameters from the problem statement.
The second line contains positive integer *a* in decimal presentation (without leading zeroes).
The third line contains positive integer *b* in decimal presentation (without leading zeroes).
It is guaranteed that *a*<=≤<=*b*, the number of digits in *a* and *b* are the same and don't exceed 2000.
Output Specification:
Print the only integer *a* — the remainder after dividing by 109<=+<=7 of the number of d-magic numbers in segment [*a*,<=*b*] that are multiple of *m*.
Demo Input:
['2 6\n10\n99\n', '2 0\n1\n9\n', '19 7\n1000\n9999\n']
Demo Output:
['8\n', '4\n', '6\n']
Note:
The numbers from the answer of the first example are 16, 26, 36, 46, 56, 76, 86 and 96.
The numbers from the answer of the second example are 2, 4, 6 and 8.
The numbers from the answer of the third example are 1767, 2717, 5757, 6707, 8797 and 9747.
|
```python
m,d=list(map(int,input().split()));
a=int(input());
b=int(input());
ans=0;
for q in range(a,b+1):
if q%m==0:
i=str(q);
if all(i[x]==str(d)for x in range(len(i))if x%2)and all(i[x]!=str(d)for x in range(len(i))if x%2==0):
ans+=1;
ans%=1000000007;
print(ans);
```
| 0
|
|
609
|
B
|
The Best Gift
|
PROGRAMMING
| 1,100
|
[
"constructive algorithms",
"implementation"
] | null | null |
Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*.
|
The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre.
|
Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109.
|
[
"4 3\n2 1 3 1\n",
"7 4\n4 2 3 1 2 4 3\n"
] |
[
"5\n",
"18\n"
] |
The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books.
| 0
|
[
{
"input": "4 3\n2 1 3 1",
"output": "5"
},
{
"input": "7 4\n4 2 3 1 2 4 3",
"output": "18"
},
{
"input": "2 2\n1 2",
"output": "1"
},
{
"input": "3 2\n1 2 2",
"output": "2"
},
{
"input": "10 10\n1 2 3 4 5 6 7 8 9 10",
"output": "45"
},
{
"input": "9 2\n1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "12 3\n1 2 3 1 2 3 1 2 3 1 2 3",
"output": "48"
},
{
"input": "100 3\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3",
"output": "3296"
},
{
"input": "100 5\n5 5 2 4 5 4 4 4 4 2 5 3 4 2 4 4 1 1 5 3 2 2 1 3 3 2 5 3 4 5 1 3 5 4 4 4 3 1 4 4 3 4 5 2 5 4 2 1 2 2 3 5 5 5 1 4 5 3 1 4 2 2 5 1 5 3 4 1 5 1 2 2 3 5 1 3 2 4 2 4 2 2 4 1 3 5 2 2 2 3 3 4 3 2 2 5 5 4 2 5",
"output": "3953"
},
{
"input": "100 10\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "4428"
}
] | 1,620,196,022
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 218
| 12,492,800
|
n,m=map(int,input().split())
a=list(map(int,input().split()))
result=0
for i in range(m):
count=a.count(i+1)
result+=count*(n-count)
print(result//2)
|
Title: The Best Gift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emily's birthday is next week and Jack has decided to buy a present for her. He knows she loves books so he goes to the local bookshop, where there are *n* books on sale from one of *m* genres.
In the bookshop, Jack decides to buy two books of different genres.
Based on the genre of books on sale in the shop, find the number of options available to Jack for choosing two books of different genres for Emily. Options are considered different if they differ in at least one book.
The books are given by indices of their genres. The genres are numbered from 1 to *m*.
Input Specification:
The first line contains two positive integers *n* and *m* (2<=≤<=*n*<=≤<=2·105,<=2<=≤<=*m*<=≤<=10) — the number of books in the bookstore and the number of genres.
The second line contains a sequence *a*1,<=*a*2,<=...,<=*a**n*, where *a**i* (1<=≤<=*a**i*<=≤<=*m*) equals the genre of the *i*-th book.
It is guaranteed that for each genre there is at least one book of that genre.
Output Specification:
Print the only integer — the number of ways in which Jack can choose books.
It is guaranteed that the answer doesn't exceed the value 2·109.
Demo Input:
['4 3\n2 1 3 1\n', '7 4\n4 2 3 1 2 4 3\n']
Demo Output:
['5\n', '18\n']
Note:
The answer to the first test sample equals 5 as Sasha can choose:
1. the first and second books, 1. the first and third books, 1. the first and fourth books, 1. the second and third books, 1. the third and fourth books.
|
```python
n,m=map(int,input().split())
a=list(map(int,input().split()))
result=0
for i in range(m):
count=a.count(i+1)
result+=count*(n-count)
print(result//2)
```
| 3
|
|
75
|
A
|
Life Without Zeros
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Life Without Zeros
|
2
|
256
|
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
|
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
|
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
|
[
"101\n102\n",
"105\n106\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "101\n102",
"output": "YES"
},
{
"input": "105\n106",
"output": "NO"
},
{
"input": "544\n397",
"output": "YES"
},
{
"input": "822\n280",
"output": "NO"
},
{
"input": "101\n413",
"output": "NO"
},
{
"input": "309\n139",
"output": "NO"
},
{
"input": "693\n970",
"output": "NO"
},
{
"input": "981\n1",
"output": "YES"
},
{
"input": "352\n276",
"output": "YES"
},
{
"input": "164\n691",
"output": "YES"
},
{
"input": "110036\n43",
"output": "YES"
},
{
"input": "100\n1000",
"output": "NO"
},
{
"input": "1000000000\n1000000000",
"output": "YES"
},
{
"input": "999999999\n999999999",
"output": "YES"
},
{
"input": "6\n4",
"output": "NO"
},
{
"input": "123456\n876543",
"output": "YES"
},
{
"input": "1234567\n9876543",
"output": "NO"
},
{
"input": "1111111\n1119111",
"output": "NO"
},
{
"input": "10502405\n40403403",
"output": "YES"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "5\n4",
"output": "YES"
},
{
"input": "1\n6",
"output": "YES"
},
{
"input": "40\n17",
"output": "NO"
},
{
"input": "35\n81",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "2081\n7450",
"output": "NO"
},
{
"input": "84355694\n373629503",
"output": "NO"
},
{
"input": "885992048\n510468672",
"output": "NO"
},
{
"input": "540144752\n647307841",
"output": "NO"
},
{
"input": "341781108\n784147010",
"output": "NO"
},
{
"input": "960440938\n572334653",
"output": "NO"
},
{
"input": "657414510\n768771903",
"output": "NO"
},
{
"input": "501871728\n725074574",
"output": "NO"
},
{
"input": "968\n851",
"output": "YES"
},
{
"input": "943\n939",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "611\n41",
"output": "YES"
},
{
"input": "737\n289",
"output": "NO"
},
{
"input": "168\n571",
"output": "YES"
},
{
"input": "868\n463",
"output": "YES"
},
{
"input": "815732007\n913882008",
"output": "NO"
},
{
"input": "459039901\n453033850",
"output": "NO"
},
{
"input": "975305404\n484601256",
"output": "NO"
}
] | 1,663,867,609
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 92
| 0
|
a = int(input())
b = int(input())
c = a + b
numbers_a = []
numbers_b = []
numbers_c = []
while a > 0 and b > 0:
last_a = a % 10
last_b = b % 10
numbers_a.append(last_a)
numbers_b.append(last_b)
a = a // 10
b = b // 10
while 0 in numbers_a or 0 in numbers_b:
if 0 in numbers_a:
numbers_a.remove(0)
elif 0 in numbers_b:
numbers_b.remove(0)
numbers_a.reverse()
numbers_b.reverse()
numbers_a2 = list(map(str, numbers_a))
numbers_b2 = list(map(str, numbers_b))
total_a = int(''.join(numbers_a2))
total_b = int(''.join(numbers_b2))
while c > 0:
last_c = c % 10
numbers_c.append(last_c)
c = c // 10
while 0 in numbers_c:
numbers_c.remove(0)
numbers_c.reverse()
numbers_c2 = list(map(str, numbers_c))
total_c = int(''.join(numbers_c2))
if total_a + total_b == total_c:
print('YES')
else:
print('NO')
|
Title: Life Without Zeros
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
Input Specification:
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
Output Specification:
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
Demo Input:
['101\n102\n', '105\n106\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
a = int(input())
b = int(input())
c = a + b
numbers_a = []
numbers_b = []
numbers_c = []
while a > 0 and b > 0:
last_a = a % 10
last_b = b % 10
numbers_a.append(last_a)
numbers_b.append(last_b)
a = a // 10
b = b // 10
while 0 in numbers_a or 0 in numbers_b:
if 0 in numbers_a:
numbers_a.remove(0)
elif 0 in numbers_b:
numbers_b.remove(0)
numbers_a.reverse()
numbers_b.reverse()
numbers_a2 = list(map(str, numbers_a))
numbers_b2 = list(map(str, numbers_b))
total_a = int(''.join(numbers_a2))
total_b = int(''.join(numbers_b2))
while c > 0:
last_c = c % 10
numbers_c.append(last_c)
c = c // 10
while 0 in numbers_c:
numbers_c.remove(0)
numbers_c.reverse()
numbers_c2 = list(map(str, numbers_c))
total_c = int(''.join(numbers_c2))
if total_a + total_b == total_c:
print('YES')
else:
print('NO')
```
| 0
|
678
|
A
|
Johny Likes Numbers
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*.
|
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109).
|
Print the smallest integer *x*<=><=*n*, so it is divisible by the number *k*.
|
[
"5 3\n",
"25 13\n",
"26 13\n"
] |
[
"6\n",
"26\n",
"39\n"
] |
none
| 0
|
[
{
"input": "5 3",
"output": "6"
},
{
"input": "25 13",
"output": "26"
},
{
"input": "26 13",
"output": "39"
},
{
"input": "1 1",
"output": "2"
},
{
"input": "8 8",
"output": "16"
},
{
"input": "14 15",
"output": "15"
},
{
"input": "197 894",
"output": "894"
},
{
"input": "6058 8581",
"output": "8581"
},
{
"input": "97259 41764",
"output": "125292"
},
{
"input": "453145 333625",
"output": "667250"
},
{
"input": "2233224 4394826",
"output": "4394826"
},
{
"input": "76770926 13350712",
"output": "80104272"
},
{
"input": "687355301 142098087",
"output": "710490435"
},
{
"input": "1000000000 999999999",
"output": "1999999998"
},
{
"input": "1000000000 1000000000",
"output": "2000000000"
},
{
"input": "999999999 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 1",
"output": "1000000001"
},
{
"input": "1000000000 2",
"output": "1000000002"
},
{
"input": "999999999 1",
"output": "1000000000"
},
{
"input": "100000000 1",
"output": "100000001"
},
{
"input": "999999999 500000000",
"output": "1000000000"
},
{
"input": "999999990 10",
"output": "1000000000"
},
{
"input": "1000000000 999999997",
"output": "1999999994"
},
{
"input": "999999999 2",
"output": "1000000000"
},
{
"input": "999999984 1",
"output": "999999985"
},
{
"input": "999999983 1",
"output": "999999984"
},
{
"input": "666666666 1",
"output": "666666667"
},
{
"input": "1000000000 990000000",
"output": "1980000000"
},
{
"input": "41 48",
"output": "48"
},
{
"input": "123456 2",
"output": "123458"
},
{
"input": "111 111",
"output": "222"
},
{
"input": "878787 1",
"output": "878788"
},
{
"input": "121 1",
"output": "122"
},
{
"input": "114514 114514",
"output": "229028"
},
{
"input": "500000001 1000000000",
"output": "1000000000"
},
{
"input": "999999997 1",
"output": "999999998"
},
{
"input": "100000000 10",
"output": "100000010"
}
] | 1,636,267,737
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 46
| 4,300,800
|
n,k=[int(x) for x in input().split()]
if n%k==0:
print(((n//k)+1)*k)
else:
print(n+k-n%k)
|
Title: Johny Likes Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Johny likes numbers *n* and *k* very much. Now Johny wants to find the smallest integer *x* greater than *n*, so it is divisible by the number *k*.
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=109).
Output Specification:
Print the smallest integer *x*<=><=*n*, so it is divisible by the number *k*.
Demo Input:
['5 3\n', '25 13\n', '26 13\n']
Demo Output:
['6\n', '26\n', '39\n']
Note:
none
|
```python
n,k=[int(x) for x in input().split()]
if n%k==0:
print(((n//k)+1)*k)
else:
print(n+k-n%k)
```
| 3
|
|
478
|
B
|
Random Teams
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null |
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
|
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
|
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
|
[
"5 1\n",
"3 2\n",
"6 3\n"
] |
[
"10 10\n",
"1 1\n",
"3 6\n"
] |
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
| 1,000
|
[
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,684,555,190
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 10
| 46
| 0
|
# Random Teams
# 1300
n, m = [int(value) for value in input().split(" ")]
def comb_2(num: int) -> int:
return int(num * (num - 1) / 2)
left = n - m
# max
max_f = comb_2(left + 1)
# min
max_size = n // m + 1
max_num = n % m
min_size = max_size - 1
min_num = m - max_num
min_f = comb_2(max_size) * max_num + comb_2(min_size) * min_num
print(min_f, max_f)
|
Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people.
|
```python
# Random Teams
# 1300
n, m = [int(value) for value in input().split(" ")]
def comb_2(num: int) -> int:
return int(num * (num - 1) / 2)
left = n - m
# max
max_f = comb_2(left + 1)
# min
max_size = n // m + 1
max_num = n % m
min_size = max_size - 1
min_num = m - max_num
min_f = comb_2(max_size) * max_num + comb_2(min_size) * min_num
print(min_f, max_f)
```
| 0
|
|
365
|
A
|
Good Number
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
|
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
|
Print a single integer — the number of *k*-good numbers in *a*.
|
[
"10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n",
"2 1\n1\n10\n"
] |
[
"10\n",
"1\n"
] |
none
| 500
|
[
{
"input": "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560",
"output": "10"
},
{
"input": "2 1\n1\n10",
"output": "1"
},
{
"input": "1 0\n1000000000",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "6 0\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "1 3\n1000000000",
"output": "0"
},
{
"input": "1 9\n1000000000",
"output": "0"
},
{
"input": "1 0\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 3\n1",
"output": "0"
},
{
"input": "1 9\n1",
"output": "0"
},
{
"input": "2 8\n123456780\n123",
"output": "1"
},
{
"input": "2 8\n12345678\n1230",
"output": "0"
},
{
"input": "6 1\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "6 2\n10\n102\n120\n1032\n1212103\n1999999",
"output": "4"
},
{
"input": "6 3\n10\n102\n120\n1032\n1212103\n1999999",
"output": "2"
},
{
"input": "6 9\n10\n102\n120\n1032\n1212103\n1999999",
"output": "0"
},
{
"input": "1 2\n2220",
"output": "0"
}
] | 1,638,792,510
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 30
| 0
|
n,k=map(int,input().split())
m=0
num=n
for i in range(0,n):
m=int(input())
if(m%10<=k):
m=m//10
else:
num=num-1
print(num)
|
Title: Good Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
Input Specification:
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print a single integer — the number of *k*-good numbers in *a*.
Demo Input:
['10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n', '2 1\n1\n10\n']
Demo Output:
['10\n', '1\n']
Note:
none
|
```python
n,k=map(int,input().split())
m=0
num=n
for i in range(0,n):
m=int(input())
if(m%10<=k):
m=m//10
else:
num=num-1
print(num)
```
| 0
|
|
363
|
B
|
Fence
|
PROGRAMMING
| 1,100
|
[
"brute force",
"dp"
] | null | null |
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
|
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
|
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
|
[
"7 3\n1 2 6 1 1 7 1\n"
] |
[
"3\n"
] |
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
| 1,000
|
[
{
"input": "7 3\n1 2 6 1 1 7 1",
"output": "3"
},
{
"input": "1 1\n100",
"output": "1"
},
{
"input": "2 1\n10 20",
"output": "1"
},
{
"input": "10 5\n1 2 3 1 2 2 3 1 4 5",
"output": "1"
},
{
"input": "10 2\n3 1 4 1 4 6 2 1 4 6",
"output": "7"
},
{
"input": "2 2\n20 10",
"output": "1"
},
{
"input": "2 1\n20 1",
"output": "2"
},
{
"input": "3 1\n1 2 3",
"output": "1"
},
{
"input": "3 1\n2 1 3",
"output": "2"
},
{
"input": "3 1\n3 2 1",
"output": "3"
},
{
"input": "3 2\n1 2 3",
"output": "1"
},
{
"input": "3 2\n3 2 1",
"output": "2"
},
{
"input": "3 3\n1 2 3",
"output": "1"
},
{
"input": "4 2\n9 8 11 7",
"output": "1"
},
{
"input": "4 2\n10 1 2 3",
"output": "2"
},
{
"input": "6 3\n56 56 56 2 1 2",
"output": "4"
},
{
"input": "8 3\n1 1 1 1 2 60 90 1",
"output": "1"
},
{
"input": "4 1\n1 5 2 2",
"output": "1"
},
{
"input": "4 2\n4 6 7 4",
"output": "1"
},
{
"input": "10 4\n1 1 1 4 4 4 4 4 4 3",
"output": "1"
},
{
"input": "6 3\n1 2 1 3 1 1",
"output": "1"
},
{
"input": "5 2\n100 100 100 1 1",
"output": "4"
}
] | 1,691,647,076
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 51
| 140
| 13,414,400
|
n,k=map(int, input().split())
a=list(map(int, input().split()))
b=[]
b.append(0)
i=0
while i<n:
b.append(b[i]+a[i])
i+=1
# print(a)
# print(b)
s=sum(a)+1
# print(s)
ind=1
i=k
while i<n+1:
if b[i]-b[i-k]<s:
ind=i-k+1
s=b[i]-b[i-k]
i+=1
print(ind)
|
Title: Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a fence in front of Polycarpus's home. The fence consists of *n* planks of the same width which go one after another from left to right. The height of the *i*-th plank is *h**i* meters, distinct planks can have distinct heights.
Polycarpus has bought a posh piano and is thinking about how to get it into the house. In order to carry out his plan, he needs to take exactly *k* consecutive planks from the fence. Higher planks are harder to tear off the fence, so Polycarpus wants to find such *k* consecutive planks that the sum of their heights is minimal possible.
Write the program that finds the indexes of *k* consecutive planks with minimal total height. Pay attention, the fence is not around Polycarpus's home, it is in front of home (in other words, the fence isn't cyclic).
Input Specification:
The first line of the input contains integers *n* and *k* (1<=≤<=*n*<=≤<=1.5·105,<=1<=≤<=*k*<=≤<=*n*) — the number of planks in the fence and the width of the hole for the piano. The second line contains the sequence of integers *h*1,<=*h*2,<=...,<=*h**n* (1<=≤<=*h**i*<=≤<=100), where *h**i* is the height of the *i*-th plank of the fence.
Output Specification:
Print such integer *j* that the sum of the heights of planks *j*, *j*<=+<=1, ..., *j*<=+<=*k*<=-<=1 is the minimum possible. If there are multiple such *j*'s, print any of them.
Demo Input:
['7 3\n1 2 6 1 1 7 1\n']
Demo Output:
['3\n']
Note:
In the sample, your task is to find three consecutive planks with the minimum sum of heights. In the given case three planks with indexes 3, 4 and 5 have the required attribute, their total height is 8.
|
```python
n,k=map(int, input().split())
a=list(map(int, input().split()))
b=[]
b.append(0)
i=0
while i<n:
b.append(b[i]+a[i])
i+=1
# print(a)
# print(b)
s=sum(a)+1
# print(s)
ind=1
i=k
while i<n+1:
if b[i]-b[i-k]<s:
ind=i-k+1
s=b[i]-b[i-k]
i+=1
print(ind)
```
| 3
|
|
743
|
C
|
Vladik and fractions
|
PROGRAMMING
| 1,500
|
[
"brute force",
"constructive algorithms",
"math",
"number theory"
] | null | null |
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
|
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
|
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
|
[
"3\n",
"7\n"
] |
[
"2 7 42\n",
"7 8 56\n"
] |
none
| 1,250
|
[
{
"input": "3",
"output": "2 7 42"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "2",
"output": "2 3 6"
},
{
"input": "5",
"output": "5 6 30"
},
{
"input": "4",
"output": "4 5 20"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "82",
"output": "82 83 6806"
},
{
"input": "56",
"output": "56 57 3192"
},
{
"input": "30",
"output": "30 31 930"
},
{
"input": "79",
"output": "79 80 6320"
},
{
"input": "28",
"output": "28 29 812"
},
{
"input": "4116",
"output": "4116 4117 16945572"
},
{
"input": "1",
"output": "-1"
},
{
"input": "6491",
"output": "6491 6492 42139572"
},
{
"input": "8865",
"output": "8865 8866 78597090"
},
{
"input": "1239",
"output": "1239 1240 1536360"
},
{
"input": "3614",
"output": "3614 3615 13064610"
},
{
"input": "5988",
"output": "5988 5989 35862132"
},
{
"input": "8363",
"output": "8363 8364 69948132"
},
{
"input": "737",
"output": "737 738 543906"
},
{
"input": "3112",
"output": "3112 3113 9687656"
},
{
"input": "9562",
"output": "9562 9563 91441406"
},
{
"input": "1936",
"output": "1936 1937 3750032"
},
{
"input": "4311",
"output": "4311 4312 18589032"
},
{
"input": "6685",
"output": "6685 6686 44695910"
},
{
"input": "9060",
"output": "9060 9061 82092660"
},
{
"input": "1434",
"output": "1434 1435 2057790"
},
{
"input": "3809",
"output": "3809 3810 14512290"
},
{
"input": "6183",
"output": "6183 6184 38235672"
},
{
"input": "8558",
"output": "8558 8559 73247922"
},
{
"input": "932",
"output": "932 933 869556"
},
{
"input": "7274",
"output": "7274 7275 52918350"
},
{
"input": "9648",
"output": "9648 9649 93093552"
},
{
"input": "2023",
"output": "2023 2024 4094552"
},
{
"input": "4397",
"output": "4397 4398 19338006"
},
{
"input": "6772",
"output": "6772 6773 45866756"
},
{
"input": "9146",
"output": "9146 9147 83658462"
},
{
"input": "1521",
"output": "1521 1522 2314962"
},
{
"input": "4938",
"output": "4938 4939 24388782"
},
{
"input": "6143",
"output": "6143 6144 37742592"
},
{
"input": "6230",
"output": "6230 6231 38819130"
},
{
"input": "10000",
"output": "10000 10001 100010000"
},
{
"input": "1",
"output": "-1"
},
{
"input": "101",
"output": "101 102 10302"
},
{
"input": "9999",
"output": "9999 10000 99990000"
},
{
"input": "512",
"output": "512 513 262656"
},
{
"input": "511",
"output": "511 512 261632"
},
{
"input": "513",
"output": "513 514 263682"
},
{
"input": "9973",
"output": "9973 9974 99470702"
},
{
"input": "9972",
"output": "9972 9973 99450756"
},
{
"input": "9974",
"output": "9974 9975 99490650"
},
{
"input": "9409",
"output": "9409 9410 88538690"
},
{
"input": "9408",
"output": "9408 9409 88519872"
},
{
"input": "9410",
"output": "9410 9411 88557510"
},
{
"input": "719",
"output": "719 720 517680"
},
{
"input": "720",
"output": "720 721 519120"
},
{
"input": "721",
"output": "721 722 520562"
},
{
"input": "9796",
"output": "9796 9797 95971412"
},
{
"input": "9797",
"output": "9797 9798 95991006"
},
{
"input": "9798",
"output": "9798 9799 96010602"
},
{
"input": "4999",
"output": "4999 5000 24995000"
},
{
"input": "9998",
"output": "9998 9999 99970002"
}
] | 1,490,721,133
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 62
| 62
| 4,608,000
|
a = int(input())
if a == 1:
print(-1)
else:
print(a, a+1, a*(a+1))
|
Title: Vladik and fractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
Input Specification:
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
Output Specification:
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '7\n']
Demo Output:
['2 7 42\n', '7 8 56\n']
Note:
none
|
```python
a = int(input())
if a == 1:
print(-1)
else:
print(a, a+1, a*(a+1))
```
| 3
|
|
2
|
A
|
Winner
|
PROGRAMMING
| 1,500
|
[
"hashing",
"implementation"
] |
A. Winner
|
1
|
64
|
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
|
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
|
Print the name of the winner.
|
[
"3\nmike 3\nandrew 5\nmike 2\n",
"3\nandrew 3\nandrew 2\nmike 5\n"
] |
[
"andrew\n",
"andrew\n"
] |
none
| 0
|
[
{
"input": "3\nmike 3\nandrew 5\nmike 2",
"output": "andrew"
},
{
"input": "3\nandrew 3\nandrew 2\nmike 5",
"output": "andrew"
},
{
"input": "5\nkaxqybeultn -352\nmgochgrmeyieyskhuourfg -910\nkaxqybeultn 691\nmgochgrmeyieyskhuourfg -76\nkaxqybeultn -303",
"output": "kaxqybeultn"
},
{
"input": "7\nksjuuerbnlklcfdjeyq 312\ndthjlkrvvbyahttifpdewvyslsh -983\nksjuuerbnlklcfdjeyq 268\ndthjlkrvvbyahttifpdewvyslsh 788\nksjuuerbnlklcfdjeyq -79\nksjuuerbnlklcfdjeyq -593\nksjuuerbnlklcfdjeyq 734",
"output": "ksjuuerbnlklcfdjeyq"
},
{
"input": "12\natrtthfpcvishmqbakprquvnejr 185\natrtthfpcvishmqbakprquvnejr -699\natrtthfpcvishmqbakprquvnejr -911\natrtthfpcvishmqbakprquvnejr -220\nfcgslzkicjrpbqaifgweyzreajjfdo 132\nfcgslzkicjrpbqaifgweyzreajjfdo -242\nm 177\nm -549\natrtthfpcvishmqbakprquvnejr -242\nm 38\natrtthfpcvishmqbakprquvnejr -761\nfcgslzkicjrpbqaifgweyzreajjfdo 879",
"output": "fcgslzkicjrpbqaifgweyzreajjfdo"
},
{
"input": "15\naawtvezfntstrcpgbzjbf 681\nzhahpvqiptvksnbjkdvmknb -74\naawtvezfntstrcpgbzjbf 661\njpdwmyke 474\naawtvezfntstrcpgbzjbf -547\naawtvezfntstrcpgbzjbf 600\nzhahpvqiptvksnbjkdvmknb -11\njpdwmyke 711\nbjmj 652\naawtvezfntstrcpgbzjbf -1000\naawtvezfntstrcpgbzjbf -171\nbjmj -302\naawtvezfntstrcpgbzjbf 961\nzhahpvqiptvksnbjkdvmknb 848\nbjmj -735",
"output": "aawtvezfntstrcpgbzjbf"
},
{
"input": "17\nqdplghhx -649\nivhgbxiv 424\nivhgbxiv -72\nivhgbxiv 479\nugowfouebkelargxylsxn 83\nugowfouebkelargxylsxn -840\nivhgbxiv 382\nqdplghhx -904\nivhgbxiv -710\nugowfouebkelargxylsxn -838\nqdplghhx -974\nqdplghhx 571\nivhgbxiv -145\nugowfouebkelargxylsxn -788\nivhgbxiv 209\nivhgbxiv 420\nqdplghhx -158",
"output": "ivhgbxiv"
}
] | 1,636,671,004
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 4,505,600
|
if __name__ == '__main__':
scores = {}
for n in range(int(input())):
split = input().split(' ')
if split[0] in scores.keys():
scores[split[0]] += int(split[1])
else:
scores[split[0]] = int(split[1])
sorted(scores.items(), key=lambda x: x[1])
print(next(iter(scores)))
|
Title: Winner
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
The winner of the card game popular in Berland "Berlogging" is determined according to the following rules. If at the end of the game there is only one player with the maximum number of points, he is the winner. The situation becomes more difficult if the number of such players is more than one. During each round a player gains or loses a particular number of points. In the course of the game the number of points is registered in the line "name score", where name is a player's name, and score is the number of points gained in this round, which is an integer number. If score is negative, this means that the player has lost in the round. So, if two or more players have the maximum number of points (say, it equals to *m*) at the end of the game, than wins the one of them who scored at least *m* points first. Initially each player has 0 points. It's guaranteed that at the end of the game at least one player has a positive number of points.
Input Specification:
The first line contains an integer number *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000), *n* is the number of rounds played. Then follow *n* lines, containing the information about the rounds in "name score" format in chronological order, where name is a string of lower-case Latin letters with the length from 1 to 32, and score is an integer number between -1000 and 1000, inclusive.
Output Specification:
Print the name of the winner.
Demo Input:
['3\nmike 3\nandrew 5\nmike 2\n', '3\nandrew 3\nandrew 2\nmike 5\n']
Demo Output:
['andrew\n', 'andrew\n']
Note:
none
|
```python
if __name__ == '__main__':
scores = {}
for n in range(int(input())):
split = input().split(' ')
if split[0] in scores.keys():
scores[split[0]] += int(split[1])
else:
scores[split[0]] = int(split[1])
sorted(scores.items(), key=lambda x: x[1])
print(next(iter(scores)))
```
| 0
|
977
|
C
|
Less or Equal
|
PROGRAMMING
| 1,200
|
[
"sortings"
] | null | null |
You are given a sequence of integers of length $n$ and integer number $k$. You should print any integer number $x$ in the range of $[1; 10^9]$ (i.e. $1 \le x \le 10^9$) such that exactly $k$ elements of given sequence are less than or equal to $x$.
Note that the sequence can contain equal elements.
If there is no such $x$, print "-1" (without quotes).
|
The first line of the input contains integer numbers $n$ and $k$ ($1 \le n \le 2 \cdot 10^5$, $0 \le k \le n$). The second line of the input contains $n$ integer numbers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) — the sequence itself.
|
Print any integer number $x$ from range $[1; 10^9]$ such that exactly $k$ elements of given sequence is less or equal to $x$.
If there is no such $x$, print "-1" (without quotes).
|
[
"7 4\n3 7 5 1 10 3 20\n",
"7 2\n3 7 5 1 10 3 20\n"
] |
[
"6",
"-1\n"
] |
In the first example $5$ is also a valid answer because the elements with indices $[1, 3, 4, 6]$ is less than or equal to $5$ and obviously less than or equal to $6$.
In the second example you cannot choose any number that only $2$ elements of the given sequence will be less than or equal to this number because $3$ elements of the given sequence will be also less than or equal to this number.
| 0
|
[
{
"input": "7 4\n3 7 5 1 10 3 20",
"output": "5"
},
{
"input": "7 2\n3 7 5 1 10 3 20",
"output": "-1"
},
{
"input": "1 0\n1",
"output": "-1"
},
{
"input": "1 0\n2",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "1000000000"
},
{
"input": "3 0\n3 3 3",
"output": "2"
},
{
"input": "3 0\n2 2 3",
"output": "1"
},
{
"input": "5 0\n3 4 5 6 7",
"output": "2"
},
{
"input": "4 0\n2 3 4 5",
"output": "1"
},
{
"input": "2 2\n1000000000 1000000000",
"output": "1000000000"
},
{
"input": "7 2\n2 7 5 1 10 2 20",
"output": "-1"
},
{
"input": "2 1\n1 1",
"output": "-1"
},
{
"input": "5 3\n1 3 3 4 5",
"output": "3"
},
{
"input": "4 4\n1000000000 1000000000 1000000000 1000000000",
"output": "1000000000"
}
] | 1,695,090,095
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 38
| 140
| 26,726,400
|
n,k = map(int, input().split())
a = list(map(int, input().split()))
a.sort()
if k == 0:
print(a[0] - 1 if a[0] - 1 > 0 else -1)
elif n == k:
print(a[-1])
else:
if a[k-1] < a[k]:
print(a[k-1])
else:
print(-1)
|
Title: Less or Equal
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence of integers of length $n$ and integer number $k$. You should print any integer number $x$ in the range of $[1; 10^9]$ (i.e. $1 \le x \le 10^9$) such that exactly $k$ elements of given sequence are less than or equal to $x$.
Note that the sequence can contain equal elements.
If there is no such $x$, print "-1" (without quotes).
Input Specification:
The first line of the input contains integer numbers $n$ and $k$ ($1 \le n \le 2 \cdot 10^5$, $0 \le k \le n$). The second line of the input contains $n$ integer numbers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) — the sequence itself.
Output Specification:
Print any integer number $x$ from range $[1; 10^9]$ such that exactly $k$ elements of given sequence is less or equal to $x$.
If there is no such $x$, print "-1" (without quotes).
Demo Input:
['7 4\n3 7 5 1 10 3 20\n', '7 2\n3 7 5 1 10 3 20\n']
Demo Output:
['6', '-1\n']
Note:
In the first example $5$ is also a valid answer because the elements with indices $[1, 3, 4, 6]$ is less than or equal to $5$ and obviously less than or equal to $6$.
In the second example you cannot choose any number that only $2$ elements of the given sequence will be less than or equal to this number because $3$ elements of the given sequence will be also less than or equal to this number.
|
```python
n,k = map(int, input().split())
a = list(map(int, input().split()))
a.sort()
if k == 0:
print(a[0] - 1 if a[0] - 1 > 0 else -1)
elif n == k:
print(a[-1])
else:
if a[k-1] < a[k]:
print(a[k-1])
else:
print(-1)
```
| 3
|
|
847
|
G
|
University Classes
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
There are *n* student groups at the university. During the study day, each group can take no more than 7 classes. Seven time slots numbered from 1 to 7 are allocated for the classes.
The schedule on Monday is known for each group, i. e. time slots when group will have classes are known.
Your task is to determine the minimum number of rooms needed to hold classes for all groups on Monday. Note that one room can hold at most one group class in a single time slot.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of groups.
Each of the following *n* lines contains a sequence consisting of 7 zeroes and ones — the schedule of classes on Monday for a group. If the symbol in a position equals to 1 then the group has class in the corresponding time slot. In the other case, the group has no class in the corresponding time slot.
|
Print minimum number of rooms needed to hold all groups classes on Monday.
|
[
"2\n0101010\n1010101\n",
"3\n0101011\n0011001\n0110111\n"
] |
[
"1\n",
"3\n"
] |
In the first example one room is enough. It will be occupied in each of the seven time slot by the first group or by the second group.
In the second example three rooms is enough, because in the seventh time slot all three groups have classes.
| 0
|
[
{
"input": "2\n0101010\n1010101",
"output": "1"
},
{
"input": "3\n0101011\n0011001\n0110111",
"output": "3"
},
{
"input": "1\n0111000",
"output": "1"
},
{
"input": "1\n0000000",
"output": "0"
},
{
"input": "1\n1111111",
"output": "1"
},
{
"input": "2\n1000000\n0101000",
"output": "1"
},
{
"input": "3\n0101111\n1101011\n1010011",
"output": "3"
},
{
"input": "5\n0100101\n0000001\n0110000\n0010000\n0011110",
"output": "3"
},
{
"input": "6\n1101110\n1111011\n1101110\n0100011\n1110110\n1110100",
"output": "6"
},
{
"input": "10\n0000000\n0010000\n0000000\n0000010\n0000000\n0100001\n1000000\n0000000\n0000000\n0000000",
"output": "1"
},
{
"input": "20\n1111111\n1101011\n1111011\n0111111\n1111111\n1110111\n1111111\n1111111\n1111111\n1111111\n1110111\n1111111\n0111111\n1011111\n1111111\n1111111\n1101110\n1111111\n1111111\n1111111",
"output": "20"
}
] | 1,544,797,451
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 124
| 102,400
|
print(max([sum(x) for x in list(zip(*[list(map(int,list(input()))) for x in range(int(input()))]))]))
|
Title: University Classes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* student groups at the university. During the study day, each group can take no more than 7 classes. Seven time slots numbered from 1 to 7 are allocated for the classes.
The schedule on Monday is known for each group, i. e. time slots when group will have classes are known.
Your task is to determine the minimum number of rooms needed to hold classes for all groups on Monday. Note that one room can hold at most one group class in a single time slot.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of groups.
Each of the following *n* lines contains a sequence consisting of 7 zeroes and ones — the schedule of classes on Monday for a group. If the symbol in a position equals to 1 then the group has class in the corresponding time slot. In the other case, the group has no class in the corresponding time slot.
Output Specification:
Print minimum number of rooms needed to hold all groups classes on Monday.
Demo Input:
['2\n0101010\n1010101\n', '3\n0101011\n0011001\n0110111\n']
Demo Output:
['1\n', '3\n']
Note:
In the first example one room is enough. It will be occupied in each of the seven time slot by the first group or by the second group.
In the second example three rooms is enough, because in the seventh time slot all three groups have classes.
|
```python
print(max([sum(x) for x in list(zip(*[list(map(int,list(input()))) for x in range(int(input()))]))]))
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
|
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
|
[
"4\n1 3 2 0\n",
"7\n1 3 3 2 1 2 3\n",
"2\n2 2\n"
] |
[
"2\n",
"0\n",
"1\n"
] |
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
| 0
|
[
{
"input": "4\n1 3 2 0",
"output": "2"
},
{
"input": "7\n1 3 3 2 1 2 3",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "10\n0 0 1 1 0 0 0 0 1 0",
"output": "8"
},
{
"input": "100\n3 2 3 3 3 2 3 1 3 2 2 3 2 3 3 3 3 3 3 1 2 2 3 1 3 3 2 2 2 3 1 0 3 3 3 2 3 3 1 1 3 1 3 3 3 1 3 1 3 0 1 3 2 3 2 1 1 3 2 3 3 3 2 3 1 3 3 3 3 2 2 2 1 3 1 3 3 3 3 1 3 2 3 3 0 3 3 3 3 3 1 0 2 1 3 3 0 2 3 3",
"output": "16"
},
{
"input": "10\n2 3 0 1 3 1 2 2 1 0",
"output": "3"
},
{
"input": "45\n3 3 2 3 2 3 3 3 0 3 3 3 3 3 3 3 1 3 2 3 2 3 2 2 2 3 2 3 3 3 3 3 1 2 3 3 2 2 2 3 3 3 3 1 3",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1 3",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n3 3",
"output": "0"
},
{
"input": "3\n3 3 3",
"output": "0"
},
{
"input": "2\n3 2",
"output": "0"
},
{
"input": "2\n0 2",
"output": "1"
},
{
"input": "10\n2 2 3 3 3 3 2 1 3 2",
"output": "2"
},
{
"input": "15\n0 1 0 0 0 2 0 1 0 0 0 2 0 0 0",
"output": "11"
},
{
"input": "15\n1 3 2 2 2 3 3 3 3 2 3 2 2 1 1",
"output": "4"
},
{
"input": "15\n3 1 3 2 3 2 2 2 3 3 3 3 2 3 2",
"output": "3"
},
{
"input": "20\n0 2 0 1 0 0 0 1 2 0 1 1 1 0 1 1 0 1 1 0",
"output": "12"
},
{
"input": "20\n2 3 2 3 3 3 3 2 0 3 1 1 2 3 0 3 2 3 0 3",
"output": "5"
},
{
"input": "20\n3 3 3 3 2 3 3 2 1 3 3 2 2 2 3 2 2 2 2 2",
"output": "4"
},
{
"input": "25\n0 0 1 0 0 1 0 0 1 0 0 1 0 2 0 0 2 0 0 1 0 2 0 1 1",
"output": "16"
},
{
"input": "25\n1 3 3 2 2 3 3 3 3 3 1 2 2 3 2 0 2 1 0 1 3 2 2 3 3",
"output": "5"
},
{
"input": "25\n2 3 1 3 3 2 1 3 3 3 1 3 3 1 3 2 3 3 1 3 3 3 2 3 3",
"output": "3"
},
{
"input": "30\n0 0 1 0 1 0 1 1 0 0 0 0 0 0 1 0 0 1 1 0 0 2 0 0 1 1 2 0 0 0",
"output": "22"
},
{
"input": "30\n1 1 3 2 2 0 3 2 3 3 1 2 0 1 1 2 3 3 2 3 1 3 2 3 0 2 0 3 3 2",
"output": "9"
},
{
"input": "30\n1 2 3 2 2 3 3 3 3 3 3 3 3 3 3 1 2 2 3 2 3 3 3 2 1 3 3 3 1 3",
"output": "2"
},
{
"input": "35\n0 1 1 0 0 2 0 0 1 0 0 0 1 0 1 0 1 0 0 0 1 2 1 0 2 2 1 0 1 0 1 1 1 0 0",
"output": "21"
},
{
"input": "35\n2 2 0 3 2 2 0 3 3 1 1 3 3 1 2 2 0 2 2 2 2 3 1 0 2 1 3 2 2 3 2 3 3 1 2",
"output": "11"
},
{
"input": "35\n1 2 2 3 3 3 3 3 2 2 3 3 2 3 3 2 3 2 3 3 2 2 2 3 3 2 3 3 3 1 3 3 2 2 2",
"output": "7"
},
{
"input": "40\n2 0 1 1 0 0 0 0 2 0 1 1 1 0 0 1 0 0 0 0 0 2 0 0 0 2 1 1 1 3 0 0 0 0 0 0 0 1 1 0",
"output": "28"
},
{
"input": "40\n2 2 3 2 0 2 3 2 1 2 3 0 2 3 2 1 1 3 1 1 0 2 3 1 3 3 1 1 3 3 2 2 1 3 3 3 2 3 3 1",
"output": "10"
},
{
"input": "40\n1 3 2 3 3 2 3 3 2 2 3 1 2 1 2 2 3 1 2 2 1 2 2 2 1 2 2 3 2 3 2 3 2 3 3 3 1 3 2 3",
"output": "8"
},
{
"input": "45\n2 1 0 0 0 2 1 0 1 0 0 2 2 1 1 0 0 2 0 0 0 0 0 0 1 0 0 2 0 0 1 1 0 0 1 0 0 1 1 2 0 0 2 0 2",
"output": "29"
},
{
"input": "45\n3 3 2 3 3 3 2 2 3 2 3 1 3 2 3 2 2 1 1 3 2 3 2 1 3 1 2 3 2 2 0 3 3 2 3 2 3 2 3 2 0 3 1 1 3",
"output": "8"
},
{
"input": "50\n3 0 0 0 2 0 0 0 0 0 0 0 2 1 0 2 0 1 0 1 3 0 2 1 1 0 0 1 1 0 0 1 2 1 1 2 1 1 0 0 0 0 0 0 0 1 2 2 0 0",
"output": "32"
},
{
"input": "50\n3 3 3 3 1 0 3 3 0 2 3 1 1 1 3 2 3 3 3 3 3 1 0 1 2 2 3 3 2 3 0 0 0 2 1 0 1 2 2 2 2 0 2 2 2 1 2 3 3 2",
"output": "16"
},
{
"input": "50\n3 2 3 1 2 1 2 3 3 2 3 3 2 1 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 2 3 3 3 3 2 3 1 2 3 3 2 3 3 1 2 2 1 1 3 3",
"output": "7"
},
{
"input": "55\n0 0 1 1 0 1 0 0 1 0 1 0 0 0 2 0 0 1 0 0 0 1 0 0 0 0 3 1 0 0 0 1 0 0 0 0 2 0 0 0 2 0 2 1 0 0 0 0 0 0 0 0 2 0 0",
"output": "40"
},
{
"input": "55\n3 0 3 3 3 2 0 2 3 0 3 2 3 3 0 3 3 1 3 3 1 2 3 2 0 3 3 2 1 2 3 2 3 0 3 2 2 1 2 3 2 2 1 3 2 2 3 1 3 2 2 3 3 2 2",
"output": "13"
},
{
"input": "55\n3 3 1 3 2 3 2 3 2 2 3 3 3 3 3 1 1 3 3 2 3 2 3 2 0 1 3 3 3 3 2 3 2 3 1 1 2 2 2 3 3 3 3 3 2 2 2 3 2 3 3 3 3 1 3",
"output": "7"
},
{
"input": "60\n0 1 0 0 0 0 0 0 0 2 1 1 3 0 0 0 0 0 1 0 1 1 0 0 0 3 0 1 0 1 0 2 0 0 0 0 0 1 0 0 0 0 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 0 0",
"output": "44"
},
{
"input": "60\n3 2 1 3 2 2 3 3 3 1 1 3 2 2 3 3 1 3 2 2 3 3 2 2 2 2 0 2 2 3 2 3 0 3 3 3 2 3 3 0 1 3 2 1 3 1 1 2 1 3 1 1 2 2 1 3 3 3 2 2",
"output": "15"
},
{
"input": "60\n3 2 2 3 2 3 2 3 3 2 3 2 3 3 2 3 3 3 3 3 3 2 3 3 1 2 3 3 3 2 1 3 3 1 3 1 3 0 3 3 3 2 3 2 3 2 3 3 1 1 2 3 3 3 3 2 1 3 2 3",
"output": "8"
},
{
"input": "65\n1 0 2 1 1 0 1 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 0 1 2 0 2 1 0 2 1 0 1 0 1 1 0 1 1 1 2 1 0 1 0 0 0 0 1 2 2 1 0 0 1 2 1 2 0 2 0 0 0 1 1",
"output": "35"
},
{
"input": "65\n2 2 2 3 0 2 1 2 3 3 1 3 1 2 1 3 2 3 2 2 2 1 2 0 3 1 3 1 1 3 1 3 3 3 3 3 1 3 0 3 1 3 1 2 2 3 2 0 3 1 3 2 1 2 2 2 3 3 2 3 3 3 2 2 3",
"output": "13"
},
{
"input": "65\n3 2 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 3 3 2 2 2 3 3 2 3 3 2 3 3 3 3 2 3 3 3 2 2 3 3 3 3 3 3 2 2 3 3 2 3 3 1 3 3 3 3",
"output": "6"
},
{
"input": "70\n1 0 0 0 1 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 1 1 1 3 1 1 0 1 2 0 2 1 0 0 0 1 1 1 1 1 0 0 1 0 0 0 1 1 1 3 0 0 1 0 0 0 1 0 0 0 0 0 1 0 1 1",
"output": "43"
},
{
"input": "70\n2 3 3 3 1 3 3 1 2 1 1 2 2 3 0 2 3 3 1 3 3 2 2 3 3 3 2 2 2 2 1 3 3 0 2 1 1 3 2 3 3 2 2 3 1 3 1 2 3 2 3 3 2 2 2 3 1 1 2 1 3 3 2 2 3 3 3 1 1 1",
"output": "16"
},
{
"input": "70\n3 3 2 2 1 2 1 2 2 2 2 2 3 3 2 3 3 3 3 2 2 2 2 3 3 3 1 3 3 3 2 3 3 3 3 2 3 3 1 3 1 3 2 3 3 2 3 3 3 2 3 2 3 3 1 2 3 3 2 2 2 3 2 3 3 3 3 3 3 1",
"output": "10"
},
{
"input": "75\n1 0 0 1 1 0 0 1 0 1 2 0 0 2 1 1 0 0 0 0 0 0 2 1 1 0 0 0 0 1 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 0 0 1 2 1 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 1 1 1 0 1 0",
"output": "51"
},
{
"input": "75\n1 3 3 3 1 1 3 2 3 3 1 3 3 3 2 1 3 2 2 3 1 1 1 1 1 1 2 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 2 2 2 1 2 3 3 2 2 3 0 1 1 3 3 0 0 1 1 3 2 3 3 3 3 1 2 2 3 3 3 3 1",
"output": "16"
},
{
"input": "75\n3 3 3 3 2 2 3 2 2 3 2 2 1 2 3 3 2 2 3 3 1 2 2 2 1 3 3 3 1 2 2 3 3 3 2 3 2 2 2 3 3 1 3 2 2 3 3 3 0 3 2 1 3 3 2 3 3 3 3 1 2 3 3 3 2 2 3 3 3 3 2 2 3 3 1",
"output": "11"
},
{
"input": "80\n0 0 0 0 2 0 1 1 1 1 1 0 0 0 0 2 0 0 1 0 0 0 0 1 1 0 2 2 1 1 0 1 0 1 0 1 1 1 0 1 2 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0 2 2 0 1 1 0 0 0 0 0 0 0 0 1",
"output": "56"
},
{
"input": "80\n2 2 3 3 2 1 0 1 0 3 2 2 3 2 1 3 1 3 3 2 3 3 3 2 3 3 3 2 1 3 3 1 3 3 3 3 3 3 2 2 2 1 3 2 1 3 2 1 1 0 1 1 2 1 3 0 1 2 3 2 2 3 2 3 1 3 3 2 1 1 0 3 3 3 3 1 2 1 2 0",
"output": "17"
},
{
"input": "80\n2 3 3 2 2 2 3 3 2 3 3 3 3 3 2 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 1 3 2 3 3 0 3 1 2 3 3 1 2 3 2 3 3 2 3 3 3 3 3 2 2 3 0 3 3 3 3 3 2 2 3 2 3 3 3 3 3 2 3 2 3 3 3 3 2 3",
"output": "9"
},
{
"input": "85\n0 1 1 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 2 0 1 0 0 2 0 1 1 0 0 0 0 2 2 0 0 0 1 0 0 0 1 2 0 1 0 0 0 2 1 1 2 0 3 1 0 2 2 1 0 0 1 1 0 0 0 0 1 0 2 1 1 2 1 0 0 1 2 1 2 0 0 1 0 1 0",
"output": "54"
},
{
"input": "85\n2 3 1 3 2 3 1 3 3 2 1 2 1 2 2 3 2 2 3 2 0 3 3 2 1 2 2 2 3 3 2 3 3 3 2 1 1 3 1 3 2 2 2 3 3 2 3 2 3 1 1 3 2 3 1 3 3 2 3 3 2 2 3 0 1 1 2 2 2 2 1 2 3 1 3 3 1 3 2 2 3 2 3 3 3",
"output": "19"
},
{
"input": "85\n1 2 1 2 3 2 3 3 3 3 3 3 3 2 1 3 2 3 3 3 3 2 3 3 3 1 3 3 3 3 2 3 3 3 3 3 3 2 2 1 3 3 3 3 2 2 3 1 1 2 3 3 3 2 3 3 3 3 3 2 3 3 3 2 2 3 3 1 1 1 3 3 3 3 1 3 3 3 1 3 3 1 3 2 3",
"output": "9"
},
{
"input": "90\n2 0 1 0 0 0 0 0 0 1 1 2 0 0 0 0 0 0 0 2 2 0 2 0 0 2 1 0 2 0 1 0 1 0 0 1 2 2 0 0 1 0 0 1 0 1 0 2 0 1 1 1 0 1 1 0 1 0 2 0 1 0 1 0 0 0 1 0 0 1 2 0 0 0 1 0 0 2 2 0 0 0 0 0 1 3 1 1 0 1",
"output": "57"
},
{
"input": "90\n2 3 3 3 2 3 2 1 3 0 3 2 3 3 2 1 3 3 2 3 2 3 3 2 1 3 1 3 3 1 2 2 3 3 2 1 2 3 2 3 0 3 3 2 2 3 1 0 3 3 1 3 3 3 3 2 1 2 2 1 3 2 1 3 3 1 2 0 2 2 3 2 2 3 3 3 1 3 2 1 2 3 3 2 3 2 3 3 2 1",
"output": "17"
},
{
"input": "90\n2 3 2 3 2 2 3 3 2 3 2 1 2 3 3 3 2 3 2 3 3 2 3 3 3 1 3 3 1 3 2 3 2 2 1 3 3 3 3 3 3 3 3 3 3 2 3 2 3 2 1 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 1 3 2 3 3 3 2 2 3 2 3 2 1 3 2",
"output": "9"
},
{
"input": "95\n0 0 3 0 2 0 1 0 0 2 0 0 0 0 0 0 0 1 0 0 0 2 0 0 0 0 0 1 0 0 2 1 0 0 1 0 0 0 1 0 0 0 0 1 0 1 0 0 1 0 1 2 0 1 2 2 0 0 1 0 2 0 0 0 1 0 2 1 2 1 0 1 0 0 0 1 0 0 1 1 2 1 1 1 1 2 0 0 0 0 0 1 1 0 1",
"output": "61"
},
{
"input": "95\n2 3 3 2 1 1 3 3 3 2 3 3 3 2 3 2 3 3 3 2 3 2 2 3 3 2 1 2 3 3 3 1 3 0 3 3 1 3 3 1 0 1 3 3 3 0 2 1 3 3 3 3 0 1 3 2 3 3 2 1 3 1 2 1 1 2 3 0 3 3 2 1 3 2 1 3 3 3 2 2 3 2 3 3 3 2 1 3 3 3 2 3 3 1 2",
"output": "15"
},
{
"input": "95\n2 3 3 2 3 2 2 1 3 1 2 1 2 3 1 2 3 3 1 3 3 3 1 2 3 2 2 2 2 3 3 3 2 2 3 3 3 3 3 1 2 2 3 3 3 3 2 3 2 2 2 3 3 2 3 3 3 3 3 3 3 0 3 2 0 3 3 1 3 3 3 2 3 2 3 2 3 3 3 3 2 2 1 1 3 3 3 3 3 1 3 3 3 3 2",
"output": "14"
},
{
"input": "100\n1 0 2 0 0 0 0 2 0 0 0 1 0 1 0 0 1 0 1 2 0 1 1 0 0 1 0 1 1 0 0 0 2 0 1 0 0 2 0 0 0 0 0 1 1 1 0 0 1 0 2 0 0 0 0 1 0 1 0 1 0 1 0 1 2 2 0 0 2 0 1 0 1 0 1 0 0 0 1 0 0 2 1 1 1 0 0 1 0 0 0 2 0 0 2 1 1 0 0 2",
"output": "63"
},
{
"input": "100\n3 2 1 3 2 3 2 3 2 2 3 1 3 3 3 3 3 2 2 3 2 2 3 2 3 3 3 2 3 1 2 1 3 3 3 3 1 3 3 3 3 3 2 3 2 1 3 3 1 2 2 3 1 3 3 1 2 2 1 3 1 3 2 2 3 3 1 3 2 3 1 2 1 2 3 3 2 2 1 2 3 3 3 3 3 1 3 3 3 3 2 1 3 0 3 3 3 2 3 3",
"output": "15"
},
{
"input": "100\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "0"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "49"
},
{
"input": "100\n2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "2\n0 3",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "1"
},
{
"input": "2\n2 1",
"output": "0"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "2\n3 0",
"output": "1"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "100\n3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0",
"output": "50"
}
] | 1,650,971,128
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 30
| 0
|
# ai equals 0, if on the i-th day of vacations the gym is closed and the contest is not carried out;
# ai equals 1, if on the i-th day of vacations the gym is closed, but the contest is carried out;
# ai equals 2, if on the i-th day of vacations the gym is open and the contest is not carried out;
# ai equals 3, if on the i-th day of vacations the gym is open and the contest is carried out.
n = int(input())
# arr = [0] * 110
arr = [int(x) for x in input().split()]
# for i in range(1, n+1):
# arr[i] = l[i-1]
dp = [[0 for _ in range(3)] for _ in range(n)]
dp[0][0] = 0
if arr[0] == 1:
dp[0][2] = 1
elif arr[0] == 2:
dp[0][1] = 1
else:
dp[0][1] = 1
dp[0][2] = 1
for i in range(1, n):
dp[i][0] = max(dp[i-1][0], dp[i-1][1], dp[i-1][2])
if arr[i] == 1:
dp[i][2] = 1 + max(dp[i-1][0], dp[i-1][1])
if arr[i] == 2:
dp[i][1] = 1 + max(dp[i - 1][0], dp[i - 1][2])
if arr[i] == 3:
dp[i][1] = 1 + max(dp[i - 1][0], dp[i - 1][2])
dp[i][2] = 1 + max(dp[i-1][0], dp[i-1][1])
# print(dp)
ans = max(dp[n-1][0], dp[n-1][1], dp[n-1][2])
print(n-ans)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
Output Specification:
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
Demo Input:
['4\n1 3 2 0\n', '7\n1 3 3 2 1 2 3\n', '2\n2 2\n']
Demo Output:
['2\n', '0\n', '1\n']
Note:
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
|
```python
# ai equals 0, if on the i-th day of vacations the gym is closed and the contest is not carried out;
# ai equals 1, if on the i-th day of vacations the gym is closed, but the contest is carried out;
# ai equals 2, if on the i-th day of vacations the gym is open and the contest is not carried out;
# ai equals 3, if on the i-th day of vacations the gym is open and the contest is carried out.
n = int(input())
# arr = [0] * 110
arr = [int(x) for x in input().split()]
# for i in range(1, n+1):
# arr[i] = l[i-1]
dp = [[0 for _ in range(3)] for _ in range(n)]
dp[0][0] = 0
if arr[0] == 1:
dp[0][2] = 1
elif arr[0] == 2:
dp[0][1] = 1
else:
dp[0][1] = 1
dp[0][2] = 1
for i in range(1, n):
dp[i][0] = max(dp[i-1][0], dp[i-1][1], dp[i-1][2])
if arr[i] == 1:
dp[i][2] = 1 + max(dp[i-1][0], dp[i-1][1])
if arr[i] == 2:
dp[i][1] = 1 + max(dp[i - 1][0], dp[i - 1][2])
if arr[i] == 3:
dp[i][1] = 1 + max(dp[i - 1][0], dp[i - 1][2])
dp[i][2] = 1 + max(dp[i-1][0], dp[i-1][1])
# print(dp)
ans = max(dp[n-1][0], dp[n-1][1], dp[n-1][2])
print(n-ans)
```
| 0
|
|
116
|
A
|
Tram
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
|
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
|
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
|
[
"4\n0 3\n2 5\n4 2\n4 0\n"
] |
[
"6\n"
] |
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
| 500
|
[
{
"input": "4\n0 3\n2 5\n4 2\n4 0",
"output": "6"
},
{
"input": "5\n0 4\n4 6\n6 5\n5 4\n4 0",
"output": "6"
},
{
"input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0",
"output": "18"
},
{
"input": "3\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "4\n0 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "5\n0 73\n73 189\n189 766\n766 0\n0 0",
"output": "766"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0",
"output": "1011"
},
{
"input": "5\n0 1\n1 2\n2 1\n1 2\n2 0",
"output": "2"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0",
"output": "22"
},
{
"input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0",
"output": "1776"
},
{
"input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0",
"output": "1016"
},
{
"input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0",
"output": "3"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0",
"output": "2071"
},
{
"input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0",
"output": "3"
},
{
"input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0",
"output": "1329"
},
{
"input": "2\n0 863\n863 0",
"output": "863"
},
{
"input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0",
"output": "8"
},
{
"input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0",
"output": "11"
},
{
"input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0",
"output": "7"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 900\n900 0",
"output": "900"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1000\n1000 0",
"output": "1000"
},
{
"input": "3\n0 802\n175 188\n815 0",
"output": "815"
},
{
"input": "3\n0 910\n910 976\n976 0",
"output": "976"
},
{
"input": "3\n0 2\n2 1\n1 0",
"output": "2"
}
] | 1,693,630,322
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 71
| 186
| 1,638,400
|
# Read the input values
n = int(input())
passenger_capacity = 0
max_capacity = 0
# Simulate the process at each stop
for _ in range(n):
passengers_exit, passengers_enter = map(int, input().split())
passenger_capacity = passenger_capacity - passengers_exit + passengers_enter
max_capacity = max(max_capacity, passenger_capacity)
# Print the maximum capacity observed during the journey
print(max_capacity)
|
Title: Tram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
Input Specification:
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Output Specification:
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
Demo Input:
['4\n0 3\n2 5\n4 2\n4 0\n']
Demo Output:
['6\n']
Note:
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
|
```python
# Read the input values
n = int(input())
passenger_capacity = 0
max_capacity = 0
# Simulate the process at each stop
for _ in range(n):
passengers_exit, passengers_enter = map(int, input().split())
passenger_capacity = passenger_capacity - passengers_exit + passengers_enter
max_capacity = max(max_capacity, passenger_capacity)
# Print the maximum capacity observed during the journey
print(max_capacity)
```
| 3
|
|
452
|
A
|
Eevee
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon.
You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.
|
First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string.
Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).
|
Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).
|
[
"7\nj......\n",
"7\n...feon\n",
"7\n.l.r.o.\n"
] |
[
"jolteon\n",
"leafeon\n",
"flareon\n"
] |
Here's a set of names in a form you can paste into your solution:
["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
{"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
| 500
|
[
{
"input": "7\n...feon",
"output": "leafeon"
},
{
"input": "7\n.l.r.o.",
"output": "flareon"
},
{
"input": "6\n.s..o.",
"output": "espeon"
},
{
"input": "7\nglaceon",
"output": "glaceon"
},
{
"input": "8\n.a.o.e.n",
"output": "vaporeon"
},
{
"input": "7\n.laceon",
"output": "glaceon"
},
{
"input": "7\n..lveon",
"output": "sylveon"
},
{
"input": "7\n.l.ceon",
"output": "glaceon"
},
{
"input": "7\n..areon",
"output": "flareon"
}
] | 1,629,015,517
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 17
| 77
| 6,963,200
|
l=[["espeon"],[ "jolteon","flareon","umbreon","leafeon","glaceon","sylveon"],["vaporeon"]]
n=int(input())
s=input()
if n==6:
print(l[0][0])
elif n==8:
print(l[2][0])
else:
t=l[1]
if s[0]!='.':
for i in t:
if s[0]==i[0]:
print(i)
break
elif s[1]!='.':
if s[1]=='l':
if s[3]=='r':
print(t[1])
else:
print(t[4])
else:
for i in t:
if s[1]==i[1]:
print(i)
break
elif s[2]!='.':
if s[2]=='l':
if s[3]=='t':
print(t[0])
else:
print(t[5])
elif s[2]=='a':
if s[3]=='r':print(t[2])
elif s[3]=='f':print(t[3])
else:print(t[4])
else:
for i in t:
if s[2]==i[2]:
print(i)
break
elif s[3]!='.':
for i in t:
if s[3]==i[3]:
print(i)
break
|
Title: Eevee
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are solving the crossword problem K from IPSC 2014. You solved all the clues except for one: who does Eevee evolve into? You are not very into pokemons, but quick googling helped you find out, that Eevee can evolve into eight different pokemons: Vaporeon, Jolteon, Flareon, Espeon, Umbreon, Leafeon, Glaceon, and Sylveon.
You know the length of the word in the crossword, and you already know some letters. Designers of the crossword made sure that the answer is unambiguous, so you can assume that exactly one pokemon out of the 8 that Eevee evolves into fits the length and the letters given. Your task is to find it.
Input Specification:
First line contains an integer *n* (6<=≤<=*n*<=≤<=8) – the length of the string.
Next line contains a string consisting of *n* characters, each of which is either a lower case english letter (indicating a known letter) or a dot character (indicating an empty cell in the crossword).
Output Specification:
Print a name of the pokemon that Eevee can evolve into that matches the pattern in the input. Use lower case letters only to print the name (in particular, do not capitalize the first letter).
Demo Input:
['7\nj......\n', '7\n...feon\n', '7\n.l.r.o.\n']
Demo Output:
['jolteon\n', 'leafeon\n', 'flareon\n']
Note:
Here's a set of names in a form you can paste into your solution:
["vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"]
{"vaporeon", "jolteon", "flareon", "espeon", "umbreon", "leafeon", "glaceon", "sylveon"}
|
```python
l=[["espeon"],[ "jolteon","flareon","umbreon","leafeon","glaceon","sylveon"],["vaporeon"]]
n=int(input())
s=input()
if n==6:
print(l[0][0])
elif n==8:
print(l[2][0])
else:
t=l[1]
if s[0]!='.':
for i in t:
if s[0]==i[0]:
print(i)
break
elif s[1]!='.':
if s[1]=='l':
if s[3]=='r':
print(t[1])
else:
print(t[4])
else:
for i in t:
if s[1]==i[1]:
print(i)
break
elif s[2]!='.':
if s[2]=='l':
if s[3]=='t':
print(t[0])
else:
print(t[5])
elif s[2]=='a':
if s[3]=='r':print(t[2])
elif s[3]=='f':print(t[3])
else:print(t[4])
else:
for i in t:
if s[2]==i[2]:
print(i)
break
elif s[3]!='.':
for i in t:
if s[3]==i[3]:
print(i)
break
```
| 0
|
|
181
|
A
|
Series of Crimes
|
PROGRAMMING
| 800
|
[
"brute force",
"geometry",
"implementation"
] | null | null |
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang.
The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital.
The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map.
Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
|
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly.
Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".".
It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
|
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
|
[
"3 2\n.*\n..\n**\n",
"3 3\n*.*\n*..\n...\n"
] |
[
"1 1\n",
"2 3\n"
] |
none
| 500
|
[
{
"input": "3 2\n.*\n..\n**",
"output": "1 1"
},
{
"input": "2 5\n*....\n*...*",
"output": "1 5"
},
{
"input": "7 2\n..\n**\n..\n..\n..\n..\n.*",
"output": "7 1"
},
{
"input": "7 2\n*.\n..\n..\n..\n..\n..\n**",
"output": "1 2"
},
{
"input": "2 10\n*......*..\n.......*..",
"output": "2 1"
},
{
"input": "10 3\n*..\n...\n...\n...\n...\n...\n...\n...\n...\n**.",
"output": "1 2"
},
{
"input": "100 2\n*.\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n..\n**",
"output": "1 2"
},
{
"input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..",
"output": "99 2"
},
{
"input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**",
"output": "2 3"
},
{
"input": "99 3\n**.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n*..",
"output": "99 2"
},
{
"input": "98 3\n...\n.*.\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n...\n.**",
"output": "2 3"
},
{
"input": "2 100\n...................................................................................................*\n*..................................................................................................*",
"output": "1 1"
},
{
"input": "2 2\n*.\n**",
"output": "1 2"
},
{
"input": "2 2\n**\n.*",
"output": "2 1"
},
{
"input": "2 3\n*.*\n..*",
"output": "2 1"
}
] | 1,563,434,962
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
post, string = map(int, input().split())
stairs = []
cords = []
s = 0
position1 = 0
position2 = 0
position3 = 0
for i in range(post+1):
if s == 2:
for j in range(string):
Element = string1[j]
if Element == "*":
cords.append(j)
elif s == 1:
for j in range(string):
Element = string1[j]
if Element == "*":
position1 = j
stairs.append(s)
s = 0
if post == i:
break
string1 = input() #Считывает строку в столбе
for j in range(string):
Element = string1[j]ф
if Element == "*":
s+=1
for i in range(len(cords)):
if position1 != cords[i]:
position2 = cords[i]
break
for j in range(len(stairs)):
if j == 0 :
pass
else:
if stairs[j] == "1":
position3 == j
print(int(position2)+1, int(position3)+1)
|
Title: Series of Crimes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Berland capital is shaken with three bold crimes committed by the Pihsters, a notorious criminal gang.
The Berland capital's map is represented by an *n*<=×<=*m* rectangular table. Each cell of the table on the map represents some districts of the capital.
The capital's main detective Polycarpus took a map and marked there the districts where the first three robberies had been committed as asterisks. Deduction tells Polycarpus that the fourth robbery will be committed in such district, that all four robbed districts will form the vertices of some rectangle, parallel to the sides of the map.
Polycarpus is good at deduction but he's hopeless at math. So he asked you to find the district where the fourth robbery will be committed.
Input Specification:
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of rows and columns in the table, correspondingly.
Each of the next *n* lines contains *m* characters — the description of the capital's map. Each character can either be a "." (dot), or an "*" (asterisk). A character equals "*" if the corresponding district has been robbed. Otherwise, it equals ".".
It is guaranteed that the map has exactly three characters "*" and we can always find the fourth district that meets the problem requirements.
Output Specification:
Print two integers — the number of the row and the number of the column of the city district that is the fourth one to be robbed. The rows are numbered starting from one from top to bottom and the columns are numbered starting from one from left to right.
Demo Input:
['3 2\n.*\n..\n**\n', '3 3\n*.*\n*..\n...\n']
Demo Output:
['1 1\n', '2 3\n']
Note:
none
|
```python
post, string = map(int, input().split())
stairs = []
cords = []
s = 0
position1 = 0
position2 = 0
position3 = 0
for i in range(post+1):
if s == 2:
for j in range(string):
Element = string1[j]
if Element == "*":
cords.append(j)
elif s == 1:
for j in range(string):
Element = string1[j]
if Element == "*":
position1 = j
stairs.append(s)
s = 0
if post == i:
break
string1 = input() #Считывает строку в столбе
for j in range(string):
Element = string1[j]ф
if Element == "*":
s+=1
for i in range(len(cords)):
if position1 != cords[i]:
position2 = cords[i]
break
for j in range(len(stairs)):
if j == 0 :
pass
else:
if stairs[j] == "1":
position3 == j
print(int(position2)+1, int(position3)+1)
```
| -1
|
|
47
|
A
|
Triangular numbers
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Triangular numbers
|
2
|
256
|
A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number).
Your task is to find out if a given integer is a triangular number.
|
The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer.
|
If the given integer is a triangular number output YES, otherwise output NO.
|
[
"1\n",
"2\n",
"3\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "1",
"output": "YES"
},
{
"input": "2",
"output": "NO"
},
{
"input": "3",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "5",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "7",
"output": "NO"
},
{
"input": "8",
"output": "NO"
},
{
"input": "12",
"output": "NO"
},
{
"input": "10",
"output": "YES"
},
{
"input": "11",
"output": "NO"
},
{
"input": "9",
"output": "NO"
},
{
"input": "14",
"output": "NO"
},
{
"input": "15",
"output": "YES"
},
{
"input": "16",
"output": "NO"
},
{
"input": "20",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "22",
"output": "NO"
},
{
"input": "121",
"output": "NO"
},
{
"input": "135",
"output": "NO"
},
{
"input": "136",
"output": "YES"
},
{
"input": "137",
"output": "NO"
},
{
"input": "152",
"output": "NO"
},
{
"input": "153",
"output": "YES"
},
{
"input": "154",
"output": "NO"
},
{
"input": "171",
"output": "YES"
},
{
"input": "189",
"output": "NO"
},
{
"input": "190",
"output": "YES"
},
{
"input": "191",
"output": "NO"
},
{
"input": "210",
"output": "YES"
},
{
"input": "211",
"output": "NO"
},
{
"input": "231",
"output": "YES"
},
{
"input": "232",
"output": "NO"
},
{
"input": "252",
"output": "NO"
},
{
"input": "253",
"output": "YES"
},
{
"input": "254",
"output": "NO"
},
{
"input": "275",
"output": "NO"
},
{
"input": "276",
"output": "YES"
},
{
"input": "277",
"output": "NO"
},
{
"input": "299",
"output": "NO"
},
{
"input": "300",
"output": "YES"
},
{
"input": "301",
"output": "NO"
},
{
"input": "324",
"output": "NO"
},
{
"input": "325",
"output": "YES"
},
{
"input": "326",
"output": "NO"
},
{
"input": "350",
"output": "NO"
},
{
"input": "351",
"output": "YES"
},
{
"input": "352",
"output": "NO"
},
{
"input": "377",
"output": "NO"
},
{
"input": "378",
"output": "YES"
},
{
"input": "406",
"output": "YES"
},
{
"input": "434",
"output": "NO"
},
{
"input": "435",
"output": "YES"
},
{
"input": "464",
"output": "NO"
},
{
"input": "465",
"output": "YES"
},
{
"input": "495",
"output": "NO"
},
{
"input": "496",
"output": "YES"
},
{
"input": "497",
"output": "NO"
},
{
"input": "331",
"output": "NO"
},
{
"input": "413",
"output": "NO"
},
{
"input": "177",
"output": "NO"
},
{
"input": "122",
"output": "NO"
},
{
"input": "478",
"output": "NO"
},
{
"input": "188",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "474",
"output": "NO"
},
{
"input": "21",
"output": "YES"
},
{
"input": "48",
"output": "NO"
},
{
"input": "498",
"output": "NO"
},
{
"input": "499",
"output": "NO"
},
{
"input": "500",
"output": "NO"
}
] | 1,680,233,392
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 71
| 124
| 0
|
def st():return str(input())
def ls():return list(map(int, input().split()))
def mx(a):return max(a)
def it():return int(input())
def mn(a):return min(a)
def yes():return print('YES')
def no():return print('NO')
def re(a):return range(a)
def pr(a):return print(a)
def prs(a):return print(str(a))
def mapa():return map(int, input().split())
a = it()
s = 0
m = []
for i in range(1, a+1):
s += i
m.append(s)
if a in m:
yes()
else:
no()
|
Title: Triangular numbers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A triangular number is the number of dots in an equilateral triangle uniformly filled with dots. For example, three dots can be arranged in a triangle; thus three is a triangular number. The *n*-th triangular number is the number of dots in a triangle with *n* dots on a side. . You can learn more about these numbers from Wikipedia (http://en.wikipedia.org/wiki/Triangular_number).
Your task is to find out if a given integer is a triangular number.
Input Specification:
The first line contains the single number *n* (1<=≤<=*n*<=≤<=500) — the given integer.
Output Specification:
If the given integer is a triangular number output YES, otherwise output NO.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none
|
```python
def st():return str(input())
def ls():return list(map(int, input().split()))
def mx(a):return max(a)
def it():return int(input())
def mn(a):return min(a)
def yes():return print('YES')
def no():return print('NO')
def re(a):return range(a)
def pr(a):return print(a)
def prs(a):return print(str(a))
def mapa():return map(int, input().split())
a = it()
s = 0
m = []
for i in range(1, a+1):
s += i
m.append(s)
if a in m:
yes()
else:
no()
```
| 3.969
|
427
|
A
|
Police Recruits
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
|
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
|
Print a single integer, the number of crimes which will go untreated.
|
[
"3\n-1 -1 1\n",
"8\n1 -1 1 -1 -1 1 1 1\n",
"11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n"
] |
[
"2\n",
"1\n",
"8\n"
] |
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
| 500
|
[
{
"input": "3\n-1 -1 1",
"output": "2"
},
{
"input": "8\n1 -1 1 -1 -1 1 1 1",
"output": "1"
},
{
"input": "11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "8"
},
{
"input": "7\n-1 -1 1 1 -1 -1 1",
"output": "2"
},
{
"input": "21\n-1 -1 -1 -1 -1 3 2 -1 6 -1 -1 2 1 -1 2 2 1 6 5 -1 5",
"output": "5"
},
{
"input": "98\n-1 -1 1 -1 -1 -1 -1 1 -1 -1 1 -1 -1 1 -1 1 1 1 -1 1 1 1 1 1 -1 1 -1 -1 -1 -1 1 -1 -1 1 1 -1 1 1 1 -1 -1 -1 -1 -1 -1 1 -1 -1 -1 1 -1 1 -1 1 -1 1 1 1 1 1 1 1 -1 -1 1 1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 1 -1 1 1 1 -1 1 1 -1 -1 -1 1 1 1 -1 -1 -1 1 -1 1 1",
"output": "13"
},
{
"input": "3\n-1 5 4",
"output": "1"
},
{
"input": "146\n4 -1 -1 -1 -1 -1 -1 -1 -1 -1 4 -1 3 -1 3 -1 -1 1 4 -1 2 -1 -1 3 -1 -1 -1 4 1 -1 -1 -1 4 -1 -1 -1 -1 -1 -1 3 2 -1 3 2 4 5 2 4 1 5 -1 -1 2 -1 -1 1 -1 5 3 -1 1 2 2 3 5 3 -1 -1 3 -1 -1 3 5 5 -1 -1 5 -1 4 4 1 -1 -1 -1 2 1 -1 -1 -1 2 5 3 -1 -1 -1 3 -1 5 4 -1 1 -1 -1 3 -1 -1 3 1 1 2 -1 -1 -1 1 3 1 -1 2 -1 -1 5 5 -1 -1 3 4 5 1 -1 2 -1 -1 -1 3 -1 5 3 2 -1 2 -1 -1 5 -1 3 -1",
"output": "5"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n1 -1",
"output": "0"
},
{
"input": "2\n-1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n-1 -1",
"output": "2"
},
{
"input": "4\n10 -1 -1 -1",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "4\n-1 -1 1 1",
"output": "2"
}
] | 1,677,687,333
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 63
| 77
| 13,721,600
|
dl = int(input())
lista = input().split()
for i in range(dl):
lista[i] = int(lista[i])
wynik = 0
dostepni = 0
for i in range(dl):
if lista[i] > 0:
dostepni += lista[i]
else:
if dostepni <= 0:
wynik += 1
else:
dostepni -= 1
print(wynik)
|
Title: Police Recruits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The police department of your city has just started its journey. Initially, they don’t have any manpower. So, they started hiring new recruits in groups.
Meanwhile, crimes keeps occurring within the city. One member of the police force can investigate only one crime during his/her lifetime.
If there is no police officer free (isn't busy with crime) during the occurrence of a crime, it will go untreated.
Given the chronological order of crime occurrences and recruit hirings, find the number of crimes which will go untreated.
Input Specification:
The first line of input will contain an integer *n* (1<=≤<=*n*<=≤<=105), the number of events. The next line will contain *n* space-separated integers.
If the integer is -1 then it means a crime has occurred. Otherwise, the integer will be positive, the number of officers recruited together at that time. No more than 10 officers will be recruited at a time.
Output Specification:
Print a single integer, the number of crimes which will go untreated.
Demo Input:
['3\n-1 -1 1\n', '8\n1 -1 1 -1 -1 1 1 1\n', '11\n-1 -1 2 -1 -1 -1 -1 -1 -1 -1 -1\n']
Demo Output:
['2\n', '1\n', '8\n']
Note:
Lets consider the second example:
1. Firstly one person is hired. 1. Then crime appears, the last hired person will investigate this crime. 1. One more person is hired. 1. One more crime appears, the last hired person will investigate this crime. 1. Crime appears. There is no free policeman at the time, so this crime will go untreated. 1. One more person is hired. 1. One more person is hired. 1. One more person is hired.
The answer is one, as one crime (on step 5) will go untreated.
|
```python
dl = int(input())
lista = input().split()
for i in range(dl):
lista[i] = int(lista[i])
wynik = 0
dostepni = 0
for i in range(dl):
if lista[i] > 0:
dostepni += lista[i]
else:
if dostepni <= 0:
wynik += 1
else:
dostepni -= 1
print(wynik)
```
| 3
|
|
580
|
B
|
Kefa and Company
|
PROGRAMMING
| 1,500
|
[
"binary search",
"sortings",
"two pointers"
] | null | null |
Kefa wants to celebrate his first big salary by going to restaurant. However, he needs company.
Kefa has *n* friends, each friend will agree to go to the restaurant if Kefa asks. Each friend is characterized by the amount of money he has and the friendship factor in respect to Kefa. The parrot doesn't want any friend to feel poor compared to somebody else in the company (Kefa doesn't count). A friend feels poor if in the company there is someone who has at least *d* units of money more than he does. Also, Kefa wants the total friendship factor of the members of the company to be maximum. Help him invite an optimal company!
|
The first line of the input contains two space-separated integers, *n* and *d* (1<=≤<=*n*<=≤<=105, ) — the number of Kefa's friends and the minimum difference between the amount of money in order to feel poor, respectively.
Next *n* lines contain the descriptions of Kefa's friends, the (*i*<=+<=1)-th line contains the description of the *i*-th friend of type *m**i*, *s**i* (0<=≤<=*m**i*,<=*s**i*<=≤<=109) — the amount of money and the friendship factor, respectively.
|
Print the maximum total friendship factir that can be reached.
|
[
"4 5\n75 5\n0 100\n150 20\n75 1\n",
"5 100\n0 7\n11 32\n99 10\n46 8\n87 54\n"
] |
[
"100\n",
"111\n"
] |
In the first sample test the most profitable strategy is to form a company from only the second friend. At all other variants the total degree of friendship will be worse.
In the second sample test we can take all the friends.
| 1,250
|
[
{
"input": "4 5\n75 5\n0 100\n150 20\n75 1",
"output": "100"
},
{
"input": "5 100\n0 7\n11 32\n99 10\n46 8\n87 54",
"output": "111"
},
{
"input": "1 1000000000\n15 12",
"output": "12"
},
{
"input": "5 1\n5 9\n2 10\n8 5\n18 12\n1 1",
"output": "12"
},
{
"input": "3 3\n4 15\n0 17\n9 11",
"output": "17"
},
{
"input": "5 10\n8 90\n1009 1000000\n9 121\n10 298\n0 109092",
"output": "1000000"
},
{
"input": "5 9\n0 98\n2 1000000000\n8 1000000000\n5 999999999\n3 989898989",
"output": "3989899086"
},
{
"input": "4 2\n10909234 9\n10909236 8\n10909237 10\n10909235 98",
"output": "107"
},
{
"input": "3 1\n801 10101\n802 134509124\n801 1",
"output": "134509124"
},
{
"input": "4 1\n2 4\n2 2\n3 3\n3 3",
"output": "6"
},
{
"input": "8 5\n3 227589091\n12 131068951\n8 492784630\n20 918918112\n11 6972428\n20 585402296\n12 220234661\n1 225083234",
"output": "1504320408"
},
{
"input": "15 1234\n2738 322313356\n1160 970909702\n2594 902749351\n3126 324754476\n3151 177963947\n3424 396145897\n5578 737768323\n3423 687640543\n381 848813098\n1058 197211286\n936 650181776\n1025 776492538\n3598 142176544\n3595 680519527\n1191 32199940",
"output": "3634263641"
},
{
"input": "5 6\n5 11\n10 11\n11 11\n12 11\n100 1",
"output": "33"
},
{
"input": "7 6\n5 11\n9 11\n10 11\n11 11\n12 11\n13 11\n100 1",
"output": "55"
},
{
"input": "4 2\n1 1\n2 100\n3 100\n4 1",
"output": "200"
}
] | 1,695,144,959
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 35
| 514
| 16,998,400
|
import sys
input = sys.stdin.readline
n, d = map(int,input().split())
ls = []
for _ in range(n) :
ls.append(list(map(int,input().split())))
ls.sort()
i, j = 0, 0
sm, mx = 0, 0
while i < n :
while i < n and (ls[i][0]-ls[j][0]+1) <= d :
sm += ls[i][1]
i += 1
mx = max(mx,sm)
sm -= ls[j][1]
j += 1
print(mx)
|
Title: Kefa and Company
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kefa wants to celebrate his first big salary by going to restaurant. However, he needs company.
Kefa has *n* friends, each friend will agree to go to the restaurant if Kefa asks. Each friend is characterized by the amount of money he has and the friendship factor in respect to Kefa. The parrot doesn't want any friend to feel poor compared to somebody else in the company (Kefa doesn't count). A friend feels poor if in the company there is someone who has at least *d* units of money more than he does. Also, Kefa wants the total friendship factor of the members of the company to be maximum. Help him invite an optimal company!
Input Specification:
The first line of the input contains two space-separated integers, *n* and *d* (1<=≤<=*n*<=≤<=105, ) — the number of Kefa's friends and the minimum difference between the amount of money in order to feel poor, respectively.
Next *n* lines contain the descriptions of Kefa's friends, the (*i*<=+<=1)-th line contains the description of the *i*-th friend of type *m**i*, *s**i* (0<=≤<=*m**i*,<=*s**i*<=≤<=109) — the amount of money and the friendship factor, respectively.
Output Specification:
Print the maximum total friendship factir that can be reached.
Demo Input:
['4 5\n75 5\n0 100\n150 20\n75 1\n', '5 100\n0 7\n11 32\n99 10\n46 8\n87 54\n']
Demo Output:
['100\n', '111\n']
Note:
In the first sample test the most profitable strategy is to form a company from only the second friend. At all other variants the total degree of friendship will be worse.
In the second sample test we can take all the friends.
|
```python
import sys
input = sys.stdin.readline
n, d = map(int,input().split())
ls = []
for _ in range(n) :
ls.append(list(map(int,input().split())))
ls.sort()
i, j = 0, 0
sm, mx = 0, 0
while i < n :
while i < n and (ls[i][0]-ls[j][0]+1) <= d :
sm += ls[i][1]
i += 1
mx = max(mx,sm)
sm -= ls[j][1]
j += 1
print(mx)
```
| 3
|
|
58
|
B
|
Coins
|
PROGRAMMING
| 1,300
|
[
"greedy"
] |
B. Coins
|
2
|
256
|
In Berland a money reform is being prepared. New coins are being introduced. After long economic calculations was decided that the most expensive coin should possess the denomination of exactly *n* Berland dollars. Also the following restriction has been introduced for comfort: the denomination of each coin should be divisible by the denomination of any cheaper coin. It is known that among all the possible variants the variant with the largest number of new coins will be chosen. Find this variant. Print in the order of decreasing of the coins' denominations.
|
The first and only line contains an integer *n* (1<=≤<=*n*<=≤<=106) which represents the denomination of the most expensive coin.
|
Print the denominations of all the coins in the order of decreasing. The number of coins must be the largest possible (with the given denomination *n* of the most expensive coin). Also, the denomination of every coin must be divisible by the denomination of any cheaper coin. Naturally, the denominations of all the coins should be different. If there are several solutins to that problem, print any of them.
|
[
"10\n",
"4\n",
"3\n"
] |
[
"10 5 1\n",
"4 2 1\n",
"3 1\n"
] |
none
| 1,000
|
[
{
"input": "10",
"output": "10 5 1"
},
{
"input": "4",
"output": "4 2 1"
},
{
"input": "3",
"output": "3 1"
},
{
"input": "2",
"output": "2 1"
},
{
"input": "5",
"output": "5 1"
},
{
"input": "6",
"output": "6 3 1"
},
{
"input": "7",
"output": "7 1"
},
{
"input": "1",
"output": "1"
},
{
"input": "8",
"output": "8 4 2 1"
},
{
"input": "12",
"output": "12 6 3 1"
},
{
"input": "100",
"output": "100 50 25 5 1"
},
{
"input": "1000",
"output": "1000 500 250 125 25 5 1"
},
{
"input": "10000",
"output": "10000 5000 2500 1250 625 125 25 5 1"
},
{
"input": "100000",
"output": "100000 50000 25000 12500 6250 3125 625 125 25 5 1"
},
{
"input": "1000000",
"output": "1000000 500000 250000 125000 62500 31250 15625 3125 625 125 25 5 1"
},
{
"input": "509149",
"output": "509149 1"
},
{
"input": "572877",
"output": "572877 190959 63653 1201 1"
},
{
"input": "152956",
"output": "152956 76478 38239 1"
},
{
"input": "733035",
"output": "733035 244345 48869 1"
},
{
"input": "313114",
"output": "313114 156557 3331 1"
},
{
"input": "893193",
"output": "893193 297731 42533 1"
},
{
"input": "473273",
"output": "473273 2243 1"
},
{
"input": "537000",
"output": "537000 268500 134250 67125 22375 4475 895 179 1"
},
{
"input": "117079",
"output": "117079 6887 97 1"
},
{
"input": "784653",
"output": "784653 261551 9019 311 1"
},
{
"input": "627251",
"output": "627251 1"
},
{
"input": "9",
"output": "9 3 1"
},
{
"input": "999999",
"output": "999999 333333 111111 37037 5291 481 37 1"
},
{
"input": "120",
"output": "120 60 30 15 5 1"
},
{
"input": "720",
"output": "720 360 180 90 45 15 5 1"
},
{
"input": "648",
"output": "648 324 162 81 27 9 3 1"
},
{
"input": "2430",
"output": "2430 1215 405 135 45 15 5 1"
},
{
"input": "119070",
"output": "119070 59535 19845 6615 2205 735 245 49 7 1"
},
{
"input": "15",
"output": "15 5 1"
},
{
"input": "21",
"output": "21 7 1"
},
{
"input": "25",
"output": "25 5 1"
},
{
"input": "100",
"output": "100 50 25 5 1"
},
{
"input": "524287",
"output": "524287 1"
},
{
"input": "1000000",
"output": "1000000 500000 250000 125000 62500 31250 15625 3125 625 125 25 5 1"
},
{
"input": "600",
"output": "600 300 150 75 25 5 1"
},
{
"input": "1000000",
"output": "1000000 500000 250000 125000 62500 31250 15625 3125 625 125 25 5 1"
},
{
"input": "36",
"output": "36 18 9 3 1"
},
{
"input": "1000000",
"output": "1000000 500000 250000 125000 62500 31250 15625 3125 625 125 25 5 1"
},
{
"input": "20",
"output": "20 10 5 1"
},
{
"input": "999983",
"output": "999983 1"
},
{
"input": "9",
"output": "9 3 1"
},
{
"input": "999983",
"output": "999983 1"
},
{
"input": "20",
"output": "20 10 5 1"
},
{
"input": "121",
"output": "121 11 1"
},
{
"input": "1331",
"output": "1331 121 11 1"
}
] | 1,608,587,123
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 434
| 0
|
x=int(input(""))
ch=x
print(x)
for i in range((ch//2),0,-1):
if ch % i ==0 :
print(i)
ch=i
|
Title: Coins
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In Berland a money reform is being prepared. New coins are being introduced. After long economic calculations was decided that the most expensive coin should possess the denomination of exactly *n* Berland dollars. Also the following restriction has been introduced for comfort: the denomination of each coin should be divisible by the denomination of any cheaper coin. It is known that among all the possible variants the variant with the largest number of new coins will be chosen. Find this variant. Print in the order of decreasing of the coins' denominations.
Input Specification:
The first and only line contains an integer *n* (1<=≤<=*n*<=≤<=106) which represents the denomination of the most expensive coin.
Output Specification:
Print the denominations of all the coins in the order of decreasing. The number of coins must be the largest possible (with the given denomination *n* of the most expensive coin). Also, the denomination of every coin must be divisible by the denomination of any cheaper coin. Naturally, the denominations of all the coins should be different. If there are several solutins to that problem, print any of them.
Demo Input:
['10\n', '4\n', '3\n']
Demo Output:
['10 5 1\n', '4 2 1\n', '3 1\n']
Note:
none
|
```python
x=int(input(""))
ch=x
print(x)
for i in range((ch//2),0,-1):
if ch % i ==0 :
print(i)
ch=i
```
| 3.8915
|
393
|
A
|
Nineteen
|
PROGRAMMING
| 0
|
[] | null | null |
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
|
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
|
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
|
[
"nniinneetteeeenn\n",
"nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n",
"nineteenineteen\n"
] |
[
"2",
"2",
"2"
] |
none
| 500
|
[
{
"input": "nniinneetteeeenn",
"output": "2"
},
{
"input": "nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii",
"output": "2"
},
{
"input": "nineteenineteen",
"output": "2"
},
{
"input": "nssemsnnsitjtihtthij",
"output": "0"
},
{
"input": "eehihnttehtherjsihihnrhimihrjinjiehmtjimnrss",
"output": "1"
},
{
"input": "rrrteiehtesisntnjirtitijnjjjthrsmhtneirjimniemmnrhirssjnhetmnmjejjnjjritjttnnrhnjs",
"output": "2"
},
{
"input": "mmrehtretseihsrjmtsenemniehssnisijmsnntesismmtmthnsieijjjnsnhisi",
"output": "2"
},
{
"input": "hshretttnntmmiertrrnjihnrmshnthirnnirrheinnnrjiirshthsrsijtrrtrmnjrrjnresnintnmtrhsnjrinsseimn",
"output": "1"
},
{
"input": "snmmensntritetnmmmerhhrmhnehehtesmhthseemjhmnrti",
"output": "2"
},
{
"input": "rmeetriiitijmrenmeiijt",
"output": "0"
},
{
"input": "ihimeitimrmhriemsjhrtjtijtesmhemnmmrsetmjttthtjhnnmirtimne",
"output": "1"
},
{
"input": "rhtsnmnesieernhstjnmmirthhieejsjttsiierhihhrrijhrrnejsjer",
"output": "2"
},
{
"input": "emmtjsjhretehmiiiestmtmnmissjrstnsnjmhimjmststsitemtttjrnhsrmsenjtjim",
"output": "2"
},
{
"input": "nmehhjrhirniitshjtrrtitsjsntjhrstjehhhrrerhemehjeermhmhjejjesnhsiirheijjrnrjmminneeehtm",
"output": "3"
},
{
"input": "hsntijjetmehejtsitnthietssmeenjrhhetsnjrsethisjrtrhrierjtmimeenjnhnijeesjttrmn",
"output": "3"
},
{
"input": "jnirirhmirmhisemittnnsmsttesjhmjnsjsmntisheneiinsrjsjirnrmnjmjhmistntersimrjni",
"output": "1"
},
{
"input": "neithjhhhtmejjnmieishethmtetthrienrhjmjenrmtejerernmthmsnrthhtrimmtmshm",
"output": "2"
},
{
"input": "sithnrsnemhijsnjitmijjhejjrinejhjinhtisttteermrjjrtsirmessejireihjnnhhemiirmhhjeet",
"output": "3"
},
{
"input": "jrjshtjstteh",
"output": "0"
},
{
"input": "jsihrimrjnnmhttmrtrenetimemjnshnimeiitmnmjishjjneisesrjemeshjsijithtn",
"output": "2"
},
{
"input": "hhtjnnmsemermhhtsstejehsssmnesereehnnsnnremjmmieethmirjjhn",
"output": "2"
},
{
"input": "tmnersmrtsehhntsietttrehrhneiireijnijjejmjhei",
"output": "1"
},
{
"input": "mtstiresrtmesritnjriirehtermtrtseirtjrhsejhhmnsineinsjsin",
"output": "2"
},
{
"input": "ssitrhtmmhtnmtreijteinimjemsiiirhrttinsnneshintjnin",
"output": "1"
},
{
"input": "rnsrsmretjiitrjthhritniijhjmm",
"output": "0"
},
{
"input": "hntrteieimrimteemenserntrejhhmijmtjjhnsrsrmrnsjseihnjmehtthnnithirnhj",
"output": "3"
},
{
"input": "nmmtsmjrntrhhtmimeresnrinstjnhiinjtnjjjnthsintmtrhijnrnmtjihtinmni",
"output": "0"
},
{
"input": "eihstiirnmteejeehimttrijittjsntjejmessstsemmtristjrhenithrrsssihnthheehhrnmimssjmejjreimjiemrmiis",
"output": "2"
},
{
"input": "srthnimimnemtnmhsjmmmjmmrsrisehjseinemienntetmitjtnnneseimhnrmiinsismhinjjnreehseh",
"output": "3"
},
{
"input": "etrsmrjehntjjimjnmsresjnrthjhehhtreiijjminnheeiinseenmmethiemmistsei",
"output": "3"
},
{
"input": "msjeshtthsieshejsjhsnhejsihisijsertenrshhrthjhiirijjneinjrtrmrs",
"output": "1"
},
{
"input": "mehsmstmeejrhhsjihntjmrjrihssmtnensttmirtieehimj",
"output": "1"
},
{
"input": "mmmsermimjmrhrhejhrrejermsneheihhjemnehrhihesnjsehthjsmmjeiejmmnhinsemjrntrhrhsmjtttsrhjjmejj",
"output": "2"
},
{
"input": "rhsmrmesijmmsnsmmhertnrhsetmisshriirhetmjihsmiinimtrnitrseii",
"output": "1"
},
{
"input": "iihienhirmnihh",
"output": "0"
},
{
"input": "ismtthhshjmhisssnmnhe",
"output": "0"
},
{
"input": "rhsmnrmhejshinnjrtmtsssijimimethnm",
"output": "0"
},
{
"input": "eehnshtiriejhiirntminrirnjihmrnittnmmnjejjhjtennremrnssnejtntrtsiejjijisermj",
"output": "3"
},
{
"input": "rnhmeesnhttrjintnhnrhristjrthhrmehrhjmjhjehmstrijemjmmistes",
"output": "2"
},
{
"input": "ssrmjmjeeetrnimemrhimes",
"output": "0"
},
{
"input": "n",
"output": "0"
},
{
"input": "ni",
"output": "0"
},
{
"input": "nine",
"output": "0"
},
{
"input": "nineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteenineteen",
"output": "13"
},
{
"input": "ninetee",
"output": "0"
},
{
"input": "mzbmweyydiadtlcouegmdbyfwurpwbpuvhifnuapwynd",
"output": "0"
},
{
"input": "zenudggmyopddhszhrbmftgzmjorabhgojdtfnzxjkayjlkgczsyshczutkdch",
"output": "0"
},
{
"input": "rtzxovxqfapkdmelxiyjroohufhbakpmmvaxq",
"output": "0"
},
{
"input": "zninetneeineteeniwnteeennieteenineteenineteenineteenineteenineteenineteenineteenineteeninetzeenz",
"output": "13"
},
{
"input": "nnnnnnniiiiiiiiiiiitttttttttteeeeeeeeeeeeeeeeee",
"output": "3"
},
{
"input": "ttttiiiieeeeeeeeeeeennnnnnnnn",
"output": "4"
},
{
"input": "ttttttttteeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiinnnnnnn",
"output": "3"
},
{
"input": "nnnnnnnnnneeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiiiiitttttttttttttttttttt",
"output": "4"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeiiiiiiiiiiiiiiiiittttttttttttttttnnnnnnn",
"output": "3"
},
{
"input": "nineeen",
"output": "0"
},
{
"input": "nineteeeeeeeeeeeeeeeeettttttttttttttttttiiiiiiiiiiiiiiiiii",
"output": "0"
},
{
"input": "nineteenieteenieteenieteenieteenieteenieteen",
"output": "4"
},
{
"input": "nineteenineteenineteenineteenineteen",
"output": "5"
}
] | 1,565,983,398
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 187
| 2,252,800
|
s = input()
if(len(s < 100)):
s = [s[i:i+1] for i in range(0, len(s), +1)]
n = s.count('n')//3
i = s.count('i')
t = s.count('t')
e = s.count('e')//3
print(min(n,i,t,e))
|
Title: Nineteen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alice likes word "nineteen" very much. She has a string *s* and wants the string to contain as many such words as possible. For that reason she can rearrange the letters of the string.
For example, if she has string "xiineteenppnnnewtnee", she can get string "xnineteenppnineteenw", containing (the occurrences marked) two such words. More formally, word "nineteen" occurs in the string the number of times you can read it starting from some letter of the string. Of course, you shouldn't skip letters.
Help her to find the maximum number of "nineteen"s that she can get in her string.
Input Specification:
The first line contains a non-empty string *s*, consisting only of lowercase English letters. The length of string *s* doesn't exceed 100.
Output Specification:
Print a single integer — the maximum number of "nineteen"s that she can get in her string.
Demo Input:
['nniinneetteeeenn\n', 'nneteenabcnneteenabcnneteenabcnneteenabcnneteenabcii\n', 'nineteenineteen\n']
Demo Output:
['2', '2', '2']
Note:
none
|
```python
s = input()
if(len(s < 100)):
s = [s[i:i+1] for i in range(0, len(s), +1)]
n = s.count('n')//3
i = s.count('i')
t = s.count('t')
e = s.count('e')//3
print(min(n,i,t,e))
```
| -1
|
|
933
|
B
|
A Determined Cleanup
|
PROGRAMMING
| 2,000
|
[
"math"
] | null | null |
In order to put away old things and welcome a fresh new year, a thorough cleaning of the house is a must.
Little Tommy finds an old polynomial and cleaned it up by taking it modulo another. But now he regrets doing this...
Given two integers *p* and *k*, find a polynomial *f*(*x*) with non-negative integer coefficients strictly less than *k*, whose remainder is *p* when divided by (*x*<=+<=*k*). That is, *f*(*x*)<==<=*q*(*x*)·(*x*<=+<=*k*)<=+<=*p*, where *q*(*x*) is a polynomial (not necessarily with integer coefficients).
|
The only line of input contains two space-separated integers *p* and *k* (1<=≤<=*p*<=≤<=1018, 2<=≤<=*k*<=≤<=2<=000).
|
If the polynomial does not exist, print a single integer -1, or output two lines otherwise.
In the first line print a non-negative integer *d* — the number of coefficients in the polynomial.
In the second line print *d* space-separated integers *a*0,<=*a*1,<=...,<=*a**d*<=-<=1, describing a polynomial fulfilling the given requirements. Your output should satisfy 0<=≤<=*a**i*<=<<=*k* for all 0<=≤<=*i*<=≤<=*d*<=-<=1, and *a**d*<=-<=1<=≠<=0.
If there are many possible solutions, print any of them.
|
[
"46 2\n",
"2018 214\n"
] |
[
"7\n0 1 0 0 1 1 1\n",
"3\n92 205 1\n"
] |
In the first example, *f*(*x*) = *x*<sup class="upper-index">6</sup> + *x*<sup class="upper-index">5</sup> + *x*<sup class="upper-index">4</sup> + *x* = (*x*<sup class="upper-index">5</sup> - *x*<sup class="upper-index">4</sup> + 3*x*<sup class="upper-index">3</sup> - 6*x*<sup class="upper-index">2</sup> + 12*x* - 23)·(*x* + 2) + 46.
In the second example, *f*(*x*) = *x*<sup class="upper-index">2</sup> + 205*x* + 92 = (*x* - 9)·(*x* + 214) + 2018.
| 750
|
[
{
"input": "46 2",
"output": "7\n0 1 0 0 1 1 1"
},
{
"input": "2018 214",
"output": "3\n92 205 1"
},
{
"input": "4 2",
"output": "3\n0 0 1"
},
{
"input": "5 2",
"output": "3\n1 0 1"
},
{
"input": "10 3",
"output": "3\n1 0 1"
},
{
"input": "250 1958",
"output": "1\n250"
},
{
"input": "1000000000000000000 2000",
"output": "7\n0 0 0 0 500 1969 1"
},
{
"input": "1 2",
"output": "1\n1"
},
{
"input": "2 2",
"output": "3\n0 1 1"
},
{
"input": "3 2",
"output": "3\n1 1 1"
},
{
"input": "6 2",
"output": "5\n0 1 0 1 1"
},
{
"input": "7 2",
"output": "5\n1 1 0 1 1"
},
{
"input": "8 2",
"output": "5\n0 0 0 1 1"
},
{
"input": "9 2",
"output": "5\n1 0 0 1 1"
},
{
"input": "10 2",
"output": "5\n0 1 1 1 1"
},
{
"input": "1 3",
"output": "1\n1"
},
{
"input": "2 3",
"output": "1\n2"
},
{
"input": "3 3",
"output": "3\n0 2 1"
},
{
"input": "4 3",
"output": "3\n1 2 1"
},
{
"input": "5 3",
"output": "3\n2 2 1"
},
{
"input": "6 3",
"output": "3\n0 1 1"
},
{
"input": "7 3",
"output": "3\n1 1 1"
},
{
"input": "8 3",
"output": "3\n2 1 1"
},
{
"input": "9 3",
"output": "3\n0 0 1"
},
{
"input": "462 2",
"output": "11\n0 1 0 0 1 0 1 1 0 1 1"
},
{
"input": "462 3",
"output": "7\n0 2 1 1 0 1 1"
},
{
"input": "2018 4",
"output": "7\n2 0 2 1 0 2 1"
},
{
"input": "20180214 5",
"output": "11\n4 3 4 4 4 3 2 2 2 0 2"
},
{
"input": "1317 221",
"output": "3\n212 216 1"
},
{
"input": "1314 520",
"output": "3\n274 518 1"
},
{
"input": "1562 862",
"output": "3\n700 861 1"
},
{
"input": "6666666666666666 3",
"output": "35\n0 1 2 0 0 2 2 1 2 2 1 1 2 2 2 2 0 0 0 2 1 2 1 1 1 1 1 2 1 2 0 1 1 2 1"
},
{
"input": "252525252525252525 252",
"output": "9\n189 176 211 80 27 238 231 249 1"
},
{
"input": "271828182845904523 536",
"output": "7\n3 157 21 240 147 288 12"
},
{
"input": "314159265358979323 846",
"output": "7\n553 47 111 353 790 122 1"
},
{
"input": "393939393939393939 393",
"output": "7\n237 191 82 181 11 30 107"
},
{
"input": "233333333333333333 2000",
"output": "7\n1333 1334 1334 1334 584 1993 1"
},
{
"input": "998244353998244353 2000",
"output": "7\n353 878 500 1456 391 1969 1"
},
{
"input": "1000000000000000000 2",
"output": "61\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 1 0 0 0 1 1 1 1 1 0 0 1 0 1 1 1 1 1 1 0 1 0 0 1 1 1 0 0 0 0 1 0 0 0 1 0 0 1"
},
{
"input": "1000000000000000000 3",
"output": "39\n1 0 0 0 2 0 2 2 0 2 0 0 1 1 1 2 1 1 1 0 1 2 2 0 1 1 1 2 0 0 0 1 0 0 0 1 1 1 1"
}
] | 1,518,681,737
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0
| 61
| 19,660,800
|
p, k = map(int, input().split())
print(2)
print(k + p, 1)
|
Title: A Determined Cleanup
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In order to put away old things and welcome a fresh new year, a thorough cleaning of the house is a must.
Little Tommy finds an old polynomial and cleaned it up by taking it modulo another. But now he regrets doing this...
Given two integers *p* and *k*, find a polynomial *f*(*x*) with non-negative integer coefficients strictly less than *k*, whose remainder is *p* when divided by (*x*<=+<=*k*). That is, *f*(*x*)<==<=*q*(*x*)·(*x*<=+<=*k*)<=+<=*p*, where *q*(*x*) is a polynomial (not necessarily with integer coefficients).
Input Specification:
The only line of input contains two space-separated integers *p* and *k* (1<=≤<=*p*<=≤<=1018, 2<=≤<=*k*<=≤<=2<=000).
Output Specification:
If the polynomial does not exist, print a single integer -1, or output two lines otherwise.
In the first line print a non-negative integer *d* — the number of coefficients in the polynomial.
In the second line print *d* space-separated integers *a*0,<=*a*1,<=...,<=*a**d*<=-<=1, describing a polynomial fulfilling the given requirements. Your output should satisfy 0<=≤<=*a**i*<=<<=*k* for all 0<=≤<=*i*<=≤<=*d*<=-<=1, and *a**d*<=-<=1<=≠<=0.
If there are many possible solutions, print any of them.
Demo Input:
['46 2\n', '2018 214\n']
Demo Output:
['7\n0 1 0 0 1 1 1\n', '3\n92 205 1\n']
Note:
In the first example, *f*(*x*) = *x*<sup class="upper-index">6</sup> + *x*<sup class="upper-index">5</sup> + *x*<sup class="upper-index">4</sup> + *x* = (*x*<sup class="upper-index">5</sup> - *x*<sup class="upper-index">4</sup> + 3*x*<sup class="upper-index">3</sup> - 6*x*<sup class="upper-index">2</sup> + 12*x* - 23)·(*x* + 2) + 46.
In the second example, *f*(*x*) = *x*<sup class="upper-index">2</sup> + 205*x* + 92 = (*x* - 9)·(*x* + 214) + 2018.
|
```python
p, k = map(int, input().split())
print(2)
print(k + p, 1)
```
| 0
|
|
664
|
A
|
Complicated GCD
|
PROGRAMMING
| 800
|
[
"math",
"number theory"
] | null | null |
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
|
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
|
[
"1 2\n",
"61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n"
] |
[
"1\n",
"61803398874989484820458683436563811772030917980576\n"
] |
none
| 500
|
[
{
"input": "1 2",
"output": "1"
},
{
"input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576",
"output": "61803398874989484820458683436563811772030917980576"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "100 100000",
"output": "1"
},
{
"input": "12345 67890123456789123457",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158",
"output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158"
},
{
"input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751",
"output": "1"
},
{
"input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794",
"output": "1"
},
{
"input": "10000 1000000000",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "11210171722243 65715435710585778347",
"output": "1"
},
{
"input": "2921881079263974825226940825843 767693191032295360887755303860323261471",
"output": "1"
},
{
"input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085",
"output": "1"
},
{
"input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424",
"output": "1"
},
{
"input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614",
"output": "1"
},
{
"input": "15943150466658398903 15943150466658398903",
"output": "15943150466658398903"
},
{
"input": "410470228200245407491525399055972 410470228200245407491525399055972",
"output": "410470228200245407491525399055972"
},
{
"input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307",
"output": "51894705655711504622197349350106792045098781545973899451307"
},
{
"input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410",
"output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410"
},
{
"input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535",
"output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535"
},
{
"input": "1 2000000000",
"output": "1"
},
{
"input": "13 1928834874",
"output": "1"
},
{
"input": "87 2938984237482934238",
"output": "1"
},
{
"input": "213 413",
"output": "1"
},
{
"input": "3 4",
"output": "1"
}
] | 1,653,568,249
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 46
| 0
|
a,b = input().split()
c=1
if a==b:
print(a)
else:
print(c)
|
Title: Complicated GCD
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output Specification:
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
Demo Input:
['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n']
Demo Output:
['1\n', '61803398874989484820458683436563811772030917980576\n']
Note:
none
|
```python
a,b = input().split()
c=1
if a==b:
print(a)
else:
print(c)
```
| 3
|
|
816
|
B
|
Karen and Coffee
|
PROGRAMMING
| 1,400
|
[
"binary search",
"data structures",
"implementation"
] | null | null |
To stay woke and attentive during classes, Karen needs some coffee!
Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe".
She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste.
Karen thinks that a temperature is admissible if at least *k* recipes recommend it.
Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range?
|
The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively.
The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive.
The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
|
For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
|
[
"3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n",
"2 1 1\n1 1\n200000 200000\n90 100\n"
] |
[
"3\n3\n0\n4\n",
"0\n"
] |
In the first test case, Karen knows 3 recipes.
1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive.
A temperature is admissible if at least 2 recipes recommend it.
She asks 4 questions.
In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible.
In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible.
In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none.
In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible.
In the second test case, Karen knows 2 recipes.
1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees.
A temperature is admissible if at least 1 recipe recommends it.
In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
| 1,000
|
[
{
"input": "3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100",
"output": "3\n3\n0\n4"
},
{
"input": "2 1 1\n1 1\n200000 200000\n90 100",
"output": "0"
},
{
"input": "1 1 1\n1 1\n1 1",
"output": "1"
},
{
"input": "1 1 1\n200000 200000\n200000 200000",
"output": "1"
}
] | 1,682,686,584
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 3
| 109
| 6,246,400
|
def main():
n, k, q = map(int, input().split())
recipes = []
quries = []
MAX_RANGE = 200002
for i in range(n):
recipes.append(tuple(map(int, input().split())))
for i in range(q):
quries.append(tuple(map(int, input().split())))
# creating exclusive prefix sum of n + 2 to inbound first and last element
prfxSum = [0] * MAX_RANGE
for start, end in recipes:
prfxSum[start] += 1
prfxSum[(end + 1)] -= 1
# prefixsum to check if the recipe is admissible
for i in range(1, MAX_RANGE):
prfxSum[i] += prfxSum[i - 1]
# marking admissible recipes with 1 and others with 0
for i in range(MAX_RANGE):
prfxSum[i] //= k
# running other prefixsum to get the range of admissible recipes
for i in range(1, MAX_RANGE):
prfxSum[i] += prfxSum[i - 1]
# print admissable recipes in a given range
for start, end in quries:
print(prfxSum[end] - prfxSum[start - 1])
if __name__ == '__main__':
main()
|
Title: Karen and Coffee
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
To stay woke and attentive during classes, Karen needs some coffee!
Karen, a coffee aficionado, wants to know the optimal temperature for brewing the perfect cup of coffee. Indeed, she has spent some time reading several recipe books, including the universally acclaimed "The Art of the Covfefe".
She knows *n* coffee recipes. The *i*-th recipe suggests that coffee should be brewed between *l**i* and *r**i* degrees, inclusive, to achieve the optimal taste.
Karen thinks that a temperature is admissible if at least *k* recipes recommend it.
Karen has a rather fickle mind, and so she asks *q* questions. In each question, given that she only wants to prepare coffee with a temperature between *a* and *b*, inclusive, can you tell her how many admissible integer temperatures fall within the range?
Input Specification:
The first line of input contains three integers, *n*, *k* (1<=≤<=*k*<=≤<=*n*<=≤<=200000), and *q* (1<=≤<=*q*<=≤<=200000), the number of recipes, the minimum number of recipes a certain temperature must be recommended by to be admissible, and the number of questions Karen has, respectively.
The next *n* lines describe the recipes. Specifically, the *i*-th line among these contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=200000), describing that the *i*-th recipe suggests that the coffee be brewed between *l**i* and *r**i* degrees, inclusive.
The next *q* lines describe the questions. Each of these lines contains *a* and *b*, (1<=≤<=*a*<=≤<=*b*<=≤<=200000), describing that she wants to know the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
Output Specification:
For each question, output a single integer on a line by itself, the number of admissible integer temperatures between *a* and *b* degrees, inclusive.
Demo Input:
['3 2 4\n91 94\n92 97\n97 99\n92 94\n93 97\n95 96\n90 100\n', '2 1 1\n1 1\n200000 200000\n90 100\n']
Demo Output:
['3\n3\n0\n4\n', '0\n']
Note:
In the first test case, Karen knows 3 recipes.
1. The first one recommends brewing the coffee between 91 and 94 degrees, inclusive. 1. The second one recommends brewing the coffee between 92 and 97 degrees, inclusive. 1. The third one recommends brewing the coffee between 97 and 99 degrees, inclusive.
A temperature is admissible if at least 2 recipes recommend it.
She asks 4 questions.
In her first question, she wants to know the number of admissible integer temperatures between 92 and 94 degrees, inclusive. There are 3: 92, 93 and 94 degrees are all admissible.
In her second question, she wants to know the number of admissible integer temperatures between 93 and 97 degrees, inclusive. There are 3: 93, 94 and 97 degrees are all admissible.
In her third question, she wants to know the number of admissible integer temperatures between 95 and 96 degrees, inclusive. There are none.
In her final question, she wants to know the number of admissible integer temperatures between 90 and 100 degrees, inclusive. There are 4: 92, 93, 94 and 97 degrees are all admissible.
In the second test case, Karen knows 2 recipes.
1. The first one, "wikiHow to make Cold Brew Coffee", recommends brewing the coffee at exactly 1 degree. 1. The second one, "What good is coffee that isn't brewed at at least 36.3306 times the temperature of the surface of the sun?", recommends brewing the coffee at exactly 200000 degrees.
A temperature is admissible if at least 1 recipe recommends it.
In her first and only question, she wants to know the number of admissible integer temperatures that are actually reasonable. There are none.
|
```python
def main():
n, k, q = map(int, input().split())
recipes = []
quries = []
MAX_RANGE = 200002
for i in range(n):
recipes.append(tuple(map(int, input().split())))
for i in range(q):
quries.append(tuple(map(int, input().split())))
# creating exclusive prefix sum of n + 2 to inbound first and last element
prfxSum = [0] * MAX_RANGE
for start, end in recipes:
prfxSum[start] += 1
prfxSum[(end + 1)] -= 1
# prefixsum to check if the recipe is admissible
for i in range(1, MAX_RANGE):
prfxSum[i] += prfxSum[i - 1]
# marking admissible recipes with 1 and others with 0
for i in range(MAX_RANGE):
prfxSum[i] //= k
# running other prefixsum to get the range of admissible recipes
for i in range(1, MAX_RANGE):
prfxSum[i] += prfxSum[i - 1]
# print admissable recipes in a given range
for start, end in quries:
print(prfxSum[end] - prfxSum[start - 1])
if __name__ == '__main__':
main()
```
| 0
|
|
471
|
A
|
MUH and Sticks
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
|
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
|
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
|
[
"4 2 5 4 4 4\n",
"4 4 5 4 4 5\n",
"1 2 3 4 5 6\n"
] |
[
"Bear",
"Elephant",
"Alien"
] |
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
| 500
|
[
{
"input": "4 2 5 4 4 4",
"output": "Bear"
},
{
"input": "4 4 5 4 4 5",
"output": "Elephant"
},
{
"input": "1 2 3 4 5 6",
"output": "Alien"
},
{
"input": "5 5 5 5 5 5",
"output": "Elephant"
},
{
"input": "1 1 1 2 3 5",
"output": "Alien"
},
{
"input": "1 1 1 1 1 1",
"output": "Elephant"
},
{
"input": "9 9 9 9 9 9",
"output": "Elephant"
},
{
"input": "1 8 9 1 1 1",
"output": "Bear"
},
{
"input": "9 9 9 1 9 9",
"output": "Bear"
},
{
"input": "1 2 3 8 9 7",
"output": "Alien"
},
{
"input": "5 5 5 6 6 6",
"output": "Alien"
},
{
"input": "1 1 2 2 3 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 2",
"output": "Bear"
},
{
"input": "2 2 3 3 4 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 5",
"output": "Bear"
},
{
"input": "1 1 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 2 5 5 5 5",
"output": "Bear"
},
{
"input": "4 4 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 1 2",
"output": "Bear"
},
{
"input": "2 2 4 4 4 4",
"output": "Elephant"
},
{
"input": "4 4 4 4 4 3",
"output": "Bear"
},
{
"input": "4 4 5 6 7 8",
"output": "Alien"
},
{
"input": "4 4 4 4 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 2 2",
"output": "Elephant"
},
{
"input": "1 1 3 3 3 5",
"output": "Alien"
},
{
"input": "1 2 2 3 3 3",
"output": "Alien"
},
{
"input": "1 2 2 2 2 2",
"output": "Bear"
},
{
"input": "1 3 3 3 4 5",
"output": "Alien"
},
{
"input": "5 1 1 1 1 1",
"output": "Bear"
}
] | 1,418,013,467
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 29
| 62
| 0
|
def main():
l = [0] * 10
for x in map(int, input().split()):
l[x] += 1
l.sort()
x = l[9] * 3 + l[8]
if x in (18, 14):
print('Elephant')
elif x in (16, 13):
print('Bear')
else:
print('Alien')
if __name__ == '__main__':
main()
|
Title: MUH and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
Input Specification:
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
Output Specification:
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
Demo Input:
['4 2 5 4 4 4\n', '4 4 5 4 4 5\n', '1 2 3 4 5 6\n']
Demo Output:
['Bear', 'Elephant', 'Alien']
Note:
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
|
```python
def main():
l = [0] * 10
for x in map(int, input().split()):
l[x] += 1
l.sort()
x = l[9] * 3 + l[8]
if x in (18, 14):
print('Elephant')
elif x in (16, 13):
print('Bear')
else:
print('Alien')
if __name__ == '__main__':
main()
```
| 3
|
|
66
|
B
|
Petya and Countryside
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] |
B. Petya and Countryside
|
2
|
256
|
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
|
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
|
[
"1\n2\n",
"5\n1 2 1 2 1\n",
"8\n1 2 1 1 1 3 3 4\n"
] |
[
"1\n",
"3\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 2 1 2 1",
"output": "3"
},
{
"input": "8\n1 2 1 1 1 3 3 4",
"output": "6"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "10"
},
{
"input": "2\n100 100",
"output": "2"
},
{
"input": "3\n100 100 100",
"output": "3"
},
{
"input": "11\n1 2 3 4 5 6 5 4 3 2 1",
"output": "11"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 100 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 1 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 1 82 83 84 85 86 87 88 89 90 91 92 93 94 100 5 4 3 2 1",
"output": "81"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 1 86 87 88 89 90 91 92 93 100 6 5 4 3 2 1",
"output": "85"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 1 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 100 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 100 8 7 6 1 4 3 2 1",
"output": "96"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 100 10 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 1 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 100 11 10 9 8 7 6 5 4 3 2 1",
"output": "55"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 1 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 100 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "59"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 100 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "86"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 100 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "83"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 100 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 1 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "74"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 100 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 100 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 1 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "52"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 100 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 1 2 1",
"output": "98"
},
{
"input": "10\n1 4 4 4 4 4 1 2 4 3",
"output": "7"
}
] | 1,663,746,631
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 8
| 186
| 2,867,200
|
from re import A
def consecutiveNumber(arr, n):
l = 0
for i in range(n-1):
if arr[i] == arr[i+1]:
l+=1
return l
def lenOfLongIncSubArr(arr, n) :
m = 1
l = 1
for i in range(1, n) :
if (arr[i] <= arr[i-1]) :
l =l + 1
else :
if (m < l) :
m = l
l = 1
if (m < l) :
m = l
return m
arr = []
# f=int(input())
# for j in range(f):
# k=int(input())
# arr.append(k)
n = int(input())
arr = list(map(int, input().split()))
n = len(arr)
res1 = lenOfLongIncSubArr(arr, n)
cons = consecutiveNumber(arr, n)
arr.reverse()
res2 = lenOfLongIncSubArr(arr, n)
print(res1 + res2 -1 - cons )
|
Title: Petya and Countryside
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
Output Specification:
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
Demo Input:
['1\n2\n', '5\n1 2 1 2 1\n', '8\n1 2 1 1 1 3 3 4\n']
Demo Output:
['1\n', '3\n', '6\n']
Note:
none
|
```python
from re import A
def consecutiveNumber(arr, n):
l = 0
for i in range(n-1):
if arr[i] == arr[i+1]:
l+=1
return l
def lenOfLongIncSubArr(arr, n) :
m = 1
l = 1
for i in range(1, n) :
if (arr[i] <= arr[i-1]) :
l =l + 1
else :
if (m < l) :
m = l
l = 1
if (m < l) :
m = l
return m
arr = []
# f=int(input())
# for j in range(f):
# k=int(input())
# arr.append(k)
n = int(input())
arr = list(map(int, input().split()))
n = len(arr)
res1 = lenOfLongIncSubArr(arr, n)
cons = consecutiveNumber(arr, n)
arr.reverse()
res2 = lenOfLongIncSubArr(arr, n)
print(res1 + res2 -1 - cons )
```
| 0
|
802
|
G
|
Fake News (easy)
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0
|
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,619,584,249
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 77
| 0
|
N=input()
S=""
N=N.lower()
A=0
for i in range(len(N)):
if(N[i]=="h"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="e"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="i"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="d"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="i"):
S=S+N[i]
break
if(S=="heidi"):
print("YES")
if not (S=="heidi"):
print("NO")
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
N=input()
S=""
N=N.lower()
A=0
for i in range(len(N)):
if(N[i]=="h"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="e"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="i"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="d"):
S=S+N[i]
A=i
break
for i in range(A+1,len(N)):
if(N[i]=="i"):
S=S+N[i]
break
if(S=="heidi"):
print("YES")
if not (S=="heidi"):
print("NO")
```
| 3
|
|
870
|
C
|
Maximum splitting
|
PROGRAMMING
| 1,300
|
[
"dp",
"greedy",
"math",
"number theory"
] | null | null |
You are given several queries. In the *i*-th query you are given a single positive integer *n**i*. You are to represent *n**i* as a sum of maximum possible number of composite summands and print this maximum number, or print -1, if there are no such splittings.
An integer greater than 1 is composite, if it is not prime, i.e. if it has positive divisors not equal to 1 and the integer itself.
|
The first line contains single integer *q* (1<=≤<=*q*<=≤<=105) — the number of queries.
*q* lines follow. The (*i*<=+<=1)-th line contains single integer *n**i* (1<=≤<=*n**i*<=≤<=109) — the *i*-th query.
|
For each query print the maximum possible number of summands in a valid splitting to composite summands, or -1, if there are no such splittings.
|
[
"1\n12\n",
"2\n6\n8\n",
"3\n1\n2\n3\n"
] |
[
"3\n",
"1\n2\n",
"-1\n-1\n-1\n"
] |
12 = 4 + 4 + 4 = 4 + 8 = 6 + 6 = 12, but the first splitting has the maximum possible number of summands.
8 = 4 + 4, 6 can't be split into several composite summands.
1, 2, 3 are less than any composite number, so they do not have valid splittings.
| 1,500
|
[
{
"input": "1\n12",
"output": "3"
},
{
"input": "2\n6\n8",
"output": "1\n2"
},
{
"input": "3\n1\n2\n3",
"output": "-1\n-1\n-1"
},
{
"input": "6\n1\n2\n3\n5\n7\n11",
"output": "-1\n-1\n-1\n-1\n-1\n-1"
},
{
"input": "3\n4\n6\n9",
"output": "1\n1\n1"
},
{
"input": "20\n8\n13\n20\n12\n9\n16\n4\n19\n7\n15\n10\n6\n14\n11\n3\n2\n5\n17\n18\n1",
"output": "2\n2\n5\n3\n1\n4\n1\n3\n-1\n2\n2\n1\n3\n-1\n-1\n-1\n-1\n3\n4\n-1"
},
{
"input": "100\n611\n513\n544\n463\n38\n778\n347\n317\n848\n664\n382\n108\n718\n33\n334\n876\n234\n22\n944\n305\n159\n245\n513\n691\n639\n135\n308\n324\n813\n459\n304\n116\n331\n993\n184\n224\n853\n769\n121\n687\n93\n930\n751\n308\n485\n914\n400\n695\n95\n981\n175\n972\n121\n654\n242\n610\n617\n999\n237\n548\n742\n767\n613\n172\n223\n391\n102\n907\n673\n116\n230\n355\n189\n552\n399\n493\n903\n201\n985\n459\n776\n641\n693\n919\n253\n540\n427\n394\n655\n101\n461\n854\n417\n249\n66\n380\n213\n906\n212\n528",
"output": "151\n127\n136\n114\n9\n194\n85\n78\n212\n166\n95\n27\n179\n7\n83\n219\n58\n5\n236\n75\n38\n60\n127\n171\n158\n32\n77\n81\n202\n113\n76\n29\n81\n247\n46\n56\n212\n191\n29\n170\n22\n232\n186\n77\n120\n228\n100\n172\n22\n244\n42\n243\n29\n163\n60\n152\n153\n248\n58\n137\n185\n190\n152\n43\n54\n96\n25\n225\n167\n29\n57\n87\n46\n138\n98\n122\n224\n49\n245\n113\n194\n159\n172\n228\n62\n135\n105\n98\n162\n24\n114\n213\n103\n61\n16\n95\n52\n226\n53\n132"
},
{
"input": "1\n10000001",
"output": "2499999"
}
] | 1,618,915,484
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 61
| 0
|
for _ in range(int(input())):
n = int(input())
tn = n
s = 1
c = 0
sn = int(n**0.5)
for i in range(2, sn + 1):
if i > n or c == 2:
break
if n % i == 0:
while n % i == 0:
if c == 2:
break
s *= i
c += 1
n //= i
if c == 0:
print(-1)
elif c == 1:
print(1)
else:
print(tn // s)
|
Title: Maximum splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given several queries. In the *i*-th query you are given a single positive integer *n**i*. You are to represent *n**i* as a sum of maximum possible number of composite summands and print this maximum number, or print -1, if there are no such splittings.
An integer greater than 1 is composite, if it is not prime, i.e. if it has positive divisors not equal to 1 and the integer itself.
Input Specification:
The first line contains single integer *q* (1<=≤<=*q*<=≤<=105) — the number of queries.
*q* lines follow. The (*i*<=+<=1)-th line contains single integer *n**i* (1<=≤<=*n**i*<=≤<=109) — the *i*-th query.
Output Specification:
For each query print the maximum possible number of summands in a valid splitting to composite summands, or -1, if there are no such splittings.
Demo Input:
['1\n12\n', '2\n6\n8\n', '3\n1\n2\n3\n']
Demo Output:
['3\n', '1\n2\n', '-1\n-1\n-1\n']
Note:
12 = 4 + 4 + 4 = 4 + 8 = 6 + 6 = 12, but the first splitting has the maximum possible number of summands.
8 = 4 + 4, 6 can't be split into several composite summands.
1, 2, 3 are less than any composite number, so they do not have valid splittings.
|
```python
for _ in range(int(input())):
n = int(input())
tn = n
s = 1
c = 0
sn = int(n**0.5)
for i in range(2, sn + 1):
if i > n or c == 2:
break
if n % i == 0:
while n % i == 0:
if c == 2:
break
s *= i
c += 1
n //= i
if c == 0:
print(-1)
elif c == 1:
print(1)
else:
print(tn // s)
```
| 0
|
|
46
|
C
|
Hamsters and Tigers
|
PROGRAMMING
| 1,600
|
[
"two pointers"
] |
C. Hamsters and Tigers
|
2
|
256
|
Today there is going to be an unusual performance at the circus — hamsters and tigers will perform together! All of them stand in circle along the arena edge and now the trainer faces a difficult task: he wants to swap the animals' positions so that all the hamsters stood together and all the tigers also stood together. The trainer swaps the animals in pairs not to create a mess. He orders two animals to step out of the circle and swap places. As hamsters feel highly uncomfortable when tigers are nearby as well as tigers get nervous when there's so much potential prey around (consisting not only of hamsters but also of yummier spectators), the trainer wants to spend as little time as possible moving the animals, i.e. he wants to achieve it with the minimal number of swaps. Your task is to help him.
|
The first line contains number *n* (2<=≤<=*n*<=≤<=1000) which indicates the total number of animals in the arena. The second line contains the description of the animals' positions. The line consists of *n* symbols "H" and "T". The "H"s correspond to hamsters and the "T"s correspond to tigers. It is guaranteed that at least one hamster and one tiger are present on the arena. The animals are given in the order in which they are located circle-wise, in addition, the last animal stands near the first one.
|
Print the single number which is the minimal number of swaps that let the trainer to achieve his goal.
|
[
"3\nHTH\n",
"9\nHTHTHTHHT\n"
] |
[
"0\n",
"2\n"
] |
In the first example we shouldn't move anybody because the animals of each species already stand apart from the other species. In the second example you may swap, for example, the tiger in position 2 with the hamster in position 5 and then — the tiger in position 9 with the hamster in position 7.
| 0
|
[
{
"input": "3\nHTH",
"output": "0"
},
{
"input": "9\nHTHTHTHHT",
"output": "2"
},
{
"input": "2\nTH",
"output": "0"
},
{
"input": "4\nHTTH",
"output": "0"
},
{
"input": "4\nHTHT",
"output": "1"
},
{
"input": "7\nTTTHTTT",
"output": "0"
},
{
"input": "8\nHHTHHTHH",
"output": "1"
},
{
"input": "13\nHTTTHHHTTTTHH",
"output": "3"
},
{
"input": "20\nTTHTHTHHTHTTHHTTTHHH",
"output": "4"
},
{
"input": "35\nTTTTTTHTTHTTTTTHTTTTTTTTTTTHTHTTTTT",
"output": "3"
},
{
"input": "120\nTTTTTTTHTHTHTTTTTHTHTTTTHTTTTTTTTTTTTTTTTTTTTHTTHTTTTHTTHTTTTTTTTTTTTTTTHTTTTTTHTHTTHTTTTTTHTTTTTTTTTHTTHTTTTHTTTHTTTTTH",
"output": "14"
},
{
"input": "19\nHHHHHHHHHHHHHTTTHHH",
"output": "0"
},
{
"input": "87\nHTHHTTHHHHTHHHHHTTTHHTHHHHTTTTHHHTTHHTHTHTHHTTHTHHTHTHTTHHHTTTTTHTTHHHHHHTHHTHHTHTTHTHH",
"output": "17"
},
{
"input": "178\nTHHHTHTTTHTTHTTHHHHHTTTHTTHHTHTTTHTHTTTTTHHHTHTHHHTHHHTTTTTTTTHHHHTTHHTHHHHTHTTTHHHHHHTHHTHTTHTHTTTTTTTTTHHTTHHTHTTHHTHHHHHTTHHTTHHTTHHHTTHHTTTTHTHHHTHTTHTHTTTHHHHTHHTHHHTHTTTTTT",
"output": "40"
}
] | 1,687,898,287
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 27
| 248
| 8,601,600
|
import sys
input = lambda: sys.stdin.readline().rstrip()
from collections import deque,defaultdict
N = int(input())
S = [c for c in input()]
ans = float("inf")
for _ in range(N):
SS = S[::]
lib = defaultdict(list)
for i in range(N):
lib[S[i]].append(i)
cnt = 0
for i in range(N):
if SS[i]!=SS[0]:
j = lib[SS[0]].pop()
if j<=i:break
SS[i],SS[j]=SS[j],SS[i]
cnt+=1
ans = min(ans, cnt)
S = S[1:]+[S[0]]
print(ans)
|
Title: Hamsters and Tigers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Today there is going to be an unusual performance at the circus — hamsters and tigers will perform together! All of them stand in circle along the arena edge and now the trainer faces a difficult task: he wants to swap the animals' positions so that all the hamsters stood together and all the tigers also stood together. The trainer swaps the animals in pairs not to create a mess. He orders two animals to step out of the circle and swap places. As hamsters feel highly uncomfortable when tigers are nearby as well as tigers get nervous when there's so much potential prey around (consisting not only of hamsters but also of yummier spectators), the trainer wants to spend as little time as possible moving the animals, i.e. he wants to achieve it with the minimal number of swaps. Your task is to help him.
Input Specification:
The first line contains number *n* (2<=≤<=*n*<=≤<=1000) which indicates the total number of animals in the arena. The second line contains the description of the animals' positions. The line consists of *n* symbols "H" and "T". The "H"s correspond to hamsters and the "T"s correspond to tigers. It is guaranteed that at least one hamster and one tiger are present on the arena. The animals are given in the order in which they are located circle-wise, in addition, the last animal stands near the first one.
Output Specification:
Print the single number which is the minimal number of swaps that let the trainer to achieve his goal.
Demo Input:
['3\nHTH\n', '9\nHTHTHTHHT\n']
Demo Output:
['0\n', '2\n']
Note:
In the first example we shouldn't move anybody because the animals of each species already stand apart from the other species. In the second example you may swap, for example, the tiger in position 2 with the hamster in position 5 and then — the tiger in position 9 with the hamster in position 7.
|
```python
import sys
input = lambda: sys.stdin.readline().rstrip()
from collections import deque,defaultdict
N = int(input())
S = [c for c in input()]
ans = float("inf")
for _ in range(N):
SS = S[::]
lib = defaultdict(list)
for i in range(N):
lib[S[i]].append(i)
cnt = 0
for i in range(N):
if SS[i]!=SS[0]:
j = lib[SS[0]].pop()
if j<=i:break
SS[i],SS[j]=SS[j],SS[i]
cnt+=1
ans = min(ans, cnt)
S = S[1:]+[S[0]]
print(ans)
```
| 3.921978
|
202
|
A
|
LLPS
|
PROGRAMMING
| 800
|
[
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null |
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
|
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
|
Print the lexicographically largest palindromic subsequence of string *s*.
|
[
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] |
[
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] |
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
| 500
|
[
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,695,405,727
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
s = input()
result = ""
for char in s:
if char > result[-1:] and char not in result:
result += char
elif char not in result:
result = char + result
print(result)
|
Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr".
|
```python
s = input()
result = ""
for char in s:
if char > result[-1:] and char not in result:
result += char
elif char not in result:
result = char + result
print(result)
```
| 0
|
|
61
|
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500
|
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,512,691,539
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 102
| 77
| 5,529,600
|
L1=input()
L2=input()
res=""
for i in range(len(L1)):
if L1[i]!=L2[i]:
res+="1"
else:
res+="0"
print(res)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
L1=input()
L2=input()
res=""
for i in range(len(L1)):
if L1[i]!=L2[i]:
res+="1"
else:
res+="0"
print(res)
```
| 3.97045
|
120
|
B
|
Quiz League
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
A team quiz game called "What? Where? When?" is very popular in Berland. The game is centered on two teams competing. They are the team of six Experts versus the team of the Audience. A person from the audience asks a question and the experts are allowed a minute on brainstorming and finding the right answer to the question. All it takes to answer a typical question is general knowledge and common logic. The question sent be the audience are in envelops lain out in a circle on a round table. Each envelop is marked by the name of the asker's town. Each question is positioned in a separate sector. In the centre of the table is a spinning arrow. Thus, the table rather resembles a roulette table with no ball but with a spinning arrow instead. The host sets off the spinning arrow to choose a question for the experts: when the arrow stops spinning, the question it is pointing at is chosen. If the arrow points at the question that has already been asked, the host chooses the next unanswered question in the clockwise direction. Your task is to determine which will be the number of the next asked question if the arrow points at sector number *k*.
|
The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=1000 and 1<=≤<=*k*<=≤<=*n*) — the numbers of sectors on the table and the number of the sector where the arrow is pointing. The second line contains *n* numbers: *a**i*<==<=0 if the question from sector *i* has already been asked and *a**i*<==<=1 if the question from sector *i* hasn't been asked yet (1<=≤<=*i*<=≤<=*n*). The sectors are given in the clockwise order, the first sector follows after the *n*-th one.
|
Print the single number — the number of the sector containing the question the experts will be asked. It is guaranteed that the answer exists, that is that not all the questions have already been asked.
|
[
"5 5\n0 1 0 1 0\n",
"2 1\n1 1\n"
] |
[
"2\n",
"1\n"
] |
none
| 0
|
[
{
"input": "5 5\n0 1 0 1 0",
"output": "2"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "3 2\n1 0 0",
"output": "1"
},
{
"input": "3 3\n0 1 0",
"output": "2"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "6 3\n0 0 1 1 0 1",
"output": "3"
},
{
"input": "3 1\n0 1 0",
"output": "2"
},
{
"input": "3 3\n1 0 1",
"output": "3"
},
{
"input": "4 4\n1 0 1 0",
"output": "1"
},
{
"input": "5 3\n0 1 0 1 1",
"output": "4"
},
{
"input": "6 4\n1 0 0 0 0 1",
"output": "6"
},
{
"input": "7 5\n1 0 0 0 0 0 1",
"output": "7"
},
{
"input": "101 81\n1 0 1 1 1 1 0 0 1 1 1 1 1 0 0 1 0 1 0 1 1 1 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 1 0 1 0 1 1 0 1 0 0 1 0 0 0 1 0 0 1 0 0 0 1 1 0 1 1 0 0 1 0 0 1 0 0 0 0 0 0 1 1 0 1 1 0 1 0 0 0 0 1 0 0 1 1 0 0 1 0 1 0 0 0 1 0",
"output": "82"
},
{
"input": "200 31\n1 0 0 1 1 1 0 0 0 0 0 1 1 1 0 1 1 0 0 1 0 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 1 1 1 0 1 0 1 0 1 0 0 1 1 1 0 0 0 1 0 0 0 1 1 0 0 0 0 1 1 0 1 1 1 1 1 0 0 1 1 1 0 0 0 0 1 0 1 1 1 0 1 1 0 0 1 1 1 1 1 0 1 0 1 1 0 1 0 1 1 0 0 1 1 0 0 0 1 1 1 1 1 1 1 0 0 1 1 0 1 1 1 0 1 0 0 1 1 1 0 0 0 0 0 0 1 0 1 0 0 1 1 1 1 1 0 1 0 0 0 0 1 1 0 1 0 1 1 1 0 1 0 1 0 0 0 1 0 0 0 0 0 0 0 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 0 1 0",
"output": "33"
},
{
"input": "17 13\n0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 1 1",
"output": "13"
},
{
"input": "102 9\n0 0 0 0 1 1 0 1 0 1 1 1 1 0 1 0 1 0 1 0 0 0 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 1 0 0 1 1 0 1 0 1 1 0 1 0 0 1 0 0 0 0 1 1 1 1 0 0 1 1 1 0 0 0 1 1 0 0 1 0 1 1 0 1 0 0 0 0 0 0 0 1 1 0 0 1 1",
"output": "10"
}
] | 1,577,478,864
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 4
| 1,000
| 1,228,800
|
import sys
sys.stdin = open('input.txt', 'r')
sys.stdout = open('output.txt', 'w')
n,k=map(int,(input().split()))
s=""
p=input().split()
k-=1
while(True):
if(k!=len(p)-1):
if(p[k]=="1"):
print(k+1)
break
else:
k+=1
else:
k=0
|
Title: Quiz League
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A team quiz game called "What? Where? When?" is very popular in Berland. The game is centered on two teams competing. They are the team of six Experts versus the team of the Audience. A person from the audience asks a question and the experts are allowed a minute on brainstorming and finding the right answer to the question. All it takes to answer a typical question is general knowledge and common logic. The question sent be the audience are in envelops lain out in a circle on a round table. Each envelop is marked by the name of the asker's town. Each question is positioned in a separate sector. In the centre of the table is a spinning arrow. Thus, the table rather resembles a roulette table with no ball but with a spinning arrow instead. The host sets off the spinning arrow to choose a question for the experts: when the arrow stops spinning, the question it is pointing at is chosen. If the arrow points at the question that has already been asked, the host chooses the next unanswered question in the clockwise direction. Your task is to determine which will be the number of the next asked question if the arrow points at sector number *k*.
Input Specification:
The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=1000 and 1<=≤<=*k*<=≤<=*n*) — the numbers of sectors on the table and the number of the sector where the arrow is pointing. The second line contains *n* numbers: *a**i*<==<=0 if the question from sector *i* has already been asked and *a**i*<==<=1 if the question from sector *i* hasn't been asked yet (1<=≤<=*i*<=≤<=*n*). The sectors are given in the clockwise order, the first sector follows after the *n*-th one.
Output Specification:
Print the single number — the number of the sector containing the question the experts will be asked. It is guaranteed that the answer exists, that is that not all the questions have already been asked.
Demo Input:
['5 5\n0 1 0 1 0\n', '2 1\n1 1\n']
Demo Output:
['2\n', '1\n']
Note:
none
|
```python
import sys
sys.stdin = open('input.txt', 'r')
sys.stdout = open('output.txt', 'w')
n,k=map(int,(input().split()))
s=""
p=input().split()
k-=1
while(True):
if(k!=len(p)-1):
if(p[k]=="1"):
print(k+1)
break
else:
k+=1
else:
k=0
```
| 0
|
|
159
|
A
|
Friends or Not
|
PROGRAMMING
| 1,400
|
[
"*special",
"greedy",
"implementation"
] | null | null |
Polycarpus has a hobby — he develops an unusual social network. His work is almost completed, and there is only one more module to implement — the module which determines friends. Oh yes, in this social network one won't have to add friends manually! Pairs of friends are deduced in the following way. Let's assume that user *A* sent user *B* a message at time *t*1, and user *B* sent user *A* a message at time *t*2. If 0<=<<=*t*2<=-<=*t*1<=≤<=*d*, then user *B*'s message was an answer to user *A*'s one. Users *A* and *B* are considered to be friends if *A* answered at least one *B*'s message or *B* answered at least one *A*'s message.
You are given the log of messages in chronological order and a number *d*. Find all pairs of users who will be considered to be friends.
|
The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=1000). The next *n* lines contain the messages log. The *i*-th line contains one line of the log formatted as "*A**i* *B**i* *t**i*" (without the quotes), which means that user *A**i* sent a message to user *B**i* at time *t**i* (1<=≤<=*i*<=≤<=*n*). *A**i* and *B**i* are non-empty strings at most 20 characters long, consisting of lowercase letters ('a' ... 'z'), and *t**i* is an integer (0<=≤<=*t**i*<=≤<=10000). It is guaranteed that the lines are given in non-decreasing order of *t**i*'s and that no user sent a message to himself. The elements in the lines are separated by single spaces.
|
In the first line print integer *k* — the number of pairs of friends. In the next *k* lines print pairs of friends as "*A**i* *B**i*" (without the quotes). You can print users in pairs and the pairs themselves in any order. Each pair must be printed exactly once.
|
[
"4 1\nvasya petya 1\npetya vasya 2\nanya ivan 2\nivan anya 4\n",
"1 1000\na b 0\n"
] |
[
"1\npetya vasya\n",
"0\n"
] |
In the first sample test case Vasya and Petya are friends because their messages' sending times are one second apart. Anya and Ivan are not, because their messages' sending times differ by more than one second.
| 500
|
[
{
"input": "4 1\nvasya petya 1\npetya vasya 2\nanya ivan 2\nivan anya 4",
"output": "1\npetya vasya"
},
{
"input": "1 1000\na b 0",
"output": "0"
},
{
"input": "2 1\na b 0\nb a 0",
"output": "0"
},
{
"input": "3 1\na b 1\nb c 2\nc d 3",
"output": "0"
},
{
"input": "10 2\nlutdc xfavzancwrokyzzkpco 0\nxfavzancwrokyzzkpco lutdc 1\nlutdc vydvatbnibttqgn 2\nxfavzancwrokyzzkpco vydvatbnibttqgn 2\nvydvatbnibttqgn lutdc 3\nlutdc xfavzancwrokyzzkpco 4\nlutdc vydvatbnibttqgn 5\nlutdc vydvatbnibttqgn 6\nlutdc xfavzancwrokyzzkpco 6\nvydvatbnibttqgn xfavzancwrokyzzkpco 6",
"output": "2\nlutdc vydvatbnibttqgn\nlutdc xfavzancwrokyzzkpco"
},
{
"input": "10 2\nrvmykneiddpqyf jdhmt 0\nwcsjvh jdhmt 0\njdhmt rvmykneiddpqyf 1\nrvmykneiddpqyf jdhmt 1\nwcsjvh rvmykneiddpqyf 2\nrvmykneiddpqyf jdhmt 2\njdhmt rvmykneiddpqyf 3\njdhmt wcsjvh 5\njdhmt wcsjvh 5\nrvmykneiddpqyf jdhmt 6",
"output": "1\njdhmt rvmykneiddpqyf"
},
{
"input": "10 2\nliazxawm spxwktiqjgs 0\nnolq liazxawm 1\nliazxawm nolq 2\nliazxawm spxwktiqjgs 2\nnolq liazxawm 3\nspxwktiqjgs liazxawm 3\nspxwktiqjgs liazxawm 3\nspxwktiqjgs liazxawm 3\nspxwktiqjgs nolq 3\nnolq spxwktiqjgs 4",
"output": "3\nliazxawm nolq\nliazxawm spxwktiqjgs\nnolq spxwktiqjgs"
},
{
"input": "10 2\nfxn ipntr 0\nipntr fxn 1\nfxn ipntr 1\npfvpfteadph ipntr 2\nfxn pfvpfteadph 4\nipntr fxn 4\npfvpfteadph fxn 5\nfxn pfvpfteadph 5\npfvpfteadph ipntr 6\nipntr pfvpfteadph 6",
"output": "2\nfxn ipntr\nfxn pfvpfteadph"
},
{
"input": "10 2\nyltec xnzdtcgzxqqltvpfr 0\nfxxhcmbzzg xnzdtcgzxqqltvpfr 0\nfxxhcmbzzg xnzdtcgzxqqltvpfr 0\nfxxhcmbzzg yltec 1\nfxxhcmbzzg xnzdtcgzxqqltvpfr 2\nfxxhcmbzzg yltec 2\nyltec fxxhcmbzzg 3\nyltec xnzdtcgzxqqltvpfr 3\nyltec xnzdtcgzxqqltvpfr 5\nfxxhcmbzzg yltec 6",
"output": "1\nfxxhcmbzzg yltec"
},
{
"input": "10 2\nrclgdpxdefqu abrfhwigaihoqq 0\nabrfhwigaihoqq rclgdpxdefqu 1\nrclgdpxdefqu bvkfwutdtvxgvx 1\nrclgdpxdefqu abrfhwigaihoqq 1\nabrfhwigaihoqq bvkfwutdtvxgvx 2\nbvkfwutdtvxgvx abrfhwigaihoqq 2\nbvkfwutdtvxgvx abrfhwigaihoqq 3\nabrfhwigaihoqq rclgdpxdefqu 5\nabrfhwigaihoqq rclgdpxdefqu 6\nrclgdpxdefqu bvkfwutdtvxgvx 6",
"output": "2\nabrfhwigaihoqq bvkfwutdtvxgvx\nabrfhwigaihoqq rclgdpxdefqu"
},
{
"input": "3 1\na b 1\na b 2\nb a 2",
"output": "1\na b"
}
] | 1,660,273,433
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 13
| 124
| 102,400
|
import sys
input = sys.stdin.readline
from collections import defaultdict
n, q = map(int, input().split())
d = defaultdict(int)
s = set()
for i in range(n):
a, b, c = input()[:-1].split()
c = int(c)
d[(a, b)] = c
if (b,a) in d:
if 0 < c - d[(b,a)] <= q:
a, b = sorted([a, b])
s.add((a, b))
print(len(s))
for i in s:
print(*i)
|
Title: Friends or Not
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has a hobby — he develops an unusual social network. His work is almost completed, and there is only one more module to implement — the module which determines friends. Oh yes, in this social network one won't have to add friends manually! Pairs of friends are deduced in the following way. Let's assume that user *A* sent user *B* a message at time *t*1, and user *B* sent user *A* a message at time *t*2. If 0<=<<=*t*2<=-<=*t*1<=≤<=*d*, then user *B*'s message was an answer to user *A*'s one. Users *A* and *B* are considered to be friends if *A* answered at least one *B*'s message or *B* answered at least one *A*'s message.
You are given the log of messages in chronological order and a number *d*. Find all pairs of users who will be considered to be friends.
Input Specification:
The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=1000). The next *n* lines contain the messages log. The *i*-th line contains one line of the log formatted as "*A**i* *B**i* *t**i*" (without the quotes), which means that user *A**i* sent a message to user *B**i* at time *t**i* (1<=≤<=*i*<=≤<=*n*). *A**i* and *B**i* are non-empty strings at most 20 characters long, consisting of lowercase letters ('a' ... 'z'), and *t**i* is an integer (0<=≤<=*t**i*<=≤<=10000). It is guaranteed that the lines are given in non-decreasing order of *t**i*'s and that no user sent a message to himself. The elements in the lines are separated by single spaces.
Output Specification:
In the first line print integer *k* — the number of pairs of friends. In the next *k* lines print pairs of friends as "*A**i* *B**i*" (without the quotes). You can print users in pairs and the pairs themselves in any order. Each pair must be printed exactly once.
Demo Input:
['4 1\nvasya petya 1\npetya vasya 2\nanya ivan 2\nivan anya 4\n', '1 1000\na b 0\n']
Demo Output:
['1\npetya vasya\n', '0\n']
Note:
In the first sample test case Vasya and Petya are friends because their messages' sending times are one second apart. Anya and Ivan are not, because their messages' sending times differ by more than one second.
|
```python
import sys
input = sys.stdin.readline
from collections import defaultdict
n, q = map(int, input().split())
d = defaultdict(int)
s = set()
for i in range(n):
a, b, c = input()[:-1].split()
c = int(c)
d[(a, b)] = c
if (b,a) in d:
if 0 < c - d[(b,a)] <= q:
a, b = sorted([a, b])
s.add((a, b))
print(len(s))
for i in s:
print(*i)
```
| 0
|
|
469
|
A
|
I Wanna Be the Guy
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation"
] | null | null |
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
|
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
|
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
|
[
"4\n3 1 2 3\n2 2 4\n",
"4\n3 1 2 3\n2 2 3\n"
] |
[
"I become the guy.\n",
"Oh, my keyboard!\n"
] |
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
| 500
|
[
{
"input": "4\n3 1 2 3\n2 2 4",
"output": "I become the guy."
},
{
"input": "4\n3 1 2 3\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "10\n5 8 6 1 5 4\n6 1 3 2 9 4 6",
"output": "Oh, my keyboard!"
},
{
"input": "10\n8 8 10 7 3 1 4 2 6\n8 9 5 10 3 7 2 4 8",
"output": "I become the guy."
},
{
"input": "10\n9 6 1 8 3 9 7 5 10 4\n7 1 3 2 7 6 9 5",
"output": "I become the guy."
},
{
"input": "100\n75 83 69 73 30 76 37 48 14 41 42 21 35 15 50 61 86 85 46 3 31 13 78 10 2 44 80 95 56 82 38 75 77 4 99 9 84 53 12 11 36 74 39 72 43 89 57 28 54 1 51 66 27 22 93 59 68 88 91 29 7 20 63 8 52 23 64 58 100 79 65 49 96 71 33 45\n83 50 89 73 34 28 99 67 77 44 19 60 68 42 8 27 94 85 14 39 17 78 24 21 29 63 92 32 86 22 71 81 31 82 65 48 80 59 98 3 70 55 37 12 15 72 47 9 11 33 16 7 91 74 13 64 38 84 6 61 93 90 45 69 1 54 52 100 57 10 35 49 53 75 76 43 62 5 4 18 36 96 79 23",
"output": "Oh, my keyboard!"
},
{
"input": "1\n1 1\n1 1",
"output": "I become the guy."
},
{
"input": "1\n0\n1 1",
"output": "I become the guy."
},
{
"input": "1\n1 1\n0",
"output": "I become the guy."
},
{
"input": "1\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n44 71 70 55 49 43 16 53 7 95 58 56 38 76 67 94 20 73 29 90 25 30 8 84 5 14 77 52 99 91 66 24 39 37 22 44 78 12 63 59 32 51 15 82 34\n56 17 10 96 80 69 13 81 31 57 4 48 68 89 50 45 3 33 36 2 72 100 64 87 21 75 54 74 92 65 23 40 97 61 18 28 98 93 35 83 9 79 46 27 41 62 88 6 47 60 86 26 42 85 19 1 11",
"output": "I become the guy."
},
{
"input": "100\n78 63 59 39 11 58 4 2 80 69 22 95 90 26 65 16 30 100 66 99 67 79 54 12 23 28 45 56 70 74 60 82 73 91 68 43 92 75 51 21 17 97 86 44 62 47 85 78 72 64 50 81 71 5 57 13 31 76 87 9 49 96 25 42 19 35 88 53 7 83 38 27 29 41 89 93 10 84 18\n78 1 16 53 72 99 9 36 59 49 75 77 94 79 35 4 92 42 82 83 76 97 20 68 55 47 65 50 14 30 13 67 98 8 7 40 64 32 87 10 33 90 93 18 26 71 17 46 24 28 89 58 37 91 39 34 25 48 84 31 96 95 80 88 3 51 62 52 85 61 12 15 27 6 45 38 2 22 60",
"output": "I become the guy."
},
{
"input": "2\n2 2 1\n0",
"output": "I become the guy."
},
{
"input": "2\n1 2\n2 1 2",
"output": "I become the guy."
},
{
"input": "80\n57 40 1 47 36 69 24 76 5 72 26 4 29 62 6 60 3 70 8 64 18 37 16 14 13 21 25 7 66 68 44 74 61 39 38 33 15 63 34 65 10 23 56 51 80 58 49 75 71 12 50 57 2 30 54 27 17 52\n61 22 67 15 28 41 26 1 80 44 3 38 18 37 79 57 11 7 65 34 9 36 40 5 48 29 64 31 51 63 27 4 50 13 24 32 58 23 19 46 8 73 39 2 21 56 77 53 59 78 43 12 55 45 30 74 33 68 42 47 17 54",
"output": "Oh, my keyboard!"
},
{
"input": "100\n78 87 96 18 73 32 38 44 29 64 40 70 47 91 60 69 24 1 5 34 92 94 99 22 83 65 14 68 15 20 74 31 39 100 42 4 97 46 25 6 8 56 79 9 71 35 54 19 59 93 58 62 10 85 57 45 33 7 86 81 30 98 26 61 84 41 23 28 88 36 66 51 80 53 37 63 43 95 75\n76 81 53 15 26 37 31 62 24 87 41 39 75 86 46 76 34 4 51 5 45 65 67 48 68 23 71 27 94 47 16 17 9 96 84 89 88 100 18 52 69 42 6 92 7 64 49 12 98 28 21 99 25 55 44 40 82 19 36 30 77 90 14 43 50 3 13 95 78 35 20 54 58 11 2 1 33",
"output": "Oh, my keyboard!"
},
{
"input": "100\n77 55 26 98 13 91 78 60 23 76 12 11 36 62 84 80 18 1 68 92 81 67 19 4 2 10 17 77 96 63 15 69 46 97 82 42 83 59 50 72 14 40 89 9 52 29 56 31 74 39 45 85 22 99 44 65 95 6 90 38 54 32 49 34 3 70 75 33 94 53 21 71 5 66 73 41 100 24\n69 76 93 5 24 57 59 6 81 4 30 12 44 15 67 45 73 3 16 8 47 95 20 64 68 85 54 17 90 86 66 58 13 37 42 51 35 32 1 28 43 80 7 14 48 19 62 55 2 91 25 49 27 26 38 79 89 99 22 60 75 53 88 82 34 21 87 71 72 61",
"output": "I become the guy."
},
{
"input": "100\n74 96 32 63 12 69 72 99 15 22 1 41 79 77 71 31 20 28 75 73 85 37 38 59 42 100 86 89 55 87 68 4 24 57 52 8 92 27 56 98 95 58 34 9 45 14 11 36 66 76 61 19 25 23 78 49 90 26 80 43 70 13 65 10 5 74 81 21 44 60 97 3 47 93 6\n64 68 21 27 16 91 23 22 33 12 71 88 90 50 62 43 28 29 57 59 5 74 10 95 35 1 67 93 36 32 86 40 6 64 78 46 89 15 84 53 18 30 17 85 2 3 47 92 25 48 76 51 20 82 52 83 99 63 80 11 94 54 39 7 58",
"output": "I become the guy."
},
{
"input": "100\n75 11 98 44 47 88 94 23 78 59 70 2 43 39 34 63 71 19 42 61 30 74 14 77 97 53 92 60 67 36 37 13 6 86 62 46 41 3 25 93 7 12 27 48 55 49 31 35 51 10 57 54 95 82 28 90 73 26 17 50 81 56 20 87 40 85 72 64 99 29 91 5 80 18 24 52\n72 93 59 5 88 47 9 58 48 1 43 50 100 87 61 91 45 98 99 56 25 84 53 73 78 54 63 38 37 2 77 95 89 85 4 90 10 33 12 22 74 32 34 70 71 52 96 57 15 66 31 27 75 8 21 39 62 44 67 94 81 68 14 19 36 28 11 79 16 65 46 83 76",
"output": "Oh, my keyboard!"
},
{
"input": "3\n1 2\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "4\n1 2\n3 1 3 4",
"output": "I become the guy."
},
{
"input": "6\n2 1 2\n3 4 5 6",
"output": "Oh, my keyboard!"
}
] | 1,691,090,980
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 31
| 0
|
x = int(input())
y = list(map(int, input().split()))
z = list(map(int, input().split()))
n = y + z
if len(set(n)) == 4:
print("I become the guy.")
else:
print("oh, my keyboard!")
|
Title: I Wanna Be the Guy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
Input Specification:
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
Output Specification:
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
Demo Input:
['4\n3 1 2 3\n2 2 4\n', '4\n3 1 2 3\n2 2 3\n']
Demo Output:
['I become the guy.\n', 'Oh, my keyboard!\n']
Note:
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4.
|
```python
x = int(input())
y = list(map(int, input().split()))
z = list(map(int, input().split()))
n = y + z
if len(set(n)) == 4:
print("I become the guy.")
else:
print("oh, my keyboard!")
```
| 0
|
|
946
|
C
|
String Transformation
|
PROGRAMMING
| 1,300
|
[
"greedy",
"strings"
] | null | null |
You are given a string *s* consisting of |*s*| small english letters.
In one move you can replace any character of this string to the next character in alphabetical order (a will be replaced with b, s will be replaced with t, etc.). You cannot replace letter z with any other letter.
Your target is to make some number of moves (not necessary minimal) to get string abcdefghijklmnopqrstuvwxyz (english alphabet) as a subsequence. Subsequence of the string is the string that is obtained by deleting characters at some positions. You need to print the string that will be obtained from the given string and will be contain english alphabet as a subsequence or say that it is impossible.
|
The only one line of the input consisting of the string *s* consisting of |*s*| (1<=≤<=|*s*|<=≤<=105) small english letters.
|
If you can get a string that can be obtained from the given string and will contain english alphabet as a subsequence, print it. Otherwise print «-1» (without quotes).
|
[
"aacceeggiikkmmooqqssuuwwyy\n",
"thereisnoanswer\n"
] |
[
"abcdefghijklmnopqrstuvwxyz\n",
"-1\n"
] |
none
| 0
|
[
{
"input": "aacceeggiikkmmooqqssuuwwyy",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "thereisnoanswer",
"output": "-1"
},
{
"input": "jqcfvsaveaixhioaaeephbmsmfcgdyawscpyioybkgxlcrhaxs",
"output": "-1"
},
{
"input": "rtdacjpsjjmjdhcoprjhaenlwuvpfqzurnrswngmpnkdnunaendlpbfuylqgxtndhmhqgbsknsy",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaa"
},
{
"input": "abcdefghijklmnopqrstuvwxxx",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvwxya",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "cdaaaaaaaaabcdjklmnopqrstuvwxyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "cdabcdefghijklmnopqrstuvwxyzxyzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz"
},
{
"input": "zazaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zazbcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abbbefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaa"
},
{
"input": "abcdefghijklmaopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvwxyx",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaz"
},
{
"input": "zaaaazaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zabcdzefghijklmnopqrstuvwxyzaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaa"
},
{
"input": "aaaaaafghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyzz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaz"
},
{
"input": "abcdefghijklmnopqrstuvwaxy",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaa"
},
{
"input": "abcdefghijklmnapqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdefghijklmnopqrstuvnxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaa"
},
{
"input": "abcdefghijklmnopqrstuvwxyzzzz",
"output": "abcdefghijklmnopqrstuvwxyzzzz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aacceeggiikkmmooqqssuuwwya",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aacdefghijklmnopqrstuvwxyyy",
"output": "abcdefghijklmnopqrstuvwxyzy"
},
{
"input": "abcaefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "zaaacaaaaaaaaaaaaaaaaaaaayy",
"output": "zabcdefghijklmnopqrstuvwxyz"
},
{
"input": "abcdedccdcdccdcdcdcdcdcddccdcdcdc",
"output": "abcdefghijklmnopqrstuvwxyzcdcdcdc"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "abcdecdcdcddcdcdcdcdcdcdcd",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "abaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "a",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaa"
},
{
"input": "aaadefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaa"
},
{
"input": "abbbbbbbbbbbbbbbbbbbbbbbbz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aacceeggiikkmmaacceeggiikkmmooaacceeggiikkmmaacceeggiikkmmooqqssuuwwzy",
"output": "abcdefghijklmnopqrstuvwxyzmmooaacceeggiikkmmaacceeggiikkmmooqqssuuwwzy"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "phqghumeaylnlfdxfircvscxggbwkfnqduxwfnfozvsrtkjprepggxrpnrvystmwcysyycqpevikeffmznimkkasvwsrenzkycxf",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaap",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "zabcdefghijklmnopqrstuvwxyz",
"output": "zabcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyza"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzabcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "rveviaomdienfygifatviahordebxazoxflfgzslhyzowhxbhqzpsgellkoimnwkvhpbijorhpggwfjexivpqbcbmqjyghkbq",
"output": "rveviaomdienfygifbtvichordefxgzoxhlijzslkyzowlxmnqzpsopqrstuvwxyzhpbijorhpggwfjexivpqbcbmqjyghkbq"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "xtlsgypsfadpooefxzbcoejuvpvaboygpoeylfpbnpljvrvipyamyehwqnqrqpmxujjloovaowuxwhmsncbxcoksfzkvatxdknly",
"output": "xtlsgypsfadpooefxzbcoejuvpvdeoygpofylgphnpljvrvipyjmyklwqnqrqpmxunopqrvstwuxwvwxyzbxcoksfzkvatxdknly"
},
{
"input": "jqcfvsaveaixhioaaeephbmsmfcgdyawscpyioybkgxlcrhaxsa",
"output": "jqcfvsavebixhiocdefphgmsmhijkylwsmpynoypqrxstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "wlrbbmqbhcdarzowkkyhiddqscdxrjmowfrxsjybldbefsarcbynecdyggxxpklorellnmpapqfwkhopkmcoqh",
"output": "wlrbbmqbhcdarzowkkyhiddqscdxrjmowfrxsjybldcefsdrefynghiyjkxxplmornopqrstuvwxyzopkmcoqh"
},
{
"input": "abadefghijklmnopqrstuvwxyz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "zazsazcbbbbbbbbbbbbbbbbbbbbbbb",
"output": "zazsbzcdefghijklmnopqrstuvwxyz"
},
{
"input": "zazsazcbbbbbbbbbbbbbbbbbbbbbyb",
"output": "zazsbzcdefghijklmnopqrstuvwxyz"
},
{
"input": "bbcdefghijklmnopqrstuvwxyzzz",
"output": "-1"
},
{
"input": "zaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zabcdefghijklmnopqrstuvwxyz"
},
{
"input": "zzzzzaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "zzzzzabcdefghijklmnopqrstuvwxyza"
},
{
"input": "kkimnfjbbgggicykcciwtoazomcvisigagkjwhyrmojmoebnqoadpmockfjxibdtvrbedrsdoundbcpkfdqdidqdmxdltink",
"output": "kkimnfjbbgggicykcciwtoazomcvisigbgkjwhyrmojmoecnqodepmofkgjxihitvrjklrsmounopqrstuvwxyzdmxdltink"
},
{
"input": "cawgathqceccscakbazmhwbefvygjbcfyihcbgga",
"output": "-1"
},
{
"input": "acrsbyszsbfslzbqzzamcmrypictkcheddehvxdipaxaannjodzyfxgtfnwababzjraapqbqbfzhbiewlzz",
"output": "acrsbyszscfslzdqzzemfmrypigtkhijklmnvxopqrxstuvwxyzyfxgtfnwababzjraapqbqbfzhbiewlzz"
},
{
"input": "ggcebbheeblbioxdvtlrtkxeuilonazpebcbqpzz",
"output": "-1"
},
{
"input": "zzzzabcdefghijklmnopqrstuvwxy",
"output": "-1"
},
{
"input": "zabcdefghijklmnopqrstuvwxy",
"output": "-1"
},
{
"input": "babcdefghijklmnopqrstuvwxyz",
"output": "babcdefghijklmnopqrstuvwxyz"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "-1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "abcdefghijklmnopqrstuvwxyzaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
}
] | 1,601,115,203
| 803
|
PyPy 3
|
OK
|
TESTS
| 102
| 155
| 4,096,000
|
import sys
s = list(input())
cc = 97
for i in range(len(s)):
if cc >= ord(s[i]):
s[i] = chr(cc)
cc += 1
if cc > 122:
print(''.join(s))
break
else:
print(-1)
|
Title: String Transformation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a string *s* consisting of |*s*| small english letters.
In one move you can replace any character of this string to the next character in alphabetical order (a will be replaced with b, s will be replaced with t, etc.). You cannot replace letter z with any other letter.
Your target is to make some number of moves (not necessary minimal) to get string abcdefghijklmnopqrstuvwxyz (english alphabet) as a subsequence. Subsequence of the string is the string that is obtained by deleting characters at some positions. You need to print the string that will be obtained from the given string and will be contain english alphabet as a subsequence or say that it is impossible.
Input Specification:
The only one line of the input consisting of the string *s* consisting of |*s*| (1<=≤<=|*s*|<=≤<=105) small english letters.
Output Specification:
If you can get a string that can be obtained from the given string and will contain english alphabet as a subsequence, print it. Otherwise print «-1» (without quotes).
Demo Input:
['aacceeggiikkmmooqqssuuwwyy\n', 'thereisnoanswer\n']
Demo Output:
['abcdefghijklmnopqrstuvwxyz\n', '-1\n']
Note:
none
|
```python
import sys
s = list(input())
cc = 97
for i in range(len(s)):
if cc >= ord(s[i]):
s[i] = chr(cc)
cc += 1
if cc > 122:
print(''.join(s))
break
else:
print(-1)
```
| 3
|
|
811
|
A
|
Vladik and Courtesy
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
At regular competition Vladik and Valera won *a* and *b* candies respectively. Vladik offered 1 his candy to Valera. After that Valera gave Vladik 2 his candies, so that no one thought that he was less generous. Vladik for same reason gave 3 candies to Valera in next turn.
More formally, the guys take turns giving each other one candy more than they received in the previous turn.
This continued until the moment when one of them couldn’t give the right amount of candy. Candies, which guys got from each other, they don’t consider as their own. You need to know, who is the first who can’t give the right amount of candy.
|
Single line of input data contains two space-separated integers *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) — number of Vladik and Valera candies respectively.
|
Pring a single line "Vladik’’ in case, if Vladik first who can’t give right amount of candy, or "Valera’’ otherwise.
|
[
"1 1\n",
"7 6\n"
] |
[
"Valera\n",
"Vladik\n"
] |
Illustration for first test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/ad9b7d0e481208de8e3a585aa1d96b9e1dda4fd7.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Illustration for second test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/9f4836d2ccdffaee5a63898e5d4e6caf2ed4678c.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 500
|
[
{
"input": "1 1",
"output": "Valera"
},
{
"input": "7 6",
"output": "Vladik"
},
{
"input": "25 38",
"output": "Vladik"
},
{
"input": "8311 2468",
"output": "Valera"
},
{
"input": "250708 857756",
"output": "Vladik"
},
{
"input": "957985574 24997558",
"output": "Valera"
},
{
"input": "999963734 999994456",
"output": "Vladik"
},
{
"input": "1000000000 1000000000",
"output": "Vladik"
},
{
"input": "946 879",
"output": "Valera"
},
{
"input": "10819 45238",
"output": "Vladik"
},
{
"input": "101357 236928",
"output": "Vladik"
},
{
"input": "1033090 7376359",
"output": "Vladik"
},
{
"input": "9754309 9525494",
"output": "Valera"
},
{
"input": "90706344 99960537",
"output": "Vladik"
},
{
"input": "965161805 908862070",
"output": "Valera"
},
{
"input": "9 11",
"output": "Valera"
},
{
"input": "3 2",
"output": "Vladik"
},
{
"input": "6 6",
"output": "Vladik"
},
{
"input": "4 4",
"output": "Valera"
},
{
"input": "5 5",
"output": "Valera"
},
{
"input": "5 4",
"output": "Valera"
},
{
"input": "12345680 1",
"output": "Valera"
},
{
"input": "9 10",
"output": "Valera"
},
{
"input": "678 76687",
"output": "Vladik"
},
{
"input": "1 678",
"output": "Vladik"
},
{
"input": "45 1678",
"output": "Vladik"
},
{
"input": "3 3",
"output": "Vladik"
},
{
"input": "10 11",
"output": "Valera"
},
{
"input": "2 1",
"output": "Valera"
},
{
"input": "1 2",
"output": "Vladik"
},
{
"input": "2 2",
"output": "Vladik"
},
{
"input": "4 5",
"output": "Valera"
},
{
"input": "9 6",
"output": "Valera"
},
{
"input": "1 5",
"output": "Vladik"
},
{
"input": "7 8",
"output": "Vladik"
},
{
"input": "1000000000 999982505",
"output": "Valera"
},
{
"input": "12 12",
"output": "Vladik"
},
{
"input": "1000 950",
"output": "Valera"
},
{
"input": "10 9",
"output": "Valera"
},
{
"input": "100 9",
"output": "Valera"
},
{
"input": "1000 996",
"output": "Vladik"
},
{
"input": "9 5",
"output": "Valera"
}
] | 1,495,880,698
| 2,998
|
Python 3
|
OK
|
TESTS
| 42
| 77
| 0
|
# -*- coding: utf-8 -*-
from sys import stdin
def regalar_dulces(dulces_vladik, dulces_valera):
cantidad_dulces = 1
dona_vladik = True
dona_valera = False
while True:
if dona_vladik is True:
if dulces_vladik >= cantidad_dulces:
dulces_vladik -= cantidad_dulces
dona_vladik = False
dona_valera = True
cantidad_dulces += 1
else:
print("Vladik")
break
if dona_valera is True:
if dulces_valera >= cantidad_dulces:
dulces_valera -= cantidad_dulces
dona_valera = False
dona_vladik = True
cantidad_dulces += 1
else:
print("Valera")
break
# Inicio del Programa
for line in stdin:
cant = line.splitlines()
break
a = cant[0].split()[0]
b = cant[0].split()[1]
regalar_dulces(int(a), int(b))
|
Title: Vladik and Courtesy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
At regular competition Vladik and Valera won *a* and *b* candies respectively. Vladik offered 1 his candy to Valera. After that Valera gave Vladik 2 his candies, so that no one thought that he was less generous. Vladik for same reason gave 3 candies to Valera in next turn.
More formally, the guys take turns giving each other one candy more than they received in the previous turn.
This continued until the moment when one of them couldn’t give the right amount of candy. Candies, which guys got from each other, they don’t consider as their own. You need to know, who is the first who can’t give the right amount of candy.
Input Specification:
Single line of input data contains two space-separated integers *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) — number of Vladik and Valera candies respectively.
Output Specification:
Pring a single line "Vladik’’ in case, if Vladik first who can’t give right amount of candy, or "Valera’’ otherwise.
Demo Input:
['1 1\n', '7 6\n']
Demo Output:
['Valera\n', 'Vladik\n']
Note:
Illustration for first test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/ad9b7d0e481208de8e3a585aa1d96b9e1dda4fd7.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Illustration for second test case:
<img class="tex-graphics" src="https://espresso.codeforces.com/9f4836d2ccdffaee5a63898e5d4e6caf2ed4678c.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
# -*- coding: utf-8 -*-
from sys import stdin
def regalar_dulces(dulces_vladik, dulces_valera):
cantidad_dulces = 1
dona_vladik = True
dona_valera = False
while True:
if dona_vladik is True:
if dulces_vladik >= cantidad_dulces:
dulces_vladik -= cantidad_dulces
dona_vladik = False
dona_valera = True
cantidad_dulces += 1
else:
print("Vladik")
break
if dona_valera is True:
if dulces_valera >= cantidad_dulces:
dulces_valera -= cantidad_dulces
dona_valera = False
dona_vladik = True
cantidad_dulces += 1
else:
print("Valera")
break
# Inicio del Programa
for line in stdin:
cant = line.splitlines()
break
a = cant[0].split()[0]
b = cant[0].split()[1]
regalar_dulces(int(a), int(b))
```
| 3
|
|
1,006
|
B
|
Polycarp's Practice
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Polycarp is practicing his problem solving skill. He has a list of $n$ problems with difficulties $a_1, a_2, \dots, a_n$, respectively. His plan is to practice for exactly $k$ days. Each day he has to solve at least one problem from his list. Polycarp solves the problems in the order they are given in his list, he cannot skip any problem from his list. He has to solve all $n$ problems in exactly $k$ days.
Thus, each day Polycarp solves a contiguous sequence of (consecutive) problems from the start of the list. He can't skip problems or solve them multiple times. As a result, in $k$ days he will solve all the $n$ problems.
The profit of the $j$-th day of Polycarp's practice is the maximum among all the difficulties of problems Polycarp solves during the $j$-th day (i.e. if he solves problems with indices from $l$ to $r$ during a day, then the profit of the day is $\max\limits_{l \le i \le r}a_i$). The total profit of his practice is the sum of the profits over all $k$ days of his practice.
You want to help Polycarp to get the maximum possible total profit over all valid ways to solve problems. Your task is to distribute all $n$ problems between $k$ days satisfying the conditions above in such a way, that the total profit is maximum.
For example, if $n = 8, k = 3$ and $a = [5, 4, 2, 6, 5, 1, 9, 2]$, one of the possible distributions with maximum total profit is: $[5, 4, 2], [6, 5], [1, 9, 2]$. Here the total profit equals $5 + 6 + 9 = 20$.
|
The first line of the input contains two integers $n$ and $k$ ($1 \le k \le n \le 2000$) — the number of problems and the number of days, respectively.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 2000$) — difficulties of problems in Polycarp's list, in the order they are placed in the list (i.e. in the order Polycarp will solve them).
|
In the first line of the output print the maximum possible total profit.
In the second line print exactly $k$ positive integers $t_1, t_2, \dots, t_k$ ($t_1 + t_2 + \dots + t_k$ must equal $n$), where $t_j$ means the number of problems Polycarp will solve during the $j$-th day in order to achieve the maximum possible total profit of his practice.
If there are many possible answers, you may print any of them.
|
[
"8 3\n5 4 2 6 5 1 9 2\n",
"5 1\n1 1 1 1 1\n",
"4 2\n1 2000 2000 2\n"
] |
[
"20\n3 2 3",
"1\n5\n",
"4000\n2 2\n"
] |
The first example is described in the problem statement.
In the second example there is only one possible distribution.
In the third example the best answer is to distribute problems in the following way: $[1, 2000], [2000, 2]$. The total profit of this distribution is $2000 + 2000 = 4000$.
| 0
|
[
{
"input": "8 3\n5 4 2 6 5 1 9 2",
"output": "20\n4 1 3"
},
{
"input": "5 1\n1 1 1 1 1",
"output": "1\n5"
},
{
"input": "4 2\n1 2000 2000 2",
"output": "4000\n2 2"
},
{
"input": "1 1\n2000",
"output": "2000\n1"
},
{
"input": "1 1\n1234",
"output": "1234\n1"
},
{
"input": "3 2\n1 1 1",
"output": "2\n2 1"
},
{
"input": "4 2\n3 5 1 1",
"output": "8\n1 3"
},
{
"input": "5 3\n5 5 6 7 1",
"output": "18\n2 1 2"
},
{
"input": "6 4\n1 1 1 1 2 2",
"output": "6\n3 1 1 1"
},
{
"input": "5 3\n5 5 6 6 4",
"output": "17\n2 1 2"
},
{
"input": "16 15\n14 4 9 12 17 1 1 8 12 13 6 9 17 2 18 12",
"output": "154\n1 1 1 1 1 2 1 1 1 1 1 1 1 1 1"
},
{
"input": "1 1\n1996",
"output": "1996\n1"
},
{
"input": "5 3\n5 5 5 9 10",
"output": "24\n3 1 1"
},
{
"input": "18 15\n18 2 13 1 18 3 2 18 18 20 9 2 20 20 4 20 9 12",
"output": "204\n1 2 2 1 2 1 1 1 1 1 1 1 1 1 1"
},
{
"input": "5 3\n1 20 20 50 50",
"output": "120\n3 1 1"
},
{
"input": "8 3\n15 14 11 19 17 14 14 8",
"output": "51\n1 3 4"
},
{
"input": "5 2\n15 20 6 19 6",
"output": "39\n2 3"
},
{
"input": "6 3\n5 5 5 5 6 9",
"output": "20\n4 1 1"
},
{
"input": "5 3\n2 2 2 3 3",
"output": "8\n3 1 1"
},
{
"input": "7 3\n2 2 2 2 2 3 3",
"output": "8\n5 1 1"
},
{
"input": "6 5\n1 1 6 6 6 6",
"output": "25\n2 1 1 1 1"
},
{
"input": "8 4\n1 2 2 2 2 3 4 5",
"output": "14\n5 1 1 1"
},
{
"input": "6 4\n1 1 1 5 5 5",
"output": "16\n3 1 1 1"
},
{
"input": "6 3\n1 2 2 2 4 5",
"output": "11\n4 1 1"
},
{
"input": "18 6\n17 17 19 14 10 20 18 16 6 7 2 15 14 16 13 6 12 11",
"output": "107\n1 1 1 3 1 11"
},
{
"input": "6 3\n1 1 2 2 3 4",
"output": "9\n4 1 1"
},
{
"input": "8 3\n5 4 2 5 6 1 9 2",
"output": "20\n4 1 3"
}
] | 1,595,831,570
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 156
| 23,449,600
|
z,zz=input,lambda:map(int,z().split());n,k=zz()
l=sorted(zip(zz(),range(n)))[-k:]
print(sum(i[0] for i in l))
p=sorted(i[1] for i in l)+[n];p[0]=0
for x,y in zip(p,p[1:]):
print(y-x,end=' ')
|
Title: Polycarp's Practice
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is practicing his problem solving skill. He has a list of $n$ problems with difficulties $a_1, a_2, \dots, a_n$, respectively. His plan is to practice for exactly $k$ days. Each day he has to solve at least one problem from his list. Polycarp solves the problems in the order they are given in his list, he cannot skip any problem from his list. He has to solve all $n$ problems in exactly $k$ days.
Thus, each day Polycarp solves a contiguous sequence of (consecutive) problems from the start of the list. He can't skip problems or solve them multiple times. As a result, in $k$ days he will solve all the $n$ problems.
The profit of the $j$-th day of Polycarp's practice is the maximum among all the difficulties of problems Polycarp solves during the $j$-th day (i.e. if he solves problems with indices from $l$ to $r$ during a day, then the profit of the day is $\max\limits_{l \le i \le r}a_i$). The total profit of his practice is the sum of the profits over all $k$ days of his practice.
You want to help Polycarp to get the maximum possible total profit over all valid ways to solve problems. Your task is to distribute all $n$ problems between $k$ days satisfying the conditions above in such a way, that the total profit is maximum.
For example, if $n = 8, k = 3$ and $a = [5, 4, 2, 6, 5, 1, 9, 2]$, one of the possible distributions with maximum total profit is: $[5, 4, 2], [6, 5], [1, 9, 2]$. Here the total profit equals $5 + 6 + 9 = 20$.
Input Specification:
The first line of the input contains two integers $n$ and $k$ ($1 \le k \le n \le 2000$) — the number of problems and the number of days, respectively.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 2000$) — difficulties of problems in Polycarp's list, in the order they are placed in the list (i.e. in the order Polycarp will solve them).
Output Specification:
In the first line of the output print the maximum possible total profit.
In the second line print exactly $k$ positive integers $t_1, t_2, \dots, t_k$ ($t_1 + t_2 + \dots + t_k$ must equal $n$), where $t_j$ means the number of problems Polycarp will solve during the $j$-th day in order to achieve the maximum possible total profit of his practice.
If there are many possible answers, you may print any of them.
Demo Input:
['8 3\n5 4 2 6 5 1 9 2\n', '5 1\n1 1 1 1 1\n', '4 2\n1 2000 2000 2\n']
Demo Output:
['20\n3 2 3', '1\n5\n', '4000\n2 2\n']
Note:
The first example is described in the problem statement.
In the second example there is only one possible distribution.
In the third example the best answer is to distribute problems in the following way: $[1, 2000], [2000, 2]$. The total profit of this distribution is $2000 + 2000 = 4000$.
|
```python
z,zz=input,lambda:map(int,z().split());n,k=zz()
l=sorted(zip(zz(),range(n)))[-k:]
print(sum(i[0] for i in l))
p=sorted(i[1] for i in l)+[n];p[0]=0
for x,y in zip(p,p[1:]):
print(y-x,end=' ')
```
| 3
|
|
69
|
E
|
Subsegments
|
PROGRAMMING
| 1,800
|
[
"data structures",
"implementation"
] |
E. Subsegments
|
1
|
256
|
Programmer Sasha has recently begun to study data structures. His coach Stas told him to solve the problem of finding a minimum on the segment of the array in , which Sasha coped with. For Sasha not to think that he had learned all, Stas gave him a new task. For each segment of the fixed length Sasha must find the maximum element of those that occur on the given segment exactly once. Help Sasha solve this problem.
|
The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*k*<=≤<=*n*) — the number of array elements and the length of the segment.
Then follow *n* lines: the *i*-th one contains a single number *a**i* (<=-<=109<=≤<=*a**i*<=≤<=109).
|
Print *n*–*k*<=+<=1 numbers, one per line: on the *i*-th line print of the maximum number of those numbers from the subarray *a**i* *a**i*<=+<=1 … *a**i*<=+<=*k*<=-<=1 that occur in this subarray exactly 1 time. If there are no such numbers in this subarray, print "Nothing".
|
[
"5 3\n1\n2\n2\n3\n3\n",
"6 4\n3\n3\n3\n4\n4\n2\n"
] |
[
"1\n3\n2\n",
"4\nNothing\n3\n"
] |
none
| 2,500
|
[
{
"input": "5 3\n1\n2\n2\n3\n3",
"output": "1\n3\n2"
},
{
"input": "6 4\n3\n3\n3\n4\n4\n2",
"output": "4\nNothing\n3"
},
{
"input": "10 3\n-55\n-35\n-80\n91\n-96\n-93\n-39\n-77\n4\n29",
"output": "-35\n91\n91\n91\n-39\n-39\n4\n29"
},
{
"input": "10 3\n-13\n26\n-97\n-38\n43\n-12\n80\n3\n8\n45",
"output": "26\n26\n43\n43\n80\n80\n80\n45"
},
{
"input": "10 3\n-84\n25\n-25\n8\n60\n-74\n-98\n48\n-55\n38",
"output": "25\n25\n60\n60\n60\n48\n48\n48"
},
{
"input": "10 3\n-62\n-81\n46\n22\n-84\n19\n-86\n44\n-84\n-73",
"output": "46\n46\n46\n22\n19\n44\n44\n44"
},
{
"input": "10 3\n-6\n2\n79\n-49\n86\n13\n-31\n-71\n57\n93",
"output": "79\n79\n86\n86\n86\n13\n57\n93"
},
{
"input": "10 3\n-38\n68\n-77\n57\n-35\n28\n-61\n-9\n3\n60",
"output": "68\n68\n57\n57\n28\n28\n3\n60"
},
{
"input": "10 3\n2\n-100\n50\n-85\n-48\n68\n-96\n-31\n85\n-29",
"output": "50\n50\n50\n68\n68\n68\n85\n85"
},
{
"input": "10 3\n-20\n-63\n-64\n45\n-84\n-13\n79\n-31\n70\n-100",
"output": "-20\n45\n45\n45\n79\n79\n79\n70"
}
] | 1,602,878,408
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 78
| 307,200
|
import sys
n, k = map(int, input().split())
c = {}
for q in range(k - 1):
x = int(input())
c[x] = c.get(x, 0) + 1
for w in range(k - 1, n):
x = int(input())
c[x] = c.get(x, 0) + 1
v = list(c.keys())
if w >= k:
c[v[w - k]] = c.get(v[w - k], 0) - 1
t = list(c.values())
if t.count(1) < 1:
print('Nothing')
else:
y = len(c) - t[::-1].index(1) - 1
print(v[y])
|
Title: Subsegments
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Programmer Sasha has recently begun to study data structures. His coach Stas told him to solve the problem of finding a minimum on the segment of the array in , which Sasha coped with. For Sasha not to think that he had learned all, Stas gave him a new task. For each segment of the fixed length Sasha must find the maximum element of those that occur on the given segment exactly once. Help Sasha solve this problem.
Input Specification:
The first line contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*k*<=≤<=*n*) — the number of array elements and the length of the segment.
Then follow *n* lines: the *i*-th one contains a single number *a**i* (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
Print *n*–*k*<=+<=1 numbers, one per line: on the *i*-th line print of the maximum number of those numbers from the subarray *a**i* *a**i*<=+<=1 … *a**i*<=+<=*k*<=-<=1 that occur in this subarray exactly 1 time. If there are no such numbers in this subarray, print "Nothing".
Demo Input:
['5 3\n1\n2\n2\n3\n3\n', '6 4\n3\n3\n3\n4\n4\n2\n']
Demo Output:
['1\n3\n2\n', '4\nNothing\n3\n']
Note:
none
|
```python
import sys
n, k = map(int, input().split())
c = {}
for q in range(k - 1):
x = int(input())
c[x] = c.get(x, 0) + 1
for w in range(k - 1, n):
x = int(input())
c[x] = c.get(x, 0) + 1
v = list(c.keys())
if w >= k:
c[v[w - k]] = c.get(v[w - k], 0) - 1
t = list(c.values())
if t.count(1) < 1:
print('Nothing')
else:
y = len(c) - t[::-1].index(1) - 1
print(v[y])
```
| 0
|
313
|
A
|
Ilya and Bank Account
|
PROGRAMMING
| 900
|
[
"implementation",
"number theory"
] | null | null |
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money.
Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance.
Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
|
The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account.
|
In a single line print an integer — the maximum state of the bank account that Ilya can get.
|
[
"2230\n",
"-10\n",
"-100003\n"
] |
[
"2230\n",
"0\n",
"-10000\n"
] |
In the first test sample Ilya doesn't profit from using the present.
In the second test sample you can delete digit 1 and get the state of the account equal to 0.
| 500
|
[
{
"input": "2230",
"output": "2230"
},
{
"input": "-10",
"output": "0"
},
{
"input": "-100003",
"output": "-10000"
},
{
"input": "544883178",
"output": "544883178"
},
{
"input": "-847251738",
"output": "-84725173"
},
{
"input": "423654797",
"output": "423654797"
},
{
"input": "-623563697",
"output": "-62356367"
},
{
"input": "645894116",
"output": "645894116"
},
{
"input": "-384381709",
"output": "-38438170"
},
{
"input": "437587210",
"output": "437587210"
},
{
"input": "-297534606",
"output": "-29753460"
},
{
"input": "891773002",
"output": "891773002"
},
{
"input": "-56712976",
"output": "-5671296"
},
{
"input": "963662765",
"output": "963662765"
},
{
"input": "-272656295",
"output": "-27265625"
},
{
"input": "383441522",
"output": "383441522"
},
{
"input": "-477665112",
"output": "-47766511"
},
{
"input": "791725034",
"output": "791725034"
},
{
"input": "-812168727",
"output": "-81216872"
},
{
"input": "528894922",
"output": "528894922"
},
{
"input": "-479977172",
"output": "-47997712"
},
{
"input": "568044564",
"output": "568044564"
},
{
"input": "-392784794",
"output": "-39278474"
},
{
"input": "925596634",
"output": "925596634"
},
{
"input": "-836078769",
"output": "-83607876"
},
{
"input": "71036059",
"output": "71036059"
},
{
"input": "-337396162",
"output": "-33739612"
},
{
"input": "87129297",
"output": "87129297"
},
{
"input": "-648171877",
"output": "-64817187"
},
{
"input": "20218400",
"output": "20218400"
},
{
"input": "10",
"output": "10"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "-1000000000",
"output": "-100000000"
},
{
"input": "-102",
"output": "-10"
},
{
"input": "-120",
"output": "-10"
},
{
"input": "-20",
"output": "0"
},
{
"input": "-15",
"output": "-1"
},
{
"input": "-5575533",
"output": "-557553"
},
{
"input": "-50",
"output": "0"
},
{
"input": "-31",
"output": "-1"
},
{
"input": "-55",
"output": "-5"
},
{
"input": "-81",
"output": "-1"
},
{
"input": "-99",
"output": "-9"
},
{
"input": "-23",
"output": "-2"
},
{
"input": "-41",
"output": "-1"
},
{
"input": "-24",
"output": "-2"
},
{
"input": "46",
"output": "46"
}
] | 1,698,091,086
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 60
| 0
|
n = int(input())
# Case 1: If the account balance is non-negative or becomes non-negative after removing one digit, keep it as is.
if n >= 0 or (-n) % 10 <= (-n) // 10:
print(n)
else:
# Case 2: If removing a digit won't make it non-negative, maximize the account balance by choosing the larger option.
option1 = (n // 10)
option2 = (n // 100) * 10 + n % 10
print(max(option1, option2))
|
Title: Ilya and Bank Account
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money.
Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance.
Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
Input Specification:
The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account.
Output Specification:
In a single line print an integer — the maximum state of the bank account that Ilya can get.
Demo Input:
['2230\n', '-10\n', '-100003\n']
Demo Output:
['2230\n', '0\n', '-10000\n']
Note:
In the first test sample Ilya doesn't profit from using the present.
In the second test sample you can delete digit 1 and get the state of the account equal to 0.
|
```python
n = int(input())
# Case 1: If the account balance is non-negative or becomes non-negative after removing one digit, keep it as is.
if n >= 0 or (-n) % 10 <= (-n) // 10:
print(n)
else:
# Case 2: If removing a digit won't make it non-negative, maximize the account balance by choosing the larger option.
option1 = (n // 10)
option2 = (n // 100) * 10 + n % 10
print(max(option1, option2))
```
| 0
|
|
217
|
A
|
Ice Skating
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dfs and similar",
"dsu",
"graphs"
] | null | null |
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
|
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
|
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
|
[
"2\n2 1\n1 2\n",
"2\n2 1\n4 1\n"
] |
[
"1\n",
"0\n"
] |
none
| 500
|
[
{
"input": "2\n2 1\n1 2",
"output": "1"
},
{
"input": "2\n2 1\n4 1",
"output": "0"
},
{
"input": "24\n171 35\n261 20\n4 206\n501 446\n961 912\n581 748\n946 978\n463 514\n841 889\n341 466\n842 967\n54 102\n235 261\n925 889\n682 672\n623 636\n268 94\n635 710\n474 510\n697 794\n586 663\n182 184\n806 663\n468 459",
"output": "21"
},
{
"input": "17\n660 646\n440 442\n689 618\n441 415\n922 865\n950 972\n312 366\n203 229\n873 860\n219 199\n344 308\n169 176\n961 992\n153 84\n201 230\n987 938\n834 815",
"output": "16"
},
{
"input": "11\n798 845\n722 911\n374 270\n629 537\n748 856\n831 885\n486 641\n751 829\n609 492\n98 27\n654 663",
"output": "10"
},
{
"input": "1\n321 88",
"output": "0"
},
{
"input": "9\n811 859\n656 676\n76 141\n945 951\n497 455\n18 55\n335 294\n267 275\n656 689",
"output": "7"
},
{
"input": "7\n948 946\n130 130\n761 758\n941 938\n971 971\n387 385\n509 510",
"output": "6"
},
{
"input": "6\n535 699\n217 337\n508 780\n180 292\n393 112\n732 888",
"output": "5"
},
{
"input": "14\n25 23\n499 406\n193 266\n823 751\n219 227\n101 138\n978 992\n43 74\n997 932\n237 189\n634 538\n774 740\n842 767\n742 802",
"output": "13"
},
{
"input": "12\n548 506\n151 198\n370 380\n655 694\n654 690\n407 370\n518 497\n819 827\n765 751\n802 771\n741 752\n653 662",
"output": "11"
},
{
"input": "40\n685 711\n433 403\n703 710\n491 485\n616 619\n288 282\n884 871\n367 352\n500 511\n977 982\n51 31\n576 564\n508 519\n755 762\n22 20\n368 353\n232 225\n953 955\n452 436\n311 330\n967 988\n369 364\n791 803\n150 149\n651 661\n118 93\n398 387\n748 766\n852 852\n230 228\n555 545\n515 519\n667 678\n867 862\n134 146\n859 863\n96 99\n486 469\n303 296\n780 786",
"output": "38"
},
{
"input": "3\n175 201\n907 909\n388 360",
"output": "2"
},
{
"input": "7\n312 298\n86 78\n73 97\n619 594\n403 451\n538 528\n71 86",
"output": "6"
},
{
"input": "19\n802 820\n368 248\n758 794\n455 378\n876 888\n771 814\n245 177\n586 555\n844 842\n364 360\n820 856\n731 624\n982 975\n825 856\n122 121\n862 896\n42 4\n792 841\n828 820",
"output": "16"
},
{
"input": "32\n643 877\n842 614\n387 176\n99 338\n894 798\n652 728\n611 648\n622 694\n579 781\n243 46\n322 305\n198 438\n708 579\n246 325\n536 459\n874 593\n120 277\n989 907\n223 110\n35 130\n761 692\n690 661\n518 766\n226 93\n678 597\n725 617\n661 574\n775 496\n56 416\n14 189\n358 359\n898 901",
"output": "31"
},
{
"input": "32\n325 327\n20 22\n72 74\n935 933\n664 663\n726 729\n785 784\n170 171\n315 314\n577 580\n984 987\n313 317\n434 435\n962 961\n55 54\n46 44\n743 742\n434 433\n617 612\n332 332\n883 886\n940 936\n793 792\n645 644\n611 607\n418 418\n465 465\n219 218\n167 164\n56 54\n403 405\n210 210",
"output": "29"
},
{
"input": "32\n652 712\n260 241\n27 154\n188 16\n521 351\n518 356\n452 540\n790 827\n339 396\n336 551\n897 930\n828 627\n27 168\n180 113\n134 67\n794 671\n812 711\n100 241\n686 813\n138 289\n384 506\n884 932\n913 959\n470 508\n730 734\n373 478\n788 862\n392 426\n148 68\n113 49\n713 852\n924 894",
"output": "29"
},
{
"input": "14\n685 808\n542 677\n712 747\n832 852\n187 410\n399 338\n626 556\n530 635\n267 145\n215 209\n559 684\n944 949\n753 596\n601 823",
"output": "13"
},
{
"input": "5\n175 158\n16 2\n397 381\n668 686\n957 945",
"output": "4"
},
{
"input": "5\n312 284\n490 509\n730 747\n504 497\n782 793",
"output": "4"
},
{
"input": "2\n802 903\n476 348",
"output": "1"
},
{
"input": "4\n325 343\n425 442\n785 798\n275 270",
"output": "3"
},
{
"input": "28\n462 483\n411 401\n118 94\n111 127\n5 6\n70 52\n893 910\n73 63\n818 818\n182 201\n642 633\n900 886\n893 886\n684 700\n157 173\n953 953\n671 660\n224 225\n832 801\n152 157\n601 585\n115 101\n739 722\n611 606\n659 642\n461 469\n702 689\n649 653",
"output": "25"
},
{
"input": "36\n952 981\n885 900\n803 790\n107 129\n670 654\n143 132\n66 58\n813 819\n849 837\n165 198\n247 228\n15 39\n619 618\n105 138\n868 855\n965 957\n293 298\n613 599\n227 212\n745 754\n723 704\n877 858\n503 487\n678 697\n592 595\n155 135\n962 982\n93 89\n660 673\n225 212\n967 987\n690 680\n804 813\n489 518\n240 221\n111 124",
"output": "34"
},
{
"input": "30\n89 3\n167 156\n784 849\n943 937\n144 95\n24 159\n80 120\n657 683\n585 596\n43 147\n909 964\n131 84\n345 389\n333 321\n91 126\n274 325\n859 723\n866 922\n622 595\n690 752\n902 944\n127 170\n426 383\n905 925\n172 284\n793 810\n414 510\n890 884\n123 24\n267 255",
"output": "29"
},
{
"input": "5\n664 666\n951 941\n739 742\n844 842\n2 2",
"output": "4"
},
{
"input": "3\n939 867\n411 427\n757 708",
"output": "2"
},
{
"input": "36\n429 424\n885 972\n442 386\n512 511\n751 759\n4 115\n461 497\n496 408\n8 23\n542 562\n296 331\n448 492\n412 395\n109 166\n622 640\n379 355\n251 262\n564 586\n66 115\n275 291\n666 611\n629 534\n510 567\n635 666\n738 803\n420 369\n92 17\n101 144\n141 92\n258 258\n184 235\n492 456\n311 210\n394 357\n531 512\n634 636",
"output": "34"
},
{
"input": "29\n462 519\n871 825\n127 335\n156 93\n576 612\n885 830\n634 779\n340 105\n744 795\n716 474\n93 139\n563 805\n137 276\n177 101\n333 14\n391 437\n873 588\n817 518\n460 597\n572 670\n140 303\n392 441\n273 120\n862 578\n670 639\n410 161\n544 577\n193 116\n252 195",
"output": "28"
},
{
"input": "23\n952 907\n345 356\n812 807\n344 328\n242 268\n254 280\n1000 990\n80 78\n424 396\n595 608\n755 813\n383 380\n55 56\n598 633\n203 211\n508 476\n600 593\n206 192\n855 882\n517 462\n967 994\n642 657\n493 488",
"output": "22"
},
{
"input": "10\n579 816\n806 590\n830 787\n120 278\n677 800\n16 67\n188 251\n559 560\n87 67\n104 235",
"output": "8"
},
{
"input": "23\n420 424\n280 303\n515 511\n956 948\n799 803\n441 455\n362 369\n299 289\n823 813\n982 967\n876 878\n185 157\n529 551\n964 989\n655 656\n1 21\n114 112\n45 56\n935 937\n1000 997\n934 942\n360 366\n648 621",
"output": "22"
},
{
"input": "23\n102 84\n562 608\n200 127\n952 999\n465 496\n322 367\n728 690\n143 147\n855 867\n861 866\n26 59\n300 273\n255 351\n192 246\n70 111\n365 277\n32 104\n298 319\n330 354\n241 141\n56 125\n315 298\n412 461",
"output": "22"
},
{
"input": "7\n429 506\n346 307\n99 171\n853 916\n322 263\n115 157\n906 924",
"output": "6"
},
{
"input": "3\n1 1\n2 1\n2 2",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "5\n1 1\n1 2\n2 2\n3 1\n3 3",
"output": "0"
},
{
"input": "6\n1 1\n1 2\n2 2\n3 1\n3 2\n3 3",
"output": "0"
},
{
"input": "20\n1 1\n2 2\n3 3\n3 9\n4 4\n5 2\n5 5\n5 7\n5 8\n6 2\n6 6\n6 9\n7 7\n8 8\n9 4\n9 7\n9 9\n10 2\n10 9\n10 10",
"output": "1"
},
{
"input": "21\n1 1\n1 9\n2 1\n2 2\n2 5\n2 6\n2 9\n3 3\n3 8\n4 1\n4 4\n5 5\n5 8\n6 6\n7 7\n8 8\n9 9\n10 4\n10 10\n11 5\n11 11",
"output": "1"
},
{
"input": "22\n1 1\n1 3\n1 4\n1 8\n1 9\n1 11\n2 2\n3 3\n4 4\n4 5\n5 5\n6 6\n6 8\n7 7\n8 3\n8 4\n8 8\n9 9\n10 10\n11 4\n11 9\n11 11",
"output": "3"
},
{
"input": "50\n1 1\n2 2\n2 9\n3 3\n4 4\n4 9\n4 16\n4 24\n5 5\n6 6\n7 7\n8 8\n8 9\n8 20\n9 9\n10 10\n11 11\n12 12\n13 13\n14 7\n14 14\n14 16\n14 25\n15 4\n15 6\n15 15\n15 22\n16 6\n16 16\n17 17\n18 18\n19 6\n19 19\n20 20\n21 21\n22 6\n22 22\n23 23\n24 6\n24 7\n24 8\n24 9\n24 24\n25 1\n25 3\n25 5\n25 7\n25 23\n25 24\n25 25",
"output": "7"
},
{
"input": "55\n1 1\n1 14\n2 2\n2 19\n3 1\n3 3\n3 8\n3 14\n3 23\n4 1\n4 4\n5 5\n5 8\n5 15\n6 2\n6 3\n6 4\n6 6\n7 7\n8 8\n8 21\n9 9\n10 1\n10 10\n11 9\n11 11\n12 12\n13 13\n14 14\n15 15\n15 24\n16 5\n16 16\n17 5\n17 10\n17 17\n17 18\n17 22\n17 27\n18 18\n19 19\n20 20\n21 20\n21 21\n22 22\n23 23\n24 14\n24 24\n25 25\n26 8\n26 11\n26 26\n27 3\n27 27\n28 28",
"output": "5"
},
{
"input": "3\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "6\n4 4\n3 4\n5 4\n4 5\n4 3\n3 1",
"output": "0"
},
{
"input": "4\n1 1\n1 2\n2 1\n2 2",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n1 2",
"output": "0"
},
{
"input": "8\n1 3\n1 1\n4 1\n2 2\n2 5\n5 9\n5 1\n5 4",
"output": "1"
},
{
"input": "10\n1 1\n1 2\n1 3\n1 4\n5 5\n6 6\n7 7\n8 8\n9 9\n100 100",
"output": "6"
},
{
"input": "7\n1 1\n2 2\n3 3\n4 4\n1 2\n2 3\n3 4",
"output": "0"
},
{
"input": "6\n1 1\n2 1\n2 2\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "4\n3 1\n2 1\n2 2\n1 2",
"output": "0"
},
{
"input": "6\n1 1\n2 2\n2 1\n2 4\n4 3\n2 3",
"output": "0"
},
{
"input": "3\n1 2\n1 3\n1 4",
"output": "0"
},
{
"input": "4\n1 1\n2 2\n1 2\n2 1",
"output": "0"
},
{
"input": "4\n1 3\n2 1\n3 2\n3 1",
"output": "1"
},
{
"input": "7\n1 1\n1 2\n2 2\n3 3\n3 4\n4 4\n1 4",
"output": "0"
},
{
"input": "21\n12 12\n13 12\n12 11\n13 13\n10 10\n11 10\n11 11\n501 500\n501 501\n503 502\n500 500\n503 503\n502 501\n502 502\n700 700\n702 702\n703 702\n701 701\n702 701\n703 703\n701 700",
"output": "2"
},
{
"input": "6\n1 11\n6 8\n11 10\n1 10\n11 11\n6 9",
"output": "1"
},
{
"input": "4\n1 1\n2 2\n3 2\n3 1",
"output": "0"
},
{
"input": "3\n1 2\n3 4\n3 2",
"output": "0"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "0"
},
{
"input": "4\n5 5\n5 4\n6 3\n6 4",
"output": "0"
},
{
"input": "3\n1 1\n2 2\n2 1",
"output": "0"
}
] | 1,620,567,922
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 34
| 156
| 11,366,400
|
t = int(input())
graph=[]
while(t):
t-=1
i,j = list(map(int,input().split()))
graph.append([i,j])
visited = []
for i in range(1000):
visited.append([0]*1000)
q = []
ans = -1
for i in range(len(graph)):
if (not visited[graph[i][0]][graph[i][1]]):
q.append([graph[i][0],graph[i][1]])
ans+=1
while (len(q) != 0):
head = q.pop(0)
if ( not visited[head[0]][head[1]]):
visited[head[0]][head[1]] = 1
for j in range(len(graph)):
if (not visited[graph[j][0]][graph[j][1]] and (graph[j][0] == head[0] or graph[j][1] == head[1])):
q.append([graph[j][0],graph[j][1]])
print(ans)
|
Title: Ice Skating
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bajtek is learning to skate on ice. He's a beginner, so his only mode of transportation is pushing off from a snow drift to the north, east, south or west and sliding until he lands in another snow drift. He has noticed that in this way it's impossible to get from some snow drifts to some other by any sequence of moves. He now wants to heap up some additional snow drifts, so that he can get from any snow drift to any other one. He asked you to find the minimal number of snow drifts that need to be created.
We assume that Bajtek can only heap up snow drifts at integer coordinates.
Input Specification:
The first line of input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of snow drifts. Each of the following *n* lines contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=1000) — the coordinates of the *i*-th snow drift.
Note that the north direction coinсides with the direction of *Oy* axis, so the east direction coinсides with the direction of the *Ox* axis. All snow drift's locations are distinct.
Output Specification:
Output the minimal number of snow drifts that need to be created in order for Bajtek to be able to reach any snow drift from any other one.
Demo Input:
['2\n2 1\n1 2\n', '2\n2 1\n4 1\n']
Demo Output:
['1\n', '0\n']
Note:
none
|
```python
t = int(input())
graph=[]
while(t):
t-=1
i,j = list(map(int,input().split()))
graph.append([i,j])
visited = []
for i in range(1000):
visited.append([0]*1000)
q = []
ans = -1
for i in range(len(graph)):
if (not visited[graph[i][0]][graph[i][1]]):
q.append([graph[i][0],graph[i][1]])
ans+=1
while (len(q) != 0):
head = q.pop(0)
if ( not visited[head[0]][head[1]]):
visited[head[0]][head[1]] = 1
for j in range(len(graph)):
if (not visited[graph[j][0]][graph[j][1]] and (graph[j][0] == head[0] or graph[j][1] == head[1])):
q.append([graph[j][0],graph[j][1]])
print(ans)
```
| -1
|
|
66
|
B
|
Petya and Countryside
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] |
B. Petya and Countryside
|
2
|
256
|
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
|
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
|
[
"1\n2\n",
"5\n1 2 1 2 1\n",
"8\n1 2 1 1 1 3 3 4\n"
] |
[
"1\n",
"3\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 2 1 2 1",
"output": "3"
},
{
"input": "8\n1 2 1 1 1 3 3 4",
"output": "6"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "10"
},
{
"input": "2\n100 100",
"output": "2"
},
{
"input": "3\n100 100 100",
"output": "3"
},
{
"input": "11\n1 2 3 4 5 6 5 4 3 2 1",
"output": "11"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 100 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 1 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 1 82 83 84 85 86 87 88 89 90 91 92 93 94 100 5 4 3 2 1",
"output": "81"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 1 86 87 88 89 90 91 92 93 100 6 5 4 3 2 1",
"output": "85"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 1 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 100 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 100 8 7 6 1 4 3 2 1",
"output": "96"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 100 10 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 1 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 100 11 10 9 8 7 6 5 4 3 2 1",
"output": "55"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 1 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 100 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "59"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 100 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "86"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 100 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "83"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 100 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 1 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "74"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 100 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 100 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 1 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "52"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 100 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 1 2 1",
"output": "98"
},
{
"input": "10\n1 4 4 4 4 4 1 2 4 3",
"output": "7"
}
] | 1,628,868,384
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 80
| 218
| 21,708,800
|
n = int(input())
arr = list(map(int, input().split()))
mx = -1
for i in range(n):
j = i-1
last=arr[i]
p=0
while j>=0 and arr[j]<=last:
last=arr[j]
j-=1
p+=1
j=i+1
last=arr[i]
while j<n and arr[j]<=last:
last = arr[j]
j+=1
p += 1
p += 1
mx = max(p, mx)
print(mx)
|
Title: Petya and Countryside
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
Output Specification:
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
Demo Input:
['1\n2\n', '5\n1 2 1 2 1\n', '8\n1 2 1 1 1 3 3 4\n']
Demo Output:
['1\n', '3\n', '6\n']
Note:
none
|
```python
n = int(input())
arr = list(map(int, input().split()))
mx = -1
for i in range(n):
j = i-1
last=arr[i]
p=0
while j>=0 and arr[j]<=last:
last=arr[j]
j-=1
p+=1
j=i+1
last=arr[i]
while j<n and arr[j]<=last:
last = arr[j]
j+=1
p += 1
p += 1
mx = max(p, mx)
print(mx)
```
| 3.905064
|
729
|
B
|
Spotlights
|
PROGRAMMING
| 1,200
|
[
"dp",
"implementation"
] | null | null |
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
|
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
|
Print one integer — the number of good positions for placing the spotlight.
|
[
"2 4\n0 1 0 0\n1 0 1 0\n",
"4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n"
] |
[
"9\n",
"20\n"
] |
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
| 1,000
|
[
{
"input": "2 4\n0 1 0 0\n1 0 1 0",
"output": "9"
},
{
"input": "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0",
"output": "20"
},
{
"input": "1 5\n1 1 0 0 0",
"output": "3"
},
{
"input": "2 10\n0 0 0 0 0 0 0 1 0 0\n1 0 0 0 0 0 0 0 0 0",
"output": "20"
},
{
"input": "3 1\n1\n0\n0",
"output": "2"
},
{
"input": "5 7\n0 0 0 0 0 0 1\n0 0 0 0 0 0 1\n0 0 0 1 0 0 0\n0 0 0 0 0 0 0\n0 0 0 0 0 0 0",
"output": "25"
},
{
"input": "10 20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "5 7\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1\n0 1 1 1 1 1 1\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1",
"output": "26"
},
{
"input": "10 20\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "121"
},
{
"input": "1 2\n0 1",
"output": "1"
},
{
"input": "1 2\n1 0",
"output": "1"
},
{
"input": "1 2\n1 1",
"output": "0"
},
{
"input": "2 1\n1\n0",
"output": "1"
},
{
"input": "2 1\n0\n1",
"output": "1"
},
{
"input": "2 1\n1\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "4 4\n1 1 1 1\n1 0 0 1\n1 0 0 1\n1 1 1 1",
"output": "16"
}
] | 1,699,521,917
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 6
| 1,000
| 49,766,400
|
import sys
import threading
from random import randint
import os
from io import BytesIO, IOBase
from collections import defaultdict, Counter, deque
from math import inf, sqrt, floor
from functools import lru_cache
from heapq import heappop, heappush, heapify
import math
from bisect import bisect_left, bisect_right
nextInts = lambda: list(map(int, input().split()))
nextInt = lambda: int(input())
Mod = 10**9 + 7
def solution():
n,m = nextInts()
board = []
for i in range(n):
row = list(map(int, input().split()))
board.append(row)
dpl = [[0 for _ in range(m)] for _ in range(n)]
dpr = [[0 for _ in range(m)] for _ in range(n)]
dpu = [[0 for _ in range(m)] for _ in range(n)]
dpd = [[0 for _ in range(m)] for _ in range(n)]
for i in range(n):
cur = 0
for j in range(m):
dpl[i][j] += cur
cur += board[i][j]
cur = 0
for j in range(m)[::-1]:
dpr[i][j] += cur
cur += board[i][j]
for j in range(m):
cur = 0
for i in range(n):
dpu[i][j] += cur
cur += board[i][j]
cur = 0
for i in range(n)[::-1]:
dpd[i][j] += cur
cur += board[i][j]
res = 0
for i in range(n):
for j in range(m):
if board[i][j] == 0:
cur = (dpl[i][j] > 0) + (dpr[i][j] > 0) + (dpu[i][j] > 0) + (dpd[i][j] > 0)
res += cur
print(res)
def main():
t = 1
#t = int(input())
for _ in range(t):
solution()
#
#------------------#
# recursion Region #
#------------------#
main()
#sys.setrecursionlimit(10**6)
#threading.stack_size(1 << 27)
#thread = threading.Thread(target=main)
#thread.start(); thread.join()
|
Title: Spotlights
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
Input Specification:
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
Output Specification:
Print one integer — the number of good positions for placing the spotlight.
Demo Input:
['2 4\n0 1 0 0\n1 0 1 0\n', '4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n']
Demo Output:
['9\n', '20\n']
Note:
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
|
```python
import sys
import threading
from random import randint
import os
from io import BytesIO, IOBase
from collections import defaultdict, Counter, deque
from math import inf, sqrt, floor
from functools import lru_cache
from heapq import heappop, heappush, heapify
import math
from bisect import bisect_left, bisect_right
nextInts = lambda: list(map(int, input().split()))
nextInt = lambda: int(input())
Mod = 10**9 + 7
def solution():
n,m = nextInts()
board = []
for i in range(n):
row = list(map(int, input().split()))
board.append(row)
dpl = [[0 for _ in range(m)] for _ in range(n)]
dpr = [[0 for _ in range(m)] for _ in range(n)]
dpu = [[0 for _ in range(m)] for _ in range(n)]
dpd = [[0 for _ in range(m)] for _ in range(n)]
for i in range(n):
cur = 0
for j in range(m):
dpl[i][j] += cur
cur += board[i][j]
cur = 0
for j in range(m)[::-1]:
dpr[i][j] += cur
cur += board[i][j]
for j in range(m):
cur = 0
for i in range(n):
dpu[i][j] += cur
cur += board[i][j]
cur = 0
for i in range(n)[::-1]:
dpd[i][j] += cur
cur += board[i][j]
res = 0
for i in range(n):
for j in range(m):
if board[i][j] == 0:
cur = (dpl[i][j] > 0) + (dpr[i][j] > 0) + (dpu[i][j] > 0) + (dpd[i][j] > 0)
res += cur
print(res)
def main():
t = 1
#t = int(input())
for _ in range(t):
solution()
#
#------------------#
# recursion Region #
#------------------#
main()
#sys.setrecursionlimit(10**6)
#threading.stack_size(1 << 27)
#thread = threading.Thread(target=main)
#thread.start(); thread.join()
```
| 0
|
|
552
|
B
|
Vanya and Books
|
PROGRAMMING
| 1,200
|
[
"implementation",
"math"
] | null | null |
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
|
Print the number of digits needed to number all the books.
|
[
"13\n",
"4\n"
] |
[
"17\n",
"4\n"
] |
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits.
| 1,000
|
[
{
"input": "13",
"output": "17"
},
{
"input": "4",
"output": "4"
},
{
"input": "100",
"output": "192"
},
{
"input": "99",
"output": "189"
},
{
"input": "1000000000",
"output": "8888888899"
},
{
"input": "1000000",
"output": "5888896"
},
{
"input": "999",
"output": "2889"
},
{
"input": "55",
"output": "101"
},
{
"input": "222222222",
"output": "1888888896"
},
{
"input": "8",
"output": "8"
},
{
"input": "13",
"output": "17"
},
{
"input": "313",
"output": "831"
},
{
"input": "1342",
"output": "4261"
},
{
"input": "30140",
"output": "139594"
},
{
"input": "290092",
"output": "1629447"
},
{
"input": "2156660",
"output": "13985516"
},
{
"input": "96482216",
"output": "760746625"
},
{
"input": "943006819",
"output": "8375950269"
},
{
"input": "1",
"output": "1"
},
{
"input": "7",
"output": "7"
},
{
"input": "35",
"output": "61"
},
{
"input": "996",
"output": "2880"
},
{
"input": "6120",
"output": "23373"
},
{
"input": "30660",
"output": "142194"
},
{
"input": "349463",
"output": "1985673"
},
{
"input": "8171970",
"output": "56092686"
},
{
"input": "36123011",
"output": "277872985"
},
{
"input": "986747865",
"output": "8769619683"
},
{
"input": "9",
"output": "9"
},
{
"input": "10",
"output": "11"
},
{
"input": "11",
"output": "13"
},
{
"input": "101",
"output": "195"
},
{
"input": "1000",
"output": "2893"
},
{
"input": "1001",
"output": "2897"
},
{
"input": "9999",
"output": "38889"
},
{
"input": "10000",
"output": "38894"
},
{
"input": "10001",
"output": "38899"
},
{
"input": "99999",
"output": "488889"
},
{
"input": "100000",
"output": "488895"
},
{
"input": "100001",
"output": "488901"
},
{
"input": "999999",
"output": "5888889"
},
{
"input": "1000001",
"output": "5888903"
},
{
"input": "9999999",
"output": "68888889"
},
{
"input": "10000000",
"output": "68888897"
},
{
"input": "10000001",
"output": "68888905"
},
{
"input": "99999999",
"output": "788888889"
},
{
"input": "100000000",
"output": "788888898"
},
{
"input": "100000001",
"output": "788888907"
},
{
"input": "999999999",
"output": "8888888889"
},
{
"input": "95",
"output": "181"
},
{
"input": "995",
"output": "2877"
},
{
"input": "9995",
"output": "38873"
},
{
"input": "99995",
"output": "488869"
},
{
"input": "999999995",
"output": "8888888853"
},
{
"input": "999999998",
"output": "8888888880"
}
] | 1,531,681,072
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 186
| 1,024,000
|
n = int(input())
for i in range(1, 13):
ans += max(0, min(n, 10 ** i - 1) - 10 ** (i - 1) + 1) * i
print(ans)
|
Title: Vanya and Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got an important task — he should enumerate books in the library and label each book with its number. Each of the *n* books should be assigned with a number from 1 to *n*. Naturally, distinct books should be assigned distinct numbers.
Vanya wants to know how many digits he will have to write down as he labels the books.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=109) — the number of books in the library.
Output Specification:
Print the number of digits needed to number all the books.
Demo Input:
['13\n', '4\n']
Demo Output:
['17\n', '4\n']
Note:
Note to the first test. The books get numbers 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, which totals to 17 digits.
Note to the second sample. The books get numbers 1, 2, 3, 4, which totals to 4 digits.
|
```python
n = int(input())
for i in range(1, 13):
ans += max(0, min(n, 10 ** i - 1) - 10 ** (i - 1) + 1) * i
print(ans)
```
| -1
|
|
435
|
A
|
Queue on Bus Stop
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
It's that time of the year when the Russians flood their countryside summer cottages (dachas) and the bus stop has a lot of people. People rarely go to the dacha on their own, it's usually a group, so the people stand in queue by groups.
The bus stop queue has *n* groups of people. The *i*-th group from the beginning has *a**i* people. Every 30 minutes an empty bus arrives at the bus stop, it can carry at most *m* people. Naturally, the people from the first group enter the bus first. Then go the people from the second group and so on. Note that the order of groups in the queue never changes. Moreover, if some group cannot fit all of its members into the current bus, it waits for the next bus together with other groups standing after it in the queue.
Your task is to determine how many buses is needed to transport all *n* groups to the dacha countryside.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The next line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*m*).
|
Print a single integer — the number of buses that is needed to transport all *n* groups to the dacha countryside.
|
[
"4 3\n2 3 2 1\n",
"3 4\n1 2 1\n"
] |
[
"3\n",
"1\n"
] |
none
| 500
|
[
{
"input": "4 3\n2 3 2 1",
"output": "3"
},
{
"input": "3 4\n1 2 1",
"output": "1"
},
{
"input": "1 5\n4",
"output": "1"
},
{
"input": "5 1\n1 1 1 1 1",
"output": "5"
},
{
"input": "6 4\n1 3 2 3 4 1",
"output": "5"
},
{
"input": "6 8\n6 1 1 1 4 5",
"output": "3"
},
{
"input": "10 10\n1 10 1 10 1 1 7 8 6 7",
"output": "8"
},
{
"input": "100 100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52",
"output": "63"
},
{
"input": "10 1\n1 1 1 1 1 1 1 1 1 1",
"output": "10"
},
{
"input": "10 2\n2 2 1 1 1 1 1 2 1 2",
"output": "8"
},
{
"input": "10 3\n1 3 1 1 3 2 2 2 3 3",
"output": "9"
},
{
"input": "10 4\n2 1 1 1 3 4 4 4 1 2",
"output": "6"
},
{
"input": "10 5\n2 2 3 4 4 1 5 3 1 2",
"output": "7"
},
{
"input": "100 3\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2",
"output": "83"
},
{
"input": "100 7\n4 7 4 7 7 4 7 3 5 6 3 5 4 3 7 2 7 2 4 1 6 3 3 7 4 4 5 4 3 6 4 3 2 2 1 4 4 1 7 3 7 7 1 3 1 5 4 1 5 3 5 2 2 1 5 5 1 5 2 7 5 5 1 5 5 4 6 5 1 3 5 6 7 4 1 3 3 4 3 2 7 6 5 7 2 7 1 1 2 2 3 1 3 7 1 3 2 1 1 7",
"output": "71"
},
{
"input": "100 10\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2",
"output": "64"
},
{
"input": "100 15\n3 12 8 3 11 14 12 14 1 11 13 3 5 13 4 14 2 11 7 8 12 9 15 7 15 1 4 11 6 12 1 3 8 13 1 8 14 4 3 14 1 3 1 6 10 15 13 11 12 1 14 13 11 14 11 3 12 7 3 15 14 4 5 6 5 14 7 14 6 2 6 12 6 13 13 1 9 13 15 11 6 3 15 11 9 4 15 8 15 12 1 15 10 10 4 1 15 1 4 1",
"output": "71"
},
{
"input": "100 30\n7 14 22 16 11 13 7 29 20 19 22 6 12 16 1 8 27 21 22 3 15 27 20 12 4 19 1 26 26 22 25 17 29 25 16 29 29 28 16 26 25 14 16 20 5 21 5 15 19 13 17 21 17 19 23 13 1 25 6 30 16 19 12 10 28 8 15 13 14 24 19 30 12 19 22 1 3 14 16 3 20 26 15 19 9 10 19 27 2 16 10 22 15 13 19 3 24 9 8 13",
"output": "71"
},
{
"input": "100 40\n39 19 13 36 11 21 32 12 1 2 39 26 32 39 24 1 4 19 10 4 16 39 32 34 13 24 30 35 3 10 8 18 13 12 39 27 31 40 37 20 17 17 37 5 10 12 22 17 7 1 31 13 11 10 2 6 22 16 2 4 9 27 6 35 22 16 22 30 33 2 26 20 35 19 40 37 19 17 21 28 37 28 40 4 5 4 35 19 26 36 19 12 21 20 21 30 9 16 9 32",
"output": "65"
},
{
"input": "100 50\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1",
"output": "60"
},
{
"input": "100 60\n34 21 39 17 48 46 23 56 46 52 50 39 55 48 54 38 32 38 24 26 44 12 28 9 25 26 10 52 42 60 41 3 16 60 44 29 27 55 19 19 19 57 45 59 29 35 5 14 50 47 57 48 16 7 12 36 58 31 37 58 30 50 19 11 10 41 59 57 49 41 33 9 12 11 53 50 60 51 21 9 44 23 1 16 4 15 17 57 15 17 46 50 18 52 43 24 47 50 19 18",
"output": "74"
},
{
"input": "100 90\n74 65 49 41 3 79 61 83 50 40 13 57 90 14 62 77 36 10 3 5 5 40 50 75 32 26 3 71 79 54 88 50 46 20 42 59 30 36 83 86 60 62 82 68 62 80 18 65 28 28 81 74 62 33 61 35 33 83 90 72 6 6 51 4 22 20 29 10 8 3 84 69 12 17 24 16 12 64 80 74 68 59 1 59 15 59 37 58 79 83 51 56 81 14 37 45 19 31 61 90",
"output": "67"
},
{
"input": "100 99\n69 46 76 47 71 9 66 46 78 17 96 83 56 96 29 3 43 48 79 23 93 61 19 9 29 72 15 84 93 46 71 87 11 43 96 44 54 75 3 66 2 95 46 32 69 52 79 38 57 53 37 60 71 82 28 31 84 58 89 40 62 74 22 50 45 38 99 67 24 28 28 12 69 88 33 10 31 71 46 7 42 81 54 81 96 44 8 1 20 24 28 19 54 35 69 32 71 13 66 15",
"output": "68"
},
{
"input": "90 100\n25 52 88 89 36 17 57 64 66 11 89 61 54 92 48 51 18 42 44 92 6 14 67 100 16 21 17 88 85 73 33 11 94 84 56 72 4 80 90 78 96 5 62 70 54 70 94 80 10 91 100 89 98 87 69 74 88 63 53 79 38 94 89 52 21 82 67 79 100 81 2 40 30 69 34 15 12 33 87 52 95 18 51 30 15 39 30 99 46 84",
"output": "67"
},
{
"input": "5 100\n14 67 15 28 21",
"output": "2"
},
{
"input": "10 100\n2 17 53 94 95 57 36 47 68 48",
"output": "7"
},
{
"input": "1 100\n18",
"output": "1"
},
{
"input": "100 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "30 100\n56 7 99 83 2 65 35 53 99 36 42 57 13 37 68 52 87 11 50 23 86 24 32 39 97 6 64 1 18 86",
"output": "18"
},
{
"input": "60 100\n18 75 43 88 45 43 20 59 59 79 62 39 53 21 28 46 54 53 97 81 18 15 2 95 84 9 36 70 30 76 17 19 83 40 45 32 31 70 23 14 44 35 79 84 97 96 99 60 3 73 64 83 6 12 67 86 70 89 18 61",
"output": "40"
},
{
"input": "1 73\n24",
"output": "1"
},
{
"input": "4 4\n1 4 4 4",
"output": "4"
},
{
"input": "2 6\n1 4",
"output": "1"
},
{
"input": "2 5\n5 5",
"output": "2"
}
] | 1,658,138,298
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 46
| 0
|
(n, m) = map(int, input().split(' '))
a = list(map(int, input().split(' ')))
if sum(a) % m == 0:
print(sum(a) // m)
else:
print(sum(a) // m + 1)
|
Title: Queue on Bus Stop
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It's that time of the year when the Russians flood their countryside summer cottages (dachas) and the bus stop has a lot of people. People rarely go to the dacha on their own, it's usually a group, so the people stand in queue by groups.
The bus stop queue has *n* groups of people. The *i*-th group from the beginning has *a**i* people. Every 30 minutes an empty bus arrives at the bus stop, it can carry at most *m* people. Naturally, the people from the first group enter the bus first. Then go the people from the second group and so on. Note that the order of groups in the queue never changes. Moreover, if some group cannot fit all of its members into the current bus, it waits for the next bus together with other groups standing after it in the queue.
Your task is to determine how many buses is needed to transport all *n* groups to the dacha countryside.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100). The next line contains *n* integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*m*).
Output Specification:
Print a single integer — the number of buses that is needed to transport all *n* groups to the dacha countryside.
Demo Input:
['4 3\n2 3 2 1\n', '3 4\n1 2 1\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
(n, m) = map(int, input().split(' '))
a = list(map(int, input().split(' ')))
if sum(a) % m == 0:
print(sum(a) // m)
else:
print(sum(a) // m + 1)
```
| 0
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.