contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
675
|
A
|
Infinite Sequence
|
PROGRAMMING
| 1,100
|
[
"math"
] | null | null |
Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help.
|
The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively.
|
If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes).
|
[
"1 7 3\n",
"10 10 0\n",
"1 -4 5\n",
"0 60 50\n"
] |
[
"YES\n",
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element.
In the second sample, the favorite integer of Vasya is equal to the first element of the sequence.
In the third sample all elements of the sequence are greater than Vasya's favorite integer.
In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer.
| 500
|
[
{
"input": "1 7 3",
"output": "YES"
},
{
"input": "10 10 0",
"output": "YES"
},
{
"input": "1 -4 5",
"output": "NO"
},
{
"input": "0 60 50",
"output": "NO"
},
{
"input": "1 -4 -5",
"output": "YES"
},
{
"input": "0 1 0",
"output": "NO"
},
{
"input": "10 10 42",
"output": "YES"
},
{
"input": "-1000000000 1000000000 -1",
"output": "NO"
},
{
"input": "10 16 4",
"output": "NO"
},
{
"input": "-1000000000 1000000000 5",
"output": "YES"
},
{
"input": "1000000000 -1000000000 5",
"output": "NO"
},
{
"input": "1000000000 -1000000000 0",
"output": "NO"
},
{
"input": "1000000000 1000000000 0",
"output": "YES"
},
{
"input": "115078364 -899474523 -1",
"output": "YES"
},
{
"input": "-245436499 416383245 992",
"output": "YES"
},
{
"input": "-719636354 536952440 2",
"output": "YES"
},
{
"input": "-198350539 963391024 68337739",
"output": "YES"
},
{
"input": "-652811055 875986516 1091",
"output": "YES"
},
{
"input": "119057893 -516914539 -39748277",
"output": "YES"
},
{
"input": "989140430 731276607 -36837689",
"output": "YES"
},
{
"input": "677168390 494583489 -985071853",
"output": "NO"
},
{
"input": "58090193 777423708 395693923",
"output": "NO"
},
{
"input": "479823846 -403424770 -653472589",
"output": "NO"
},
{
"input": "-52536829 -132023273 -736287999",
"output": "NO"
},
{
"input": "-198893776 740026818 -547885271",
"output": "NO"
},
{
"input": "-2 -2 -2",
"output": "YES"
},
{
"input": "-2 -2 -1",
"output": "YES"
},
{
"input": "-2 -2 0",
"output": "YES"
},
{
"input": "-2 -2 1",
"output": "YES"
},
{
"input": "-2 -2 2",
"output": "YES"
},
{
"input": "-2 -1 -2",
"output": "NO"
},
{
"input": "-2 -1 -1",
"output": "NO"
},
{
"input": "-2 -1 0",
"output": "NO"
},
{
"input": "-2 -1 1",
"output": "YES"
},
{
"input": "-2 -1 2",
"output": "NO"
},
{
"input": "-2 0 -2",
"output": "NO"
},
{
"input": "-2 0 -1",
"output": "NO"
},
{
"input": "-2 0 0",
"output": "NO"
},
{
"input": "-2 0 1",
"output": "YES"
},
{
"input": "-2 0 2",
"output": "YES"
},
{
"input": "-2 1 -2",
"output": "NO"
},
{
"input": "-2 1 -1",
"output": "NO"
},
{
"input": "-2 1 0",
"output": "NO"
},
{
"input": "-2 1 1",
"output": "YES"
},
{
"input": "-2 1 2",
"output": "NO"
},
{
"input": "-2 2 -2",
"output": "NO"
},
{
"input": "-2 2 -1",
"output": "NO"
},
{
"input": "-2 2 0",
"output": "NO"
},
{
"input": "-2 2 1",
"output": "YES"
},
{
"input": "-2 2 2",
"output": "YES"
},
{
"input": "-1 -2 -2",
"output": "NO"
},
{
"input": "-1 -2 -1",
"output": "YES"
},
{
"input": "-1 -2 0",
"output": "NO"
},
{
"input": "-1 -2 1",
"output": "NO"
},
{
"input": "-1 -2 2",
"output": "NO"
},
{
"input": "-1 -1 -2",
"output": "YES"
},
{
"input": "-1 -1 -1",
"output": "YES"
},
{
"input": "-1 -1 0",
"output": "YES"
},
{
"input": "-1 -1 1",
"output": "YES"
},
{
"input": "-1 -1 2",
"output": "YES"
},
{
"input": "-1 0 -2",
"output": "NO"
},
{
"input": "-1 0 -1",
"output": "NO"
},
{
"input": "-1 0 0",
"output": "NO"
},
{
"input": "-1 0 1",
"output": "YES"
},
{
"input": "-1 0 2",
"output": "NO"
},
{
"input": "-1 1 -2",
"output": "NO"
},
{
"input": "-1 1 -1",
"output": "NO"
},
{
"input": "-1 1 0",
"output": "NO"
},
{
"input": "-1 1 1",
"output": "YES"
},
{
"input": "-1 1 2",
"output": "YES"
},
{
"input": "-1 2 -2",
"output": "NO"
},
{
"input": "-1 2 -1",
"output": "NO"
},
{
"input": "-1 2 0",
"output": "NO"
},
{
"input": "-1 2 1",
"output": "YES"
},
{
"input": "-1 2 2",
"output": "NO"
},
{
"input": "0 -2 -2",
"output": "YES"
},
{
"input": "0 -2 -1",
"output": "YES"
},
{
"input": "0 -2 0",
"output": "NO"
},
{
"input": "0 -2 1",
"output": "NO"
},
{
"input": "0 -2 2",
"output": "NO"
},
{
"input": "0 -1 -2",
"output": "NO"
},
{
"input": "0 -1 -1",
"output": "YES"
},
{
"input": "0 -1 0",
"output": "NO"
},
{
"input": "0 -1 1",
"output": "NO"
},
{
"input": "0 -1 2",
"output": "NO"
},
{
"input": "0 0 -2",
"output": "YES"
},
{
"input": "0 0 -1",
"output": "YES"
},
{
"input": "0 0 0",
"output": "YES"
},
{
"input": "0 0 1",
"output": "YES"
},
{
"input": "0 0 2",
"output": "YES"
},
{
"input": "0 1 -2",
"output": "NO"
},
{
"input": "0 1 -1",
"output": "NO"
},
{
"input": "0 1 0",
"output": "NO"
},
{
"input": "0 1 1",
"output": "YES"
},
{
"input": "0 1 2",
"output": "NO"
},
{
"input": "0 2 -2",
"output": "NO"
},
{
"input": "0 2 -1",
"output": "NO"
},
{
"input": "0 2 0",
"output": "NO"
},
{
"input": "0 2 1",
"output": "YES"
},
{
"input": "0 2 2",
"output": "YES"
},
{
"input": "1 -2 -2",
"output": "NO"
},
{
"input": "1 -2 -1",
"output": "YES"
},
{
"input": "1 -2 0",
"output": "NO"
},
{
"input": "1 -2 1",
"output": "NO"
},
{
"input": "1 -2 2",
"output": "NO"
},
{
"input": "1 -1 -2",
"output": "YES"
},
{
"input": "1 -1 -1",
"output": "YES"
},
{
"input": "1 -1 0",
"output": "NO"
},
{
"input": "1 -1 1",
"output": "NO"
},
{
"input": "1 -1 2",
"output": "NO"
},
{
"input": "1 0 -2",
"output": "NO"
},
{
"input": "1 0 -1",
"output": "YES"
},
{
"input": "1 0 0",
"output": "NO"
},
{
"input": "1 0 1",
"output": "NO"
},
{
"input": "1 0 2",
"output": "NO"
},
{
"input": "1 1 -2",
"output": "YES"
},
{
"input": "1 1 -1",
"output": "YES"
},
{
"input": "1 1 0",
"output": "YES"
},
{
"input": "1 1 1",
"output": "YES"
},
{
"input": "1 1 2",
"output": "YES"
},
{
"input": "1 2 -2",
"output": "NO"
},
{
"input": "1 2 -1",
"output": "NO"
},
{
"input": "1 2 0",
"output": "NO"
},
{
"input": "1 2 1",
"output": "YES"
},
{
"input": "1 2 2",
"output": "NO"
},
{
"input": "2 -2 -2",
"output": "YES"
},
{
"input": "2 -2 -1",
"output": "YES"
},
{
"input": "2 -2 0",
"output": "NO"
},
{
"input": "2 -2 1",
"output": "NO"
},
{
"input": "2 -2 2",
"output": "NO"
},
{
"input": "2 -1 -2",
"output": "NO"
},
{
"input": "2 -1 -1",
"output": "YES"
},
{
"input": "2 -1 0",
"output": "NO"
},
{
"input": "2 -1 1",
"output": "NO"
},
{
"input": "2 -1 2",
"output": "NO"
},
{
"input": "2 0 -2",
"output": "YES"
},
{
"input": "2 0 -1",
"output": "YES"
},
{
"input": "2 0 0",
"output": "NO"
},
{
"input": "2 0 1",
"output": "NO"
},
{
"input": "2 0 2",
"output": "NO"
},
{
"input": "2 1 -2",
"output": "NO"
},
{
"input": "2 1 -1",
"output": "YES"
},
{
"input": "2 1 0",
"output": "NO"
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "2 1 2",
"output": "NO"
},
{
"input": "2 2 -2",
"output": "YES"
},
{
"input": "2 2 -1",
"output": "YES"
},
{
"input": "2 2 0",
"output": "YES"
},
{
"input": "2 2 1",
"output": "YES"
},
{
"input": "2 2 2",
"output": "YES"
},
{
"input": "-1000000000 1000000000 1",
"output": "YES"
},
{
"input": "-1000000000 1000000000 2",
"output": "YES"
},
{
"input": "1000000000 -1000000000 -1",
"output": "YES"
},
{
"input": "5 2 3",
"output": "NO"
},
{
"input": "2 1 -1",
"output": "YES"
},
{
"input": "3 2 1",
"output": "NO"
},
{
"input": "0 -5 -3",
"output": "NO"
},
{
"input": "2 5 5",
"output": "NO"
},
{
"input": "0 10 1",
"output": "YES"
},
{
"input": "15 5 -5",
"output": "YES"
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "20 10 0",
"output": "NO"
},
{
"input": "20 15 5",
"output": "NO"
},
{
"input": "1 6 1",
"output": "YES"
},
{
"input": "1000000000 0 -1000000000",
"output": "YES"
},
{
"input": "1 1 -5",
"output": "YES"
},
{
"input": "4 6 1",
"output": "YES"
},
{
"input": "-5 -10 -5",
"output": "YES"
},
{
"input": "2 0 0",
"output": "NO"
},
{
"input": "10 9 -1",
"output": "YES"
},
{
"input": "-2 -1 -1",
"output": "NO"
},
{
"input": "1 13 3",
"output": "YES"
},
{
"input": "2 3 0",
"output": "NO"
},
{
"input": "1 1 -1",
"output": "YES"
},
{
"input": "5 -10 -5",
"output": "YES"
},
{
"input": "5 3 1",
"output": "NO"
},
{
"input": "1 1000000000 1",
"output": "YES"
},
{
"input": "-1000000000 1000000000 1000000000",
"output": "YES"
}
] | 1,576,175,254
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 108
| 0
|
a,b,d = map(int,input().split())
if d>0:
if (b-a)/d == abs(int((b-a)/d)):
print('YES')
else:
print('NO')
else:
if b == a:
print("YES")
else:
print('NO')
|
Title: Infinite Sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help.
Input Specification:
The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively.
Output Specification:
If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes).
Demo Input:
['1 7 3\n', '10 10 0\n', '1 -4 5\n', '0 60 50\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n', 'NO\n']
Note:
In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element.
In the second sample, the favorite integer of Vasya is equal to the first element of the sequence.
In the third sample all elements of the sequence are greater than Vasya's favorite integer.
In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer.
|
```python
a,b,d = map(int,input().split())
if d>0:
if (b-a)/d == abs(int((b-a)/d)):
print('YES')
else:
print('NO')
else:
if b == a:
print("YES")
else:
print('NO')
```
| 0
|
|
361
|
B
|
Levko and Permutation
|
PROGRAMMING
| 1,200
|
[
"constructive algorithms",
"math",
"number theory"
] | null | null |
Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them.
|
The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*).
|
In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them.
|
[
"4 2\n",
"1 1\n"
] |
[
"2 4 3 1",
"-1\n"
] |
In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations.
| 1,000
|
[
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "7 4",
"output": "3 1 2 4 5 6 7 "
},
{
"input": "10 9",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10000 5000",
"output": "5000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "7 0",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1 0",
"output": "1 "
},
{
"input": "7 7",
"output": "-1"
},
{
"input": "100000 47",
"output": "99953 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 100000",
"output": "-1"
},
{
"input": "100000 43425",
"output": "56575 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "7 6",
"output": "1 2 3 4 5 6 7 "
},
{
"input": "100000 99999",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "47 46",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 "
},
{
"input": "5 0",
"output": "5 1 2 3 4 "
},
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1533 1052",
"output": "481 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "81314 52747",
"output": "28567 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "17767 145",
"output": "17622 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "18168 7942",
"output": "10226 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 15915",
"output": "10678 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 8877",
"output": "17716 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "13852 12727",
"output": "1125 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "8834 8834",
"output": "-1"
},
{
"input": "8485 8484",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "14564 14564",
"output": "-1"
},
{
"input": "8254 8253",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "81314 81312",
"output": "2 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "5795 5792",
"output": "3 1 2 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "6417 3",
"output": "6414 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6896 0",
"output": "6896 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6778 1",
"output": "6777 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "9448 1",
"output": "9447 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "5938 2",
"output": "5936 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "3072 0",
"output": "3072 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "8576 0",
"output": "8576 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "2 1",
"output": "1 2 "
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "5 5",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "100000 1",
"output": "99999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 50000",
"output": "50000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "100000 9999",
"output": "90001 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 99000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "100000 12347",
"output": "87653 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
}
] | 1,556,014,109
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
n,k=input().split()
n=int(n)
k=int(k)
if(n<=k):
print(-1)
else:
for i in range(1,k+2):
print(i,end=" ")
for i in range(k+2,n+1):
print(1,end=" ")
|
Title: Levko and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them.
Input Specification:
The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*).
Output Specification:
In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them.
Demo Input:
['4 2\n', '1 1\n']
Demo Output:
['2 4 3 1', '-1\n']
Note:
In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations.
|
```python
n,k=input().split()
n=int(n)
k=int(k)
if(n<=k):
print(-1)
else:
for i in range(1,k+2):
print(i,end=" ")
for i in range(k+2,n+1):
print(1,end=" ")
```
| 0
|
|
233
|
A
|
Perfect Permutation
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
|
A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.
|
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.
|
[
"1\n",
"2\n",
"4\n"
] |
[
"-1\n",
"2 1 \n",
"2 1 4 3 \n"
] |
none
| 500
|
[
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "4",
"output": "2 1 4 3 "
},
{
"input": "3",
"output": "-1"
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "2 1 4 3 6 5 "
},
{
"input": "7",
"output": "-1"
},
{
"input": "20",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 "
},
{
"input": "8",
"output": "2 1 4 3 6 5 8 7 "
},
{
"input": "9",
"output": "-1"
},
{
"input": "10",
"output": "2 1 4 3 6 5 8 7 10 9 "
},
{
"input": "11",
"output": "-1"
},
{
"input": "21",
"output": "-1"
},
{
"input": "50",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 "
},
{
"input": "51",
"output": "-1"
},
{
"input": "52",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 "
},
{
"input": "84",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 "
},
{
"input": "86",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 "
},
{
"input": "100",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 "
},
{
"input": "98",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 "
},
{
"input": "96",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 "
},
{
"input": "33",
"output": "-1"
},
{
"input": "34",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 "
},
{
"input": "36",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 "
},
{
"input": "38",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 "
},
{
"input": "40",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 "
},
{
"input": "42",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 "
},
{
"input": "44",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 "
},
{
"input": "46",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 "
},
{
"input": "48",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 "
}
] | 1,643,135,537
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 62
| 0
|
n = int(input())
if(n%2 == 1):
print('-1')
else:
s = list(range(1,n+1))
for i in range(0,n-1,2):
s[i], s[i+1] = s[i+1],s[i]
print(*s)
|
Title: Perfect Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
Input Specification:
A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.
Output Specification:
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.
Demo Input:
['1\n', '2\n', '4\n']
Demo Output:
['-1\n', '2 1 \n', '2 1 4 3 \n']
Note:
none
|
```python
n = int(input())
if(n%2 == 1):
print('-1')
else:
s = list(range(1,n+1))
for i in range(0,n-1,2):
s[i], s[i+1] = s[i+1],s[i]
print(*s)
```
| 3
|
|
583
|
B
|
Robot's Task
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation"
] | null | null |
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
|
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
|
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
|
[
"3\n0 2 0\n",
"5\n4 2 3 0 1\n",
"7\n0 3 1 0 5 2 6\n"
] |
[
"1\n",
"3\n",
"2\n"
] |
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7.
| 1,000
|
[
{
"input": "3\n0 2 0",
"output": "1"
},
{
"input": "5\n4 2 3 0 1",
"output": "3"
},
{
"input": "7\n0 3 1 0 5 2 6",
"output": "2"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n0 1",
"output": "0"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "3\n0 2 1",
"output": "1"
},
{
"input": "10\n7 1 9 3 5 8 6 0 2 4",
"output": "9"
},
{
"input": "10\n1 3 5 7 9 8 6 4 2 0",
"output": "9"
},
{
"input": "10\n5 0 0 1 3 2 2 2 5 7",
"output": "1"
},
{
"input": "10\n8 6 5 3 9 7 1 4 2 0",
"output": "8"
},
{
"input": "10\n1 2 4 5 0 1 3 7 1 4",
"output": "2"
},
{
"input": "10\n3 4 8 9 5 1 2 0 6 7",
"output": "6"
},
{
"input": "10\n2 2 0 0 6 2 9 0 2 0",
"output": "2"
},
{
"input": "10\n1 7 5 3 2 6 0 8 4 9",
"output": "8"
},
{
"input": "9\n1 3 8 6 2 4 5 0 7",
"output": "7"
},
{
"input": "9\n1 3 5 7 8 6 4 2 0",
"output": "8"
},
{
"input": "9\n2 4 3 1 3 0 5 4 3",
"output": "3"
},
{
"input": "9\n3 5 6 8 7 0 4 2 1",
"output": "5"
},
{
"input": "9\n2 0 8 1 0 3 0 5 3",
"output": "2"
},
{
"input": "9\n6 2 3 7 4 8 5 1 0",
"output": "4"
},
{
"input": "9\n3 1 5 6 0 3 2 0 0",
"output": "2"
},
{
"input": "9\n2 6 4 1 0 8 5 3 7",
"output": "7"
},
{
"input": "100\n27 20 18 78 93 38 56 2 48 75 36 88 96 57 69 10 25 74 68 86 65 85 66 14 22 12 43 80 99 34 42 63 61 71 77 15 37 54 21 59 23 94 28 30 50 84 62 76 47 16 26 64 82 92 72 53 17 11 41 91 35 83 79 95 67 13 1 7 3 4 73 90 8 19 33 58 98 32 39 45 87 52 60 46 6 44 49 70 51 9 5 29 31 24 40 97 81 0 89 55",
"output": "69"
},
{
"input": "100\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "99"
},
{
"input": "100\n13 89 81 0 62 1 59 92 29 13 1 37 2 8 53 15 20 34 12 70 0 85 97 55 84 60 37 54 14 65 22 69 30 22 95 44 59 85 50 80 9 71 91 93 74 21 11 78 28 21 40 81 76 24 26 60 48 85 61 68 89 76 46 73 34 52 98 29 4 38 94 51 5 55 6 27 74 27 38 37 82 70 44 89 51 59 30 37 15 55 63 78 42 39 71 43 4 10 2 13",
"output": "21"
},
{
"input": "100\n1 3 5 7 58 11 13 15 17 19 45 23 25 27 29 31 33 35 37 39 41 43 21 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 81 79 83 85 87 89 91 93 95 97 48 98 96 94 92 90 88 44 84 82 80 78 76 74 72 70 68 66 64 62 60 9 56 54 52 50 99 46 86 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "96"
},
{
"input": "100\n32 47 74 8 14 4 12 68 18 0 44 80 14 38 6 57 4 72 69 3 21 78 74 22 39 32 58 63 34 33 23 6 39 11 6 12 18 4 0 11 20 28 16 1 22 12 57 55 13 48 43 1 50 18 87 6 11 45 38 67 37 14 7 56 6 41 1 55 5 73 78 64 38 18 38 8 37 0 18 61 37 58 58 62 86 5 0 2 15 43 34 61 2 21 15 9 69 1 11 24",
"output": "4"
},
{
"input": "100\n40 3 55 7 6 77 13 46 17 64 21 54 25 27 91 41 1 15 37 82 23 43 42 47 26 95 53 5 11 59 61 9 78 67 69 58 73 0 36 79 60 83 2 87 63 33 71 89 97 99 98 93 56 92 19 88 86 84 39 28 65 20 34 76 51 94 66 12 62 49 96 72 24 52 48 50 44 35 74 31 38 57 81 32 22 80 70 29 30 18 68 16 14 90 10 8 85 4 45 75",
"output": "75"
},
{
"input": "100\n34 16 42 21 84 27 11 7 82 16 95 39 36 64 26 0 38 37 2 2 16 56 16 61 55 42 26 5 61 8 30 20 19 15 9 78 5 34 15 0 3 17 36 36 1 5 4 26 18 0 14 25 7 5 91 7 43 26 79 37 17 27 40 55 66 7 0 2 16 23 68 35 2 5 9 21 1 7 2 9 4 3 22 15 27 6 0 47 5 0 12 9 20 55 36 10 6 8 5 1",
"output": "3"
},
{
"input": "100\n35 53 87 49 13 24 93 20 5 11 31 32 40 52 96 46 1 25 66 69 28 88 84 82 70 9 75 39 26 21 18 29 23 57 90 16 48 22 95 0 58 43 7 73 8 62 63 30 64 92 79 3 6 94 34 12 76 99 67 55 56 97 14 91 68 36 44 78 41 71 86 89 47 74 4 45 98 37 80 33 83 27 42 59 72 54 17 60 51 81 15 77 65 50 10 85 61 19 38 2",
"output": "67"
},
{
"input": "99\n89 96 56 31 32 14 9 66 87 34 69 5 92 54 41 52 46 30 22 26 16 18 20 68 62 73 90 43 79 33 58 98 37 45 10 78 94 51 19 0 91 39 28 47 17 86 3 61 77 7 15 64 55 83 65 71 97 88 6 48 24 11 8 42 81 4 63 93 50 74 35 12 95 27 53 82 29 85 84 60 72 40 36 57 23 13 38 59 49 1 75 44 76 2 21 25 70 80 67",
"output": "75"
},
{
"input": "99\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 78 76 74 72 70 68 66 64 62 60 58 56 54 52 50 48 46 44 42 40 38 36 34 32 30 28 26 24 22 20 18 16 14 12 10 8 6 4 2 0",
"output": "98"
},
{
"input": "99\n82 7 6 77 17 28 90 3 68 12 63 60 24 20 4 81 71 85 57 45 11 84 3 91 49 34 89 82 0 50 48 88 36 76 36 5 62 48 20 2 20 45 69 27 37 62 42 31 57 51 92 84 89 25 7 62 12 23 23 56 30 90 27 10 77 58 48 38 56 68 57 15 33 1 34 67 16 47 75 70 69 28 38 16 5 61 85 76 44 90 37 22 77 94 55 1 97 8 69",
"output": "22"
},
{
"input": "99\n1 51 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 42 43 45 47 49 3 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 98 96 94 92 90 88 86 84 82 80 8 76 74 72 70 68 66 22 62 60 58 56 54 52 0 48 46 44 41 40 38 36 34 32 30 28 26 24 64 20 18 16 14 12 10 78 6 4 2 50",
"output": "96"
},
{
"input": "99\n22 3 19 13 65 87 28 17 41 40 31 21 8 37 29 65 65 53 16 33 13 5 76 4 72 9 2 76 57 72 50 15 75 0 30 13 83 36 12 31 49 51 65 22 48 31 60 15 2 17 6 1 8 0 1 63 3 16 7 7 2 1 47 28 26 21 2 36 1 5 20 25 44 0 2 39 46 30 33 11 15 34 34 4 84 52 0 39 7 3 17 15 6 38 52 64 26 1 0",
"output": "3"
},
{
"input": "99\n24 87 25 82 97 11 37 15 23 19 34 17 76 13 45 89 33 1 27 78 63 43 54 47 49 2 42 41 75 83 61 90 65 67 21 71 60 57 77 62 81 58 85 69 3 91 68 55 72 93 29 94 66 16 88 86 84 53 14 39 35 44 9 70 80 92 56 79 74 5 64 31 52 50 48 46 51 59 40 38 36 96 32 30 28 95 7 22 20 18 26 73 12 10 8 6 4 98 0",
"output": "74"
},
{
"input": "99\n22 14 0 44 6 17 6 6 37 45 0 48 19 8 57 8 10 0 3 12 25 2 5 53 9 49 15 6 38 14 9 40 38 22 27 12 64 10 11 35 89 19 46 39 12 24 48 0 52 1 27 27 24 4 64 24 5 0 67 3 5 39 0 1 13 37 2 8 46 1 28 70 6 79 14 15 33 6 7 34 6 18 4 71 1 55 33 71 18 11 47 23 72 53 65 32 2 7 28",
"output": "3"
},
{
"input": "99\n28 59 73 89 52 27 0 20 36 12 83 95 31 24 54 94 49 14 51 34 50 93 13 1 2 68 63 48 41 81 23 43 18 9 16 38 33 60 62 3 40 85 72 69 90 98 11 37 22 44 35 6 21 39 82 10 64 66 96 42 74 30 8 67 97 46 84 32 17 57 75 71 5 26 4 55 58 29 7 15 45 19 92 91 78 65 88 25 86 80 77 87 79 53 47 70 56 76 61",
"output": "63"
}
] | 1,444,069,189
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 61
| 4,403,200
|
#!/usr/bin/env python3.4
import time
COL, ROW, LEN = 1000, 1000, 26
matrix = [[0] * COL for i in range(ROW)]
arr = [0] * LEN
direction = ((0, -1), (-1, 0), (0, 1), (1, 0))
class Pair:
def __init__(self, x, y):
self.x = x
self.y = y
def timer(func, *pargs, **kargs):
start = time.time()
func(*pargs, **kargs)
return time.time() - start
def test(a):
answer = 0
for value in a:
if value >= 0:
answer += value
return answer
if __name__ == "__main__":
n = int(input())
arr = list(map(int, input().split()))
ans = -1
volume = 0
direct = 0
while test(arr):
ans += 1
if direct == 0:
for ind, val in enumerate(arr):
if val <= volume and val != -1:
arr[ind] = -1
volume += 1
else:
for ind in range(len(arr), 0, -1):
if arr[ind] <= volume and arr[ind] != -1:
arr[ind] = -1
volume += 1
direct += 1
direct %= 2
print(ans)
|
Title: Robot's Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Robot Doc is located in the hall, with *n* computers stand in a line, numbered from left to right from 1 to *n*. Each computer contains exactly one piece of information, each of which Doc wants to get eventually. The computers are equipped with a security system, so to crack the *i*-th of them, the robot needs to collect at least *a**i* any pieces of information from the other computers. Doc can hack the computer only if he is right next to it.
The robot is assembled using modern technologies and can move along the line of computers in either of the two possible directions, but the change of direction requires a large amount of resources from Doc. Tell the minimum number of changes of direction, which the robot will have to make to collect all *n* parts of information if initially it is next to computer with number 1.
It is guaranteed that there exists at least one sequence of the robot's actions, which leads to the collection of all information. Initially Doc doesn't have any pieces of information.
Input Specification:
The first line contains number *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=<<=*n*), separated by a space. It is guaranteed that there exists a way for robot to collect all pieces of the information.
Output Specification:
Print a single number — the minimum number of changes in direction that the robot will have to make in order to collect all *n* parts of information.
Demo Input:
['3\n0 2 0\n', '5\n4 2 3 0 1\n', '7\n0 3 1 0 5 2 6\n']
Demo Output:
['1\n', '3\n', '2\n']
Note:
In the first sample you can assemble all the pieces of information in the optimal manner by assembling first the piece of information in the first computer, then in the third one, then change direction and move to the second one, and then, having 2 pieces of information, collect the last piece.
In the second sample to collect all the pieces of information in the optimal manner, Doc can go to the fourth computer and get the piece of information, then go to the fifth computer with one piece and get another one, then go to the second computer in the same manner, then to the third one and finally, to the first one. Changes of direction will take place before moving from the fifth to the second computer, then from the second to the third computer, then from the third to the first computer.
In the third sample the optimal order of collecting parts from computers can look like that: 1->3->4->6->2->5->7.
|
```python
#!/usr/bin/env python3.4
import time
COL, ROW, LEN = 1000, 1000, 26
matrix = [[0] * COL for i in range(ROW)]
arr = [0] * LEN
direction = ((0, -1), (-1, 0), (0, 1), (1, 0))
class Pair:
def __init__(self, x, y):
self.x = x
self.y = y
def timer(func, *pargs, **kargs):
start = time.time()
func(*pargs, **kargs)
return time.time() - start
def test(a):
answer = 0
for value in a:
if value >= 0:
answer += value
return answer
if __name__ == "__main__":
n = int(input())
arr = list(map(int, input().split()))
ans = -1
volume = 0
direct = 0
while test(arr):
ans += 1
if direct == 0:
for ind, val in enumerate(arr):
if val <= volume and val != -1:
arr[ind] = -1
volume += 1
else:
for ind in range(len(arr), 0, -1):
if arr[ind] <= volume and arr[ind] != -1:
arr[ind] = -1
volume += 1
direct += 1
direct %= 2
print(ans)
```
| -1
|
|
501
|
A
|
Contest
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Misha and Vasya participated in a Codeforces contest. Unfortunately, each of them solved only one problem, though successfully submitted it at the first attempt. Misha solved the problem that costs *a* points and Vasya solved the problem that costs *b* points. Besides, Misha submitted the problem *c* minutes after the contest started and Vasya submitted the problem *d* minutes after the contest started. As you know, on Codeforces the cost of a problem reduces as a round continues. That is, if you submit a problem that costs *p* points *t* minutes after the contest started, you get points.
Misha and Vasya are having an argument trying to find out who got more points. Help them to find out the truth.
|
The first line contains four integers *a*, *b*, *c*, *d* (250<=≤<=*a*,<=*b*<=≤<=3500, 0<=≤<=*c*,<=*d*<=≤<=180).
It is guaranteed that numbers *a* and *b* are divisible by 250 (just like on any real Codeforces round).
|
Output on a single line:
"Misha" (without the quotes), if Misha got more points than Vasya.
"Vasya" (without the quotes), if Vasya got more points than Misha.
"Tie" (without the quotes), if both of them got the same number of points.
|
[
"500 1000 20 30\n",
"1000 1000 1 1\n",
"1500 1000 176 177\n"
] |
[
"Vasya\n",
"Tie\n",
"Misha\n"
] |
none
| 500
|
[
{
"input": "500 1000 20 30",
"output": "Vasya"
},
{
"input": "1000 1000 1 1",
"output": "Tie"
},
{
"input": "1500 1000 176 177",
"output": "Misha"
},
{
"input": "1500 1000 74 177",
"output": "Misha"
},
{
"input": "750 2500 175 178",
"output": "Vasya"
},
{
"input": "750 1000 54 103",
"output": "Tie"
},
{
"input": "2000 1250 176 130",
"output": "Tie"
},
{
"input": "1250 1750 145 179",
"output": "Tie"
},
{
"input": "2000 2000 176 179",
"output": "Tie"
},
{
"input": "1500 1500 148 148",
"output": "Tie"
},
{
"input": "2750 1750 134 147",
"output": "Misha"
},
{
"input": "3250 250 175 173",
"output": "Misha"
},
{
"input": "500 500 170 176",
"output": "Misha"
},
{
"input": "250 1000 179 178",
"output": "Vasya"
},
{
"input": "3250 1000 160 138",
"output": "Misha"
},
{
"input": "3000 2000 162 118",
"output": "Tie"
},
{
"input": "1500 1250 180 160",
"output": "Tie"
},
{
"input": "1250 2500 100 176",
"output": "Tie"
},
{
"input": "3500 3500 177 178",
"output": "Tie"
},
{
"input": "3000 3250 16 34",
"output": "Tie"
},
{
"input": "1750 3000 137 49",
"output": "Vasya"
},
{
"input": "500 1500 179 71",
"output": "Vasya"
},
{
"input": "1250 2000 101 180",
"output": "Misha"
},
{
"input": "250 750 180 176",
"output": "Vasya"
},
{
"input": "2250 2250 163 145",
"output": "Vasya"
},
{
"input": "3000 3000 176 78",
"output": "Vasya"
},
{
"input": "250 3500 8 178",
"output": "Vasya"
},
{
"input": "1750 1250 179 180",
"output": "Misha"
},
{
"input": "2750 1750 13 164",
"output": "Misha"
},
{
"input": "1750 2250 178 53",
"output": "Vasya"
},
{
"input": "2500 2750 73 179",
"output": "Misha"
},
{
"input": "1000 3500 178 175",
"output": "Vasya"
},
{
"input": "1000 500 7 162",
"output": "Misha"
},
{
"input": "1000 250 175 48",
"output": "Misha"
},
{
"input": "1750 500 166 177",
"output": "Misha"
},
{
"input": "250 250 0 0",
"output": "Tie"
},
{
"input": "250 3500 0 0",
"output": "Vasya"
},
{
"input": "250 3500 0 180",
"output": "Vasya"
},
{
"input": "3500 3500 180 180",
"output": "Tie"
},
{
"input": "3500 250 0 180",
"output": "Misha"
}
] | 1,655,325,243
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 46
| 0
|
n=input().split(' ')
a=int(n[0])
b=int(n[1])
c=int(n[2])
d=int(n[3])
calc_1=(3*a)/10
calc_1_1=a-((a*c)/250)
calc_2=(3*b)/10
calc_2_2=b-((b*d)/250)
if calc_1_1==calc_2_2:
print('Tie')
elif calc_1_1>calc_2_2:
print('Misha')
else:
print('Vasya')
|
Title: Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Misha and Vasya participated in a Codeforces contest. Unfortunately, each of them solved only one problem, though successfully submitted it at the first attempt. Misha solved the problem that costs *a* points and Vasya solved the problem that costs *b* points. Besides, Misha submitted the problem *c* minutes after the contest started and Vasya submitted the problem *d* minutes after the contest started. As you know, on Codeforces the cost of a problem reduces as a round continues. That is, if you submit a problem that costs *p* points *t* minutes after the contest started, you get points.
Misha and Vasya are having an argument trying to find out who got more points. Help them to find out the truth.
Input Specification:
The first line contains four integers *a*, *b*, *c*, *d* (250<=≤<=*a*,<=*b*<=≤<=3500, 0<=≤<=*c*,<=*d*<=≤<=180).
It is guaranteed that numbers *a* and *b* are divisible by 250 (just like on any real Codeforces round).
Output Specification:
Output on a single line:
"Misha" (without the quotes), if Misha got more points than Vasya.
"Vasya" (without the quotes), if Vasya got more points than Misha.
"Tie" (without the quotes), if both of them got the same number of points.
Demo Input:
['500 1000 20 30\n', '1000 1000 1 1\n', '1500 1000 176 177\n']
Demo Output:
['Vasya\n', 'Tie\n', 'Misha\n']
Note:
none
|
```python
n=input().split(' ')
a=int(n[0])
b=int(n[1])
c=int(n[2])
d=int(n[3])
calc_1=(3*a)/10
calc_1_1=a-((a*c)/250)
calc_2=(3*b)/10
calc_2_2=b-((b*d)/250)
if calc_1_1==calc_2_2:
print('Tie')
elif calc_1_1>calc_2_2:
print('Misha')
else:
print('Vasya')
```
| 0
|
|
284
|
B
|
Cows and Poker Game
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] | null | null |
There are *n* cows playing poker at a table. For the current betting phase, each player's status is either "ALLIN", "IN", or "FOLDED", and does not change throughout the phase. To increase the suspense, a player whose current status is not "FOLDED" may show his/her hand to the table. However, so as not to affect any betting decisions, he/she may only do so if all other players have a status of either "ALLIN" or "FOLDED". The player's own status may be either "ALLIN" or "IN".
Find the number of cows that can currently show their hands without affecting any betting decisions.
|
The first line contains a single integer, *n* (2<=≤<=*n*<=≤<=2·105). The second line contains *n* characters, each either "A", "I", or "F". The *i*-th character is "A" if the *i*-th player's status is "ALLIN", "I" if the *i*-th player's status is "IN", or "F" if the *i*-th player's status is "FOLDED".
|
The first line should contain a single integer denoting the number of players that can currently show their hands.
|
[
"6\nAFFAAA\n",
"3\nAFI\n"
] |
[
"4\n",
"1\n"
] |
In the first sample, cows 1, 4, 5, and 6 can show their hands. In the second sample, only cow 3 can show her hand.
| 1,000
|
[
{
"input": "6\nAFFAAA",
"output": "4"
},
{
"input": "3\nAFI",
"output": "1"
},
{
"input": "3\nFFF",
"output": "0"
},
{
"input": "3\nFIF",
"output": "1"
},
{
"input": "3\nAAA",
"output": "3"
},
{
"input": "3\nIII",
"output": "0"
},
{
"input": "3\nIIA",
"output": "0"
},
{
"input": "3\nAFF",
"output": "1"
},
{
"input": "5\nFAFFF",
"output": "1"
},
{
"input": "3\nIAA",
"output": "1"
},
{
"input": "3\nIIF",
"output": "0"
},
{
"input": "2\nFA",
"output": "1"
},
{
"input": "2\nFF",
"output": "0"
},
{
"input": "2\nIF",
"output": "1"
},
{
"input": "5\nAAAAI",
"output": "1"
},
{
"input": "5\nIIIIF",
"output": "0"
},
{
"input": "10\nAAAAAAAAAA",
"output": "10"
},
{
"input": "100\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "100"
},
{
"input": "5\nFAIAF",
"output": "1"
},
{
"input": "5\nAIAIF",
"output": "0"
},
{
"input": "5\nFAAII",
"output": "0"
},
{
"input": "5\nAIFFF",
"output": "1"
},
{
"input": "5\nAFAFA",
"output": "3"
},
{
"input": "2\nFA",
"output": "1"
},
{
"input": "8\nAFFFFIAF",
"output": "1"
},
{
"input": "8\nIAAIFFFI",
"output": "0"
},
{
"input": "5\nIIIII",
"output": "0"
}
] | 1,622,864,670
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 218
| 0
|
def main():
n = int(input())
cont = 0
cows = input()
for i in range(n-1, -1, -1):
if cows[i] == 'A':
cont += 1
elif cows[i] == 'I':
cont += 1
break
print(cont)
main()
|
Title: Cows and Poker Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cows playing poker at a table. For the current betting phase, each player's status is either "ALLIN", "IN", or "FOLDED", and does not change throughout the phase. To increase the suspense, a player whose current status is not "FOLDED" may show his/her hand to the table. However, so as not to affect any betting decisions, he/she may only do so if all other players have a status of either "ALLIN" or "FOLDED". The player's own status may be either "ALLIN" or "IN".
Find the number of cows that can currently show their hands without affecting any betting decisions.
Input Specification:
The first line contains a single integer, *n* (2<=≤<=*n*<=≤<=2·105). The second line contains *n* characters, each either "A", "I", or "F". The *i*-th character is "A" if the *i*-th player's status is "ALLIN", "I" if the *i*-th player's status is "IN", or "F" if the *i*-th player's status is "FOLDED".
Output Specification:
The first line should contain a single integer denoting the number of players that can currently show their hands.
Demo Input:
['6\nAFFAAA\n', '3\nAFI\n']
Demo Output:
['4\n', '1\n']
Note:
In the first sample, cows 1, 4, 5, and 6 can show their hands. In the second sample, only cow 3 can show her hand.
|
```python
def main():
n = int(input())
cont = 0
cows = input()
for i in range(n-1, -1, -1):
if cows[i] == 'A':
cont += 1
elif cows[i] == 'I':
cont += 1
break
print(cont)
main()
```
| 0
|
|
1,007
|
A
|
Reorder the Array
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"data structures",
"math",
"sortings",
"two pointers"
] | null | null |
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
|
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
|
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
|
[
"7\n10 1 1 1 5 5 3\n",
"5\n1 1 1 1 1\n"
] |
[
"4\n",
"0\n"
] |
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
| 500
|
[
{
"input": "7\n10 1 1 1 5 5 3",
"output": "4"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "6\n300000000 200000000 300000000 200000000 1000000000 300000000",
"output": "3"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "9"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "7\n3 5 2 2 5 2 4",
"output": "4"
},
{
"input": "5\n1 5 4 2 3",
"output": "4"
}
] | 1,565,879,211
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 140
| 0
|
n = int(input())
a = list(map(int , input().split()))
count = 0
a.sort()
mini = a[0]
for i in range(n):
if a[i] > mini:
count+=1
print(count)
|
Title: Reorder the Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given an array of integers. Vasya can permute (change order) its integers. He wants to do it so that as many as possible integers will become on a place where a smaller integer used to stand. Help Vasya find the maximal number of such integers.
For instance, if we are given an array $[10, 20, 30, 40]$, we can permute it so that it becomes $[20, 40, 10, 30]$. Then on the first and the second positions the integers became larger ($20>10$, $40>20$) and did not on the third and the fourth, so for this permutation, the number that Vasya wants to maximize equals $2$. Read the note for the first example, there is one more demonstrative test case.
Help Vasya to permute integers in such way that the number of positions in a new array, where integers are greater than in the original one, is maximal.
Input Specification:
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the length of the array.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) — the elements of the array.
Output Specification:
Print a single integer — the maximal number of the array's elements which after a permutation will stand on the position where a smaller element stood in the initial array.
Demo Input:
['7\n10 1 1 1 5 5 3\n', '5\n1 1 1 1 1\n']
Demo Output:
['4\n', '0\n']
Note:
In the first sample, one of the best permutations is $[1, 5, 5, 3, 10, 1, 1]$. On the positions from second to fifth the elements became larger, so the answer for this permutation is 4.
In the second sample, there is no way to increase any element with a permutation, so the answer is 0.
|
```python
n = int(input())
a = list(map(int , input().split()))
count = 0
a.sort()
mini = a[0]
for i in range(n):
if a[i] > mini:
count+=1
print(count)
```
| 0
|
|
633
|
B
|
A Trivial Problem
|
PROGRAMMING
| 1,300
|
[
"brute force",
"constructive algorithms",
"math",
"number theory"
] | null | null |
Mr. Santa asks all the great programmers of the world to solve a trivial problem. He gives them an integer *m* and asks for the number of positive integers *n*, such that the factorial of *n* ends with exactly *m* zeroes. Are you among those great programmers who can solve this problem?
|
The only line of input contains an integer *m* (1<=≤<=*m*<=≤<=100<=000) — the required number of trailing zeroes in factorial.
|
First print *k* — the number of values of *n* such that the factorial of *n* ends with *m* zeroes. Then print these *k* integers in increasing order.
|
[
"1\n",
"5\n"
] |
[
"5\n5 6 7 8 9 ",
"0"
] |
The factorial of *n* is equal to the product of all integers from 1 to *n* inclusive, that is *n*! = 1·2·3·...·*n*.
In the first sample, 5! = 120, 6! = 720, 7! = 5040, 8! = 40320 and 9! = 362880.
| 500
|
[
{
"input": "1",
"output": "5\n5 6 7 8 9 "
},
{
"input": "5",
"output": "0"
},
{
"input": "2",
"output": "5\n10 11 12 13 14 "
},
{
"input": "3",
"output": "5\n15 16 17 18 19 "
},
{
"input": "7",
"output": "5\n30 31 32 33 34 "
},
{
"input": "12",
"output": "5\n50 51 52 53 54 "
},
{
"input": "15",
"output": "5\n65 66 67 68 69 "
},
{
"input": "18",
"output": "5\n75 76 77 78 79 "
},
{
"input": "38",
"output": "5\n155 156 157 158 159 "
},
{
"input": "47",
"output": "5\n195 196 197 198 199 "
},
{
"input": "58",
"output": "5\n240 241 242 243 244 "
},
{
"input": "66",
"output": "5\n270 271 272 273 274 "
},
{
"input": "70",
"output": "5\n285 286 287 288 289 "
},
{
"input": "89",
"output": "5\n365 366 367 368 369 "
},
{
"input": "417",
"output": "5\n1675 1676 1677 1678 1679 "
},
{
"input": "815",
"output": "5\n3265 3266 3267 3268 3269 "
},
{
"input": "394",
"output": "5\n1585 1586 1587 1588 1589 "
},
{
"input": "798",
"output": "0"
},
{
"input": "507",
"output": "5\n2035 2036 2037 2038 2039 "
},
{
"input": "406",
"output": "5\n1630 1631 1632 1633 1634 "
},
{
"input": "570",
"output": "5\n2290 2291 2292 2293 2294 "
},
{
"input": "185",
"output": "0"
},
{
"input": "765",
"output": "0"
},
{
"input": "967",
"output": "0"
},
{
"input": "112",
"output": "5\n455 456 457 458 459 "
},
{
"input": "729",
"output": "5\n2925 2926 2927 2928 2929 "
},
{
"input": "4604",
"output": "5\n18425 18426 18427 18428 18429 "
},
{
"input": "8783",
"output": "5\n35140 35141 35142 35143 35144 "
},
{
"input": "1059",
"output": "0"
},
{
"input": "6641",
"output": "5\n26575 26576 26577 26578 26579 "
},
{
"input": "9353",
"output": "5\n37425 37426 37427 37428 37429 "
},
{
"input": "1811",
"output": "5\n7250 7251 7252 7253 7254 "
},
{
"input": "2528",
"output": "0"
},
{
"input": "8158",
"output": "5\n32640 32641 32642 32643 32644 "
},
{
"input": "3014",
"output": "5\n12070 12071 12072 12073 12074 "
},
{
"input": "7657",
"output": "5\n30640 30641 30642 30643 30644 "
},
{
"input": "4934",
"output": "0"
},
{
"input": "9282",
"output": "5\n37140 37141 37142 37143 37144 "
},
{
"input": "2610",
"output": "5\n10450 10451 10452 10453 10454 "
},
{
"input": "2083",
"output": "5\n8345 8346 8347 8348 8349 "
},
{
"input": "26151",
"output": "5\n104620 104621 104622 104623 104624 "
},
{
"input": "64656",
"output": "5\n258640 258641 258642 258643 258644 "
},
{
"input": "46668",
"output": "5\n186690 186691 186692 186693 186694 "
},
{
"input": "95554",
"output": "5\n382235 382236 382237 382238 382239 "
},
{
"input": "37320",
"output": "0"
},
{
"input": "52032",
"output": "5\n208140 208141 208142 208143 208144 "
},
{
"input": "11024",
"output": "5\n44110 44111 44112 44113 44114 "
},
{
"input": "63218",
"output": "5\n252885 252886 252887 252888 252889 "
},
{
"input": "40095",
"output": "5\n160390 160391 160392 160393 160394 "
},
{
"input": "42724",
"output": "5\n170910 170911 170912 170913 170914 "
},
{
"input": "24381",
"output": "5\n97530 97531 97532 97533 97534 "
},
{
"input": "73138",
"output": "5\n292570 292571 292572 292573 292574 "
},
{
"input": "93346",
"output": "5\n373400 373401 373402 373403 373404 "
},
{
"input": "18338",
"output": "5\n73370 73371 73372 73373 73374 "
},
{
"input": "42662",
"output": "5\n170660 170661 170662 170663 170664 "
},
{
"input": "81221",
"output": "5\n324900 324901 324902 324903 324904 "
},
{
"input": "100000",
"output": "5\n400005 400006 400007 400008 400009 "
},
{
"input": "100000",
"output": "5\n400005 400006 400007 400008 400009 "
},
{
"input": "99998",
"output": "0"
},
{
"input": "30",
"output": "0"
},
{
"input": "11",
"output": "0"
},
{
"input": "780",
"output": "0"
},
{
"input": "97656",
"output": "5\n390625 390626 390627 390628 390629 "
},
{
"input": "12499",
"output": "5\n50000 50001 50002 50003 50004 "
},
{
"input": "65",
"output": "5\n265 266 267 268 269 "
},
{
"input": "41",
"output": "5\n170 171 172 173 174 "
},
{
"input": "31",
"output": "5\n125 126 127 128 129 "
},
{
"input": "86577",
"output": "0"
}
] | 1,659,787,419
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 68
| 249
| 0
|
m = int(input())
result = list()
number = 1
fiveCount = 0
while True:
curFiveCount = fiveCount
tempNumber = number
while tempNumber%5 == 0:
curFiveCount = curFiveCount + 1
tempNumber = tempNumber//5
if curFiveCount == m:
result.append(number)
#print(curFiveCount)
if curFiveCount > m:
break
fiveCount = curFiveCount
number = number + 1
print(len(result))
for ele in result:
print(ele,end=(' '))
|
Title: A Trivial Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mr. Santa asks all the great programmers of the world to solve a trivial problem. He gives them an integer *m* and asks for the number of positive integers *n*, such that the factorial of *n* ends with exactly *m* zeroes. Are you among those great programmers who can solve this problem?
Input Specification:
The only line of input contains an integer *m* (1<=≤<=*m*<=≤<=100<=000) — the required number of trailing zeroes in factorial.
Output Specification:
First print *k* — the number of values of *n* such that the factorial of *n* ends with *m* zeroes. Then print these *k* integers in increasing order.
Demo Input:
['1\n', '5\n']
Demo Output:
['5\n5 6 7 8 9 ', '0']
Note:
The factorial of *n* is equal to the product of all integers from 1 to *n* inclusive, that is *n*! = 1·2·3·...·*n*.
In the first sample, 5! = 120, 6! = 720, 7! = 5040, 8! = 40320 and 9! = 362880.
|
```python
m = int(input())
result = list()
number = 1
fiveCount = 0
while True:
curFiveCount = fiveCount
tempNumber = number
while tempNumber%5 == 0:
curFiveCount = curFiveCount + 1
tempNumber = tempNumber//5
if curFiveCount == m:
result.append(number)
#print(curFiveCount)
if curFiveCount > m:
break
fiveCount = curFiveCount
number = number + 1
print(len(result))
for ele in result:
print(ele,end=(' '))
```
| 3
|
|
46
|
A
|
Ball Game
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] |
A. Ball Game
|
2
|
256
|
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) which indicates the number of kids in the circle.
|
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
|
[
"10\n",
"3\n"
] |
[
"2 4 7 1 6 2 9 7 6\n",
"2 1\n"
] |
none
| 0
|
[
{
"input": "10",
"output": "2 4 7 1 6 2 9 7 6"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "4",
"output": "2 4 3"
},
{
"input": "5",
"output": "2 4 2 1"
},
{
"input": "6",
"output": "2 4 1 5 4"
},
{
"input": "7",
"output": "2 4 7 4 2 1"
},
{
"input": "8",
"output": "2 4 7 3 8 6 5"
},
{
"input": "9",
"output": "2 4 7 2 7 4 2 1"
},
{
"input": "2",
"output": "2"
},
{
"input": "11",
"output": "2 4 7 11 5 11 7 4 2 1"
},
{
"input": "12",
"output": "2 4 7 11 4 10 5 1 10 8 7"
},
{
"input": "13",
"output": "2 4 7 11 3 9 3 11 7 4 2 1"
},
{
"input": "20",
"output": "2 4 7 11 16 2 9 17 6 16 7 19 12 6 1 17 14 12 11"
},
{
"input": "25",
"output": "2 4 7 11 16 22 4 12 21 6 17 4 17 6 21 12 4 22 16 11 7 4 2 1"
},
{
"input": "30",
"output": "2 4 7 11 16 22 29 7 16 26 7 19 2 16 1 17 4 22 11 1 22 14 7 1 26 22 19 17 16"
},
{
"input": "35",
"output": "2 4 7 11 16 22 29 2 11 21 32 9 22 1 16 32 14 32 16 1 22 9 32 21 11 2 29 22 16 11 7 4 2 1"
},
{
"input": "40",
"output": "2 4 7 11 16 22 29 37 6 16 27 39 12 26 1 17 34 12 31 11 32 14 37 21 6 32 19 7 36 26 17 9 2 36 31 27 24 22 21"
},
{
"input": "45",
"output": "2 4 7 11 16 22 29 37 1 11 22 34 2 16 31 2 19 37 11 31 7 29 7 31 11 37 19 2 31 16 2 34 22 11 1 37 29 22 16 11 7 4 2 1"
},
{
"input": "50",
"output": "2 4 7 11 16 22 29 37 46 6 17 29 42 6 21 37 4 22 41 11 32 4 27 1 26 2 29 7 36 16 47 29 12 46 31 17 4 42 31 21 12 4 47 41 36 32 29 27 26"
},
{
"input": "55",
"output": "2 4 7 11 16 22 29 37 46 1 12 24 37 51 11 27 44 7 26 46 12 34 2 26 51 22 49 22 51 26 2 34 12 46 26 7 44 27 11 51 37 24 12 1 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "60",
"output": "2 4 7 11 16 22 29 37 46 56 7 19 32 46 1 17 34 52 11 31 52 14 37 1 26 52 19 47 16 46 17 49 22 56 31 7 44 22 1 41 22 4 47 31 16 2 49 37 26 16 7 59 52 46 41 37 34 32 31"
},
{
"input": "65",
"output": "2 4 7 11 16 22 29 37 46 56 2 14 27 41 56 7 24 42 61 16 37 59 17 41 1 27 54 17 46 11 42 9 42 11 46 17 54 27 1 41 17 59 37 16 61 42 24 7 56 41 27 14 2 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "70",
"output": "2 4 7 11 16 22 29 37 46 56 67 9 22 36 51 67 14 32 51 1 22 44 67 21 46 2 29 57 16 46 7 39 2 36 1 37 4 42 11 51 22 64 37 11 56 32 9 57 36 16 67 49 32 16 1 57 44 32 21 11 2 64 57 51 46 42 39 37 36"
},
{
"input": "75",
"output": "2 4 7 11 16 22 29 37 46 56 67 4 17 31 46 62 4 22 41 61 7 29 52 1 26 52 4 32 61 16 47 4 37 71 31 67 29 67 31 71 37 4 47 16 61 32 4 52 26 1 52 29 7 61 41 22 4 62 46 31 17 4 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "80",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 12 26 41 57 74 12 31 51 72 14 37 61 6 32 59 7 36 66 17 49 2 36 71 27 64 22 61 21 62 24 67 31 76 42 9 57 26 76 47 19 72 46 21 77 54 32 11 71 52 34 17 1 66 52 39 27 16 6 77 69 62 56 51 47 44 42 41"
},
{
"input": "85",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 7 21 36 52 69 2 21 41 62 84 22 46 71 12 39 67 11 41 72 19 52 1 36 72 24 62 16 56 12 54 12 56 16 62 24 72 36 1 52 19 72 41 11 67 39 12 71 46 22 84 62 41 21 2 69 52 36 21 7 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "90",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 2 16 31 47 64 82 11 31 52 74 7 31 56 82 19 47 76 16 47 79 22 56 1 37 74 22 61 11 52 4 47 1 46 2 49 7 56 16 67 29 82 46 11 67 34 2 61 31 2 64 37 11 76 52 29 7 76 56 37 19 2 76 61 47 34 22 11 1 82 74 67 61 56 52 49 47 46"
},
{
"input": "95",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 11 26 42 59 77 1 21 42 64 87 16 41 67 94 27 56 86 22 54 87 26 61 2 39 77 21 61 7 49 92 41 86 37 84 37 86 41 92 49 7 61 21 77 39 2 61 26 87 54 22 86 56 27 94 67 41 16 87 64 42 21 1 77 59 42 26 11 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "96",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 10 25 41 58 76 95 19 40 62 85 13 38 64 91 23 52 82 17 49 82 20 55 91 32 70 13 53 94 40 83 31 76 26 73 25 74 28 79 35 88 46 5 61 22 80 43 7 68 34 1 65 34 4 71 43 16 86 61 37 14 88 67 47 28 10 89 73 58 44 31 19 8 94 85 77 70 64 59 55 52 50 49"
},
{
"input": "97",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 9 24 40 57 75 94 17 38 60 83 10 35 61 88 19 48 78 12 44 77 14 49 85 25 63 5 45 86 31 74 21 66 15 62 13 62 15 66 21 74 31 86 45 5 63 25 85 49 14 77 44 12 78 48 19 88 61 35 10 83 60 38 17 94 75 57 40 24 9 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "98",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 8 23 39 56 74 93 15 36 58 81 7 32 58 85 15 44 74 7 39 72 8 43 79 18 56 95 37 78 22 65 11 56 4 51 1 50 2 53 7 60 16 71 29 86 46 7 67 30 92 57 23 88 56 25 93 64 36 9 81 56 32 9 85 64 44 25 7 88 72 57 43 30 18 7 95 86 78 71 65 60 56 53 51 50"
},
{
"input": "99",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 7 22 38 55 73 92 13 34 56 79 4 29 55 82 11 40 70 2 34 67 2 37 73 11 49 88 29 70 13 56 1 46 92 40 88 38 88 40 92 46 1 56 13 70 29 88 49 11 73 37 2 67 34 2 70 40 11 82 55 29 4 79 56 34 13 92 73 55 38 22 7 92 79 67 56 46 37 29 22 16 11 7 4 2 1"
},
{
"input": "100",
"output": "2 4 7 11 16 22 29 37 46 56 67 79 92 6 21 37 54 72 91 11 32 54 77 1 26 52 79 7 36 66 97 29 62 96 31 67 4 42 81 21 62 4 47 91 36 82 29 77 26 76 27 79 32 86 41 97 54 12 71 31 92 54 17 81 46 12 79 47 16 86 57 29 2 76 51 27 4 82 61 41 22 4 87 71 56 42 29 17 6 96 87 79 72 66 61 57 54 52 51"
}
] | 1,691,736,160
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 92
| 0
|
n,a=int(input()),0
for i in range(1,n):
a=(a+i)%n
print(a+1,'')
|
Title: Ball Game
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A kindergarten teacher Natalia Pavlovna has invented a new ball game. This game not only develops the children's physique, but also teaches them how to count.
The game goes as follows. Kids stand in circle. Let's agree to think of the children as numbered with numbers from 1 to *n* clockwise and the child number 1 is holding the ball. First the first child throws the ball to the next one clockwise, i.e. to the child number 2. Then the child number 2 throws the ball to the next but one child, i.e. to the child number 4, then the fourth child throws the ball to the child that stands two children away from him, i.e. to the child number 7, then the ball is thrown to the child who stands 3 children away from the child number 7, then the ball is thrown to the child who stands 4 children away from the last one, and so on. It should be mentioned that when a ball is thrown it may pass the beginning of the circle. For example, if *n*<==<=5, then after the third throw the child number 2 has the ball again. Overall, *n*<=-<=1 throws are made, and the game ends.
The problem is that not all the children get the ball during the game. If a child doesn't get the ball, he gets very upset and cries until Natalia Pavlovna gives him a candy. That's why Natalia Pavlovna asks you to help her to identify the numbers of the children who will get the ball after each throw.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) which indicates the number of kids in the circle.
Output Specification:
In the single line print *n*<=-<=1 numbers which are the numbers of children who will get the ball after each throw. Separate the numbers by spaces.
Demo Input:
['10\n', '3\n']
Demo Output:
['2 4 7 1 6 2 9 7 6\n', '2 1\n']
Note:
none
|
```python
n,a=int(input()),0
for i in range(1,n):
a=(a+i)%n
print(a+1,'')
```
| 3.977
|
125
|
C
|
Hobbits' Party
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"greedy"
] | null | null |
Everyone knows that hobbits love to organize all sorts of parties and celebrations. There are *n* hobbits living in the Shire. They decided to organize the Greatest Party (GP) that would last for several days. Next day the hobbits wrote a guest list, some non-empty set containing all the inhabitants of the Shire. To ensure that everybody enjoy themselves and nobody gets bored, for any two days (say, days A and B) of the GP there existed at least one hobbit, invited to come on day A and on day B. However, to ensure that nobody has a row, for any three different days A, B, C there shouldn't be a hobbit invited on days A, B and C. The Shire inhabitants are keen on keeping the GP going for as long as possible. Your task is given number *n*, to indicate the GP's maximum duration and the guest lists for each day.
|
The first line contains an integer *n* (3<=≤<=*n*<=≤<=10000), representing the number of hobbits.
|
In the first output line print a number *k* — the maximum duration of GP in days. Then on *k* lines print the guest lists, (the guests should be separated by spaces). Print each guest list on the single line. Each list can contain an arbitrary positive number of hobbits. The hobbits are numbered with integers from 1 to *n*.
|
[
"4\n",
"5\n"
] |
[
"3\n1 2 \n1 3 \n2 3 \n",
"3\n1 2 \n1 3 \n2 3 \n"
] |
none
| 2,000
|
[
{
"input": "4",
"output": "3\n1 2 \n1 3 \n2 3 "
},
{
"input": "5",
"output": "3\n1 2 \n1 3 \n2 3 "
},
{
"input": "6",
"output": "4\n1 2 3 \n1 4 5 \n2 4 6 \n3 5 6 "
},
{
"input": "7",
"output": "4\n1 2 3 \n1 4 5 \n2 4 6 \n3 5 6 "
},
{
"input": "8",
"output": "4\n1 2 3 \n1 4 5 \n2 4 6 \n3 5 6 "
},
{
"input": "9",
"output": "4\n1 2 3 \n1 4 5 \n2 4 6 \n3 5 6 "
},
{
"input": "10",
"output": "5\n1 2 3 4 \n1 5 6 7 \n2 5 8 9 \n3 6 8 10 \n4 7 9 10 "
},
{
"input": "11",
"output": "5\n1 2 3 4 \n1 5 6 7 \n2 5 8 9 \n3 6 8 10 \n4 7 9 10 "
},
{
"input": "14",
"output": "5\n1 2 3 4 \n1 5 6 7 \n2 5 8 9 \n3 6 8 10 \n4 7 9 10 "
},
{
"input": "15",
"output": "6\n1 2 3 4 5 \n1 6 7 8 9 \n2 6 10 11 12 \n3 7 10 13 14 \n4 8 11 13 15 \n5 9 12 14 15 "
},
{
"input": "16",
"output": "6\n1 2 3 4 5 \n1 6 7 8 9 \n2 6 10 11 12 \n3 7 10 13 14 \n4 8 11 13 15 \n5 9 12 14 15 "
},
{
"input": "20",
"output": "6\n1 2 3 4 5 \n1 6 7 8 9 \n2 6 10 11 12 \n3 7 10 13 14 \n4 8 11 13 15 \n5 9 12 14 15 "
},
{
"input": "21",
"output": "7\n1 2 3 4 5 6 \n1 7 8 9 10 11 \n2 7 12 13 14 15 \n3 8 12 16 17 18 \n4 9 13 16 19 20 \n5 10 14 17 19 21 \n6 11 15 18 20 21 "
},
{
"input": "44",
"output": "9\n1 2 3 4 5 6 7 8 \n1 9 10 11 12 13 14 15 \n2 9 16 17 18 19 20 21 \n3 10 16 22 23 24 25 26 \n4 11 17 22 27 28 29 30 \n5 12 18 23 27 31 32 33 \n6 13 19 24 28 31 34 35 \n7 14 20 25 29 32 34 36 \n8 15 21 26 30 33 35 36 "
},
{
"input": "45",
"output": "10\n1 2 3 4 5 6 7 8 9 \n1 10 11 12 13 14 15 16 17 \n2 10 18 19 20 21 22 23 24 \n3 11 18 25 26 27 28 29 30 \n4 12 19 25 31 32 33 34 35 \n5 13 20 26 31 36 37 38 39 \n6 14 21 27 32 36 40 41 42 \n7 15 22 28 33 37 40 43 44 \n8 16 23 29 34 38 41 43 45 \n9 17 24 30 35 39 42 44 45 "
},
{
"input": "189",
"output": "19\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 \n1 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 \n2 19 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 \n3 20 36 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 \n4 21 37 52 67 68 69 70 71 72 73 74 75 76 77 78 79 80 \n5 22 38 53 67 81 82 83 84 85 86 87 88 89 90 91 92 93 \n6 23 39 54 68 81 94 95 96 97 98 99 100 101 102 103 104 105 \n7 24 40 55 69 82 94 106 107 108 109 110 111 112 113 114 115 116 \n8 25 41 56 70 83 95 106 117 118 119 120 121 122 123 124 12..."
},
{
"input": "190",
"output": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 \n1 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 \n2 20 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 \n3 21 38 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 \n4 22 39 55 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 \n5 23 40 56 71 86 87 88 89 90 91 92 93 94 95 96 97 98 99 \n6 24 41 57 72 86 100 101 102 103 104 105 106 107 108 109 110 111 112 \n7 25 42 58 73 87 100 113 114 115 116 117 118 119 120 121 122 123 124 \n8 26 43 59 74 88 101 113 ..."
},
{
"input": "191",
"output": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 \n1 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 \n2 20 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 \n3 21 38 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 \n4 22 39 55 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 \n5 23 40 56 71 86 87 88 89 90 91 92 93 94 95 96 97 98 99 \n6 24 41 57 72 86 100 101 102 103 104 105 106 107 108 109 110 111 112 \n7 25 42 58 73 87 100 113 114 115 116 117 118 119 120 121 122 123 124 \n8 26 43 59 74 88 101 113 ..."
},
{
"input": "209",
"output": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 \n1 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 \n2 20 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 \n3 21 38 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 \n4 22 39 55 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 \n5 23 40 56 71 86 87 88 89 90 91 92 93 94 95 96 97 98 99 \n6 24 41 57 72 86 100 101 102 103 104 105 106 107 108 109 110 111 112 \n7 25 42 58 73 87 100 113 114 115 116 117 118 119 120 121 122 123 124 \n8 26 43 59 74 88 101 113 ..."
},
{
"input": "210",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 \n1 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 \n2 21 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 \n3 22 40 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 \n4 23 41 58 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 \n5 24 42 59 75 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 \n6 25 43 60 76 91 106 107 108 109 110 111 112 113 114 115 116 117 118 119 \n7 26 44 61 77 92 106 120 121 122 123 124 125 126 127 128 129 130 131..."
},
{
"input": "230",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 \n1 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 \n2 21 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 \n3 22 40 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 \n4 23 41 58 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 \n5 24 42 59 75 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 \n6 25 43 60 76 91 106 107 108 109 110 111 112 113 114 115 116 117 118 119 \n7 26 44 61 77 92 106 120 121 122 123 124 125 126 127 128 129 130 131..."
},
{
"input": "231",
"output": "22\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 \n1 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 \n2 22 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 \n3 23 42 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 \n4 24 43 61 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 \n5 25 44 62 79 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 \n6 26 45 63 80 96 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 \n7 27 46 64 81 97 112 127 128 129 130 131..."
},
{
"input": "251",
"output": "22\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 \n1 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 \n2 22 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 \n3 23 42 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 \n4 24 43 61 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 \n5 25 44 62 79 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 \n6 26 45 63 80 96 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 \n7 27 46 64 81 97 112 127 128 129 130 131..."
},
{
"input": "252",
"output": "22\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 \n1 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 \n2 22 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 \n3 23 42 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 \n4 24 43 61 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 \n5 25 44 62 79 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 \n6 26 45 63 80 96 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 \n7 27 46 64 81 97 112 127 128 129 130 131..."
},
{
"input": "253",
"output": "23\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n1 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 \n2 23 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 \n3 24 44 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 \n4 25 45 64 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 \n5 26 46 65 83 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 \n6 27 47 66 84 101 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 \n7 28 48 67 ..."
},
{
"input": "254",
"output": "23\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n1 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 \n2 23 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 \n3 24 44 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 \n4 25 45 64 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 \n5 26 46 65 83 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 \n6 27 47 66 84 101 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 \n7 28 48 67 ..."
},
{
"input": "255",
"output": "23\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 \n1 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 \n2 23 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 \n3 24 44 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 \n4 25 45 64 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 \n5 26 46 65 83 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 \n6 27 47 66 84 101 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 \n7 28 48 67 ..."
},
{
"input": "3",
"output": "3\n1 2 \n1 3 \n2 3 "
},
{
"input": "9000",
"output": "134\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 \n1 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9100",
"output": "135\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 \n1 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9200",
"output": "136\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 \n1 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9300",
"output": "136\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 \n1 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9400",
"output": "137\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 \n1 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9500",
"output": "138\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 \n1 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9600",
"output": "139\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 \n1 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9700",
"output": "139\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 \n1 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9800",
"output": "140\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 \n1 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9900",
"output": "141\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 \n1 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9998",
"output": "141\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 \n1 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9999",
"output": "141\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 \n1 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "10000",
"output": "141\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 \n1 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9868",
"output": "140\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 \n1 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9869",
"output": "140\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 \n1 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9870",
"output": "141\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 \n1 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9871",
"output": "141\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 \n1 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "9377",
"output": "137\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 \n1 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
}
] | 1,570,149,973
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 46
| 310
| 1,740,800
|
'''
Author : thekushalghosh
Team : CodeDiggers
'''
n = int(input())
q = int(0.5 + (1 + 8*n)**0.5 / 2)
w = 1
qw = [[] for _ in range(q)]
for i in range(q):
j = i + 1
while len(qw[i]) < q - 1:
qw[i].append(str(w))
qw[j].append(str(w))
w = w + 1
j = j + 1
print(q)
for q in qw:
print(" ".join(q))
|
Title: Hobbits' Party
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everyone knows that hobbits love to organize all sorts of parties and celebrations. There are *n* hobbits living in the Shire. They decided to organize the Greatest Party (GP) that would last for several days. Next day the hobbits wrote a guest list, some non-empty set containing all the inhabitants of the Shire. To ensure that everybody enjoy themselves and nobody gets bored, for any two days (say, days A and B) of the GP there existed at least one hobbit, invited to come on day A and on day B. However, to ensure that nobody has a row, for any three different days A, B, C there shouldn't be a hobbit invited on days A, B and C. The Shire inhabitants are keen on keeping the GP going for as long as possible. Your task is given number *n*, to indicate the GP's maximum duration and the guest lists for each day.
Input Specification:
The first line contains an integer *n* (3<=≤<=*n*<=≤<=10000), representing the number of hobbits.
Output Specification:
In the first output line print a number *k* — the maximum duration of GP in days. Then on *k* lines print the guest lists, (the guests should be separated by spaces). Print each guest list on the single line. Each list can contain an arbitrary positive number of hobbits. The hobbits are numbered with integers from 1 to *n*.
Demo Input:
['4\n', '5\n']
Demo Output:
['3\n1 2 \n1 3 \n2 3 \n', '3\n1 2 \n1 3 \n2 3 \n']
Note:
none
|
```python
'''
Author : thekushalghosh
Team : CodeDiggers
'''
n = int(input())
q = int(0.5 + (1 + 8*n)**0.5 / 2)
w = 1
qw = [[] for _ in range(q)]
for i in range(q):
j = i + 1
while len(qw[i]) < q - 1:
qw[i].append(str(w))
qw[j].append(str(w))
w = w + 1
j = j + 1
print(q)
for q in qw:
print(" ".join(q))
```
| 3
|
|
233
|
A
|
Perfect Permutation
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
|
A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.
|
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.
|
[
"1\n",
"2\n",
"4\n"
] |
[
"-1\n",
"2 1 \n",
"2 1 4 3 \n"
] |
none
| 500
|
[
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "4",
"output": "2 1 4 3 "
},
{
"input": "3",
"output": "-1"
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "2 1 4 3 6 5 "
},
{
"input": "7",
"output": "-1"
},
{
"input": "20",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 "
},
{
"input": "8",
"output": "2 1 4 3 6 5 8 7 "
},
{
"input": "9",
"output": "-1"
},
{
"input": "10",
"output": "2 1 4 3 6 5 8 7 10 9 "
},
{
"input": "11",
"output": "-1"
},
{
"input": "21",
"output": "-1"
},
{
"input": "50",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 "
},
{
"input": "51",
"output": "-1"
},
{
"input": "52",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 "
},
{
"input": "84",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 "
},
{
"input": "86",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 "
},
{
"input": "100",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 "
},
{
"input": "98",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 "
},
{
"input": "96",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 "
},
{
"input": "33",
"output": "-1"
},
{
"input": "34",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 "
},
{
"input": "36",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 "
},
{
"input": "38",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 "
},
{
"input": "40",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 "
},
{
"input": "42",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 "
},
{
"input": "44",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 "
},
{
"input": "46",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 "
},
{
"input": "48",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 "
}
] | 1,649,856,741
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
n = int(input())
arr = [i for i in range (1,n+1)]
arr1 = []
i,con = 0,True
while i <= n>>1:
try:
arr1.append(arr.pop(1))
except:
break
arr1.append(arr.pop(0))
if arr:arr1.append(arr[0])
for i in range (len(arr1)):
if i+1 == arr1[i]:
con = False
break
if con:print(*arr1)
else:print(-1)
|
Title: Perfect Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
Input Specification:
A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.
Output Specification:
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.
Demo Input:
['1\n', '2\n', '4\n']
Demo Output:
['-1\n', '2 1 \n', '2 1 4 3 \n']
Note:
none
|
```python
n = int(input())
arr = [i for i in range (1,n+1)]
arr1 = []
i,con = 0,True
while i <= n>>1:
try:
arr1.append(arr.pop(1))
except:
break
arr1.append(arr.pop(0))
if arr:arr1.append(arr[0])
for i in range (len(arr1)):
if i+1 == arr1[i]:
con = False
break
if con:print(*arr1)
else:print(-1)
```
| 3
|
|
500
|
A
|
New Year Transportation
|
PROGRAMMING
| 1,000
|
[
"dfs and similar",
"graphs",
"implementation"
] | null | null |
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
|
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
|
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
|
[
"8 4\n1 2 1 2 1 2 1\n",
"8 5\n1 2 1 2 1 1 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
| 500
|
[
{
"input": "8 4\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "8 5\n1 2 1 2 1 1 1",
"output": "NO"
},
{
"input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1",
"output": "YES"
},
{
"input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1",
"output": "YES"
},
{
"input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1",
"output": "NO"
},
{
"input": "10 3\n8 3 5 4 2 3 2 2 1",
"output": "NO"
},
{
"input": "10 9\n8 3 5 4 2 3 2 2 1",
"output": "YES"
},
{
"input": "3 2\n1 1",
"output": "YES"
},
{
"input": "3 2\n2 1",
"output": "NO"
},
{
"input": "4 2\n2 1 1",
"output": "NO"
},
{
"input": "4 4\n2 2 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "3 3\n1 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 1 1",
"output": "YES"
},
{
"input": "3 3\n2 1",
"output": "YES"
},
{
"input": "4 4\n1 1 1",
"output": "YES"
},
{
"input": "8 8\n1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "5 5\n1 1 1 1",
"output": "YES"
}
] | 1,659,522,853
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 12
| 46
| 1,740,800
|
n, t = map(int, input().split())
numbers = list(map(int, input().split()))
ans = 'NO'
i = 1 # номер портала и ячейки
while i < n:
if i == t:
ans = 'YES'
break
i = i + numbers[i-1]
print(ans)
|
Title: New Year Transportation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
Input Specification:
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
Output Specification:
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
Demo Input:
['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
|
```python
n, t = map(int, input().split())
numbers = list(map(int, input().split()))
ans = 'NO'
i = 1 # номер портала и ячейки
while i < n:
if i == t:
ans = 'YES'
break
i = i + numbers[i-1]
print(ans)
```
| 0
|
|
32
|
B
|
Borze
|
PROGRAMMING
| 800
|
[
"expression parsing",
"implementation"
] |
B. Borze
|
2
|
256
|
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
|
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
|
Output the decoded ternary number. It can have leading zeroes.
|
[
".-.--\n",
"--.\n",
"-..-.--\n"
] |
[
"012",
"20",
"1012"
] |
none
| 1,000
|
[
{
"input": ".-.--",
"output": "012"
},
{
"input": "--.",
"output": "20"
},
{
"input": "-..-.--",
"output": "1012"
},
{
"input": "---..",
"output": "210"
},
{
"input": "..--.---..",
"output": "0020210"
},
{
"input": "-.....----.",
"output": "10000220"
},
{
"input": ".",
"output": "0"
},
{
"input": "-.",
"output": "1"
},
{
"input": "--",
"output": "2"
},
{
"input": "..",
"output": "00"
},
{
"input": "--.",
"output": "20"
},
{
"input": ".--.",
"output": "020"
},
{
"input": ".-.-..",
"output": "0110"
},
{
"input": "----.-.",
"output": "2201"
},
{
"input": "-..--.-.",
"output": "10201"
},
{
"input": "..--..--.",
"output": "0020020"
},
{
"input": "-.-.---.--..-..-.-.-..-..-.--.",
"output": "112120010111010120"
},
{
"input": "---.-.-.------..-..-..-..-.-..-.--.-.-..-.-.-----..-.-.",
"output": "21112220010101011012011011221011"
},
{
"input": "-.-..--.-.-.-.-.-..-.-.-.---------.--.---..--...--.-----.-.-.-...--.-.-.---.------.--..-.--.-----.-...-..------",
"output": "11020111110111222212021020002022111100201121222020012022110010222"
},
{
"input": "-.-..-.--.---..---.-..---.-...-.-.----..-.---.-.---..-.--.---.-.-------.---.--....----.-.---.---.---.----.-----..---.-.-.-.-----.--.-------.-..",
"output": "110120210211021100112200121121012021122212120000220121212122022102111122120222110"
},
{
"input": ".-..-.-.---.-----.--.---...-.--.-.-....-..",
"output": "01011212212021001201100010"
},
{
"input": ".------.-.---..--...-..-..-.-.-.--.--.-..-.--...-.-.---.-.-.------..--..-.---..----.-..-.--.---.-.----.-.---...-.-.-.-----.-.-.---.---.-.....-.-...-----.-...-.---.-..-.-----.--...---.-.-..-.--.-.---..",
"output": "022201210200010101112020101200011211122200200121022010120211220121001112211121211000011002211001211012212000211101201210"
},
{
"input": ".-.--.---.-----.-.-----.-.-..-----..-..----..--.-.--.----..---.---..-.-.-----..-------.----..----.-..---...-----..-..-----...-..-.-.-----....---..---..-.-----...-.--...--.-.---.-.-.-.-.-...---..----.",
"output": "01202122112211102210102200201202200212101122102221220022010210022101022100101122100021021012210012000201211111100210220"
},
{
"input": "..-.-.-.---.-.-.-..-.-..-.-.---.-------.---..-----.---....-.---.--.--.-.---.---------.-..---.-.-.--..---.---.-.---.-.-..-.-..-.-.-.----.--.-....--------.-.---..----.------.-.-.--.--.-----.-----.----",
"output": "0011121111011011212221210221210001212020121222211021112002121121110110111220201000222201210220222011202022122122"
},
{
"input": "-..-------.------.-..--.-.-..--.-.-..-----..-.-.-..-..-..--.---..-----..---..-..--.-..-.-.---...-.....-------.---.-----.-...-.-...-.-.---.---.-----.--.--...-.--..-.-..-...-.-.-.-.---..---.-..-.-.-.-..",
"output": "102221222010201102011022101110101020210221021010201011210010000222121221100110011212122120200012001101001111210211011110"
},
{
"input": ".-.----.-.--..-.-.-.-..----..-.-...--.-.---.---.-------..-.--..-......--.------.--.----.--...-.--.--..-----..-.....--.--.-.-.------..--------.----------..-.---.----.---.-..--..-.....-..------.--.",
"output": "012201200111102200110020121212221012001000002022202022020001202002210100002020112220022220222220012122021102001000010222020"
},
{
"input": "------.-----.-....--.-.----.-.---.-.-..---.-.---.-----..-...-.-.---..-.-.-..-.-.-...-.-.-.----..--.------.----.-..-.--...-.-------...-.-..-.-.--.--.---..--..--------.--.-.-.---.-.-.-...----.--..-.--..",
"output": "222022110002012201211102112122101001121011101110011122002022202201012000122210011011202021020022220201121111002202001200"
},
{
"input": "-.---...----...--.--...-.--.----",
"output": "121002200020200012022"
},
{
"input": "--.--.--.---.--.-.---.-.-..-..--.-..---.-.....-..---.-----.--...-.-.-------.-.--.-.----.-..-.------.",
"output": "202020212012111010201021100001021221200011222112012201012220"
}
] | 1,668,838,966
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 92
| 0
|
num = input()
buffer = ''
ans = ''
for ch in num:
buffer += ch
if buffer == '.':
ans += '0'
buffer = ''
elif buffer == '-.':
ans += '1'
buffer = ''
elif buffer == '--':
ans += '2'
buffer = ''
print(ans)
|
Title: Borze
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Ternary numeric notation is quite popular in Berland. To telegraph the ternary number the Borze alphabet is used. Digit 0 is transmitted as «.», 1 as «-.» and 2 as «--». You are to decode the Borze code, i.e. to find out the ternary number given its representation in Borze alphabet.
Input Specification:
The first line contains a number in Borze code. The length of the string is between 1 and 200 characters. It's guaranteed that the given string is a valid Borze code of some ternary number (this number can have leading zeroes).
Output Specification:
Output the decoded ternary number. It can have leading zeroes.
Demo Input:
['.-.--\n', '--.\n', '-..-.--\n']
Demo Output:
['012', '20', '1012']
Note:
none
|
```python
num = input()
buffer = ''
ans = ''
for ch in num:
buffer += ch
if buffer == '.':
ans += '0'
buffer = ''
elif buffer == '-.':
ans += '1'
buffer = ''
elif buffer == '--':
ans += '2'
buffer = ''
print(ans)
```
| 3.977
|
289
|
B
|
Polo the Penguin and Matrix
|
PROGRAMMING
| 1,400
|
[
"brute force",
"dp",
"implementation",
"sortings",
"ternary search"
] | null | null |
Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*.
In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so.
|
The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104).
|
In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes).
|
[
"2 2 2\n2 4\n6 8\n",
"1 2 7\n6 7\n"
] |
[
"4\n",
"-1\n"
] |
none
| 1,000
|
[
{
"input": "2 2 2\n2 4\n6 8",
"output": "4"
},
{
"input": "1 2 7\n6 7",
"output": "-1"
},
{
"input": "3 2 1\n5 7\n1 2\n5 100",
"output": "104"
},
{
"input": "3 3 3\n5 8 5\n11 11 17\n14 5 2",
"output": "12"
},
{
"input": "3 3 3\n5 8 5\n11 11 17\n14 5 3",
"output": "-1"
},
{
"input": "2 2 4\n5 5\n5 5",
"output": "0"
},
{
"input": "7 4 5\n7 7 7 12\n7 12 12 7\n7 7 7 7\n7 7 12 7\n7 7 12 12\n12 12 7 12\n7 7 7 7",
"output": "9"
},
{
"input": "7 7 47\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91",
"output": "0"
},
{
"input": "7 7 47\n47 47 47 47 47 47 47\n47 47 47 47 77 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 127 47",
"output": "-1"
},
{
"input": "7 5 47\n9583 1734 4601 5353 2110\n3802 5165 7985 6293 324\n7045 653 9160 7891 4930\n1781 3520 4178 2298 3943\n1405 2956 5447 5494 6528\n3097 1640 7750 4883 8032\n4225 8455 1875 4789 4366",
"output": "1508"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 1 8\n12",
"output": "0"
}
] | 1,618,408,176
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 124
| 0
|
def solve(r, c, d):
a = []
mod = None
no = False
for _ in range(r):
for n in map(int, input().split()):
if not no:
a.append(n)
if mod is None:
mod = n % d
continue
if mod != n % d:
no = True
if no:
return -1
a.sort()
k = r * c
med = a[(k // 2) - 1]
ans = 0
for n in a:
ans += abs(n - med) // d
return ans
n, m, d = map(int, input().split())
print(solve(n, m, d))
|
Title: Polo the Penguin and Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*.
In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so.
Input Specification:
The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104).
Output Specification:
In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes).
Demo Input:
['2 2 2\n2 4\n6 8\n', '1 2 7\n6 7\n']
Demo Output:
['4\n', '-1\n']
Note:
none
|
```python
def solve(r, c, d):
a = []
mod = None
no = False
for _ in range(r):
for n in map(int, input().split()):
if not no:
a.append(n)
if mod is None:
mod = n % d
continue
if mod != n % d:
no = True
if no:
return -1
a.sort()
k = r * c
med = a[(k // 2) - 1]
ans = 0
for n in a:
ans += abs(n - med) // d
return ans
n, m, d = map(int, input().split())
print(solve(n, m, d))
```
| 0
|
|
791
|
A
|
Bear and Big Brother
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
|
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
|
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
|
[
"4 7\n",
"4 9\n",
"1 1\n"
] |
[
"2\n",
"3\n",
"1\n"
] |
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
| 500
|
[
{
"input": "4 7",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "4"
},
{
"input": "1 6",
"output": "5"
},
{
"input": "1 7",
"output": "5"
},
{
"input": "1 8",
"output": "6"
},
{
"input": "1 9",
"output": "6"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "2 4",
"output": "2"
},
{
"input": "2 5",
"output": "3"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "4"
},
{
"input": "2 8",
"output": "4"
},
{
"input": "2 9",
"output": "4"
},
{
"input": "2 10",
"output": "4"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "3 4",
"output": "1"
},
{
"input": "3 5",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "3"
},
{
"input": "3 8",
"output": "3"
},
{
"input": "3 9",
"output": "3"
},
{
"input": "3 10",
"output": "3"
},
{
"input": "4 4",
"output": "1"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "4 10",
"output": "3"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "1"
},
{
"input": "5 7",
"output": "1"
},
{
"input": "5 8",
"output": "2"
},
{
"input": "5 9",
"output": "2"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "6 9",
"output": "2"
},
{
"input": "6 10",
"output": "2"
},
{
"input": "7 7",
"output": "1"
},
{
"input": "7 8",
"output": "1"
},
{
"input": "7 9",
"output": "1"
},
{
"input": "7 10",
"output": "1"
},
{
"input": "8 8",
"output": "1"
},
{
"input": "8 9",
"output": "1"
},
{
"input": "8 10",
"output": "1"
},
{
"input": "9 9",
"output": "1"
},
{
"input": "9 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "1 2",
"output": "2"
}
] | 1,694,317,529
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 62
| 46
| 0
|
from math import log2
a, b = tuple(map(int, input().strip().split()))
print(f'{int(1 + ((log2(b) - log2(a)) // (log2(3) - 1)))}')
|
Title: Bear and Big Brother
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
Output Specification:
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
Demo Input:
['4 7\n', '4 9\n', '1 1\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then.
|
```python
from math import log2
a, b = tuple(map(int, input().strip().split()))
print(f'{int(1 + ((log2(b) - log2(a)) // (log2(3) - 1)))}')
```
| 3
|
|
895
|
B
|
XK Segments
|
PROGRAMMING
| 1,700
|
[
"binary search",
"math",
"sortings",
"two pointers"
] | null | null |
While Vasya finished eating his piece of pizza, the lesson has already started. For being late for the lesson, the teacher suggested Vasya to solve one interesting problem. Vasya has an array *a* and integer *x*. He should find the number of different ordered pairs of indexes (*i*,<=*j*) such that *a**i*<=≤<=*a**j* and there are exactly *k* integers *y* such that *a**i*<=≤<=*y*<=≤<=*a**j* and *y* is divisible by *x*.
In this problem it is meant that pair (*i*,<=*j*) is equal to (*j*,<=*i*) only if *i* is equal to *j*. For example pair (1,<=2) is not the same as (2,<=1).
|
The first line contains 3 integers *n*,<=*x*,<=*k* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*x*<=≤<=109,<=0<=≤<=*k*<=≤<=109), where *n* is the size of the array *a* and *x* and *k* are numbers from the statement.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
|
Print one integer — the answer to the problem.
|
[
"4 2 1\n1 3 5 7\n",
"4 2 0\n5 3 1 7\n",
"5 3 1\n3 3 3 3 3\n"
] |
[
"3\n",
"4\n",
"25\n"
] |
In first sample there are only three suitable pairs of indexes — (1, 2), (2, 3), (3, 4).
In second sample there are four suitable pairs of indexes(1, 1), (2, 2), (3, 3), (4, 4).
In third sample every pair (*i*, *j*) is suitable, so the answer is 5 * 5 = 25.
| 1,000
|
[
{
"input": "4 2 1\n1 3 5 7",
"output": "3"
},
{
"input": "4 2 0\n5 3 1 7",
"output": "4"
},
{
"input": "5 3 1\n3 3 3 3 3",
"output": "25"
},
{
"input": "5 3 4\n24 13 1 24 24",
"output": "4"
},
{
"input": "4 2 2\n1 3 5 7",
"output": "2"
},
{
"input": "5 1 0\n10 12 14 20 30",
"output": "0"
},
{
"input": "7 3 1\n3 3 6 9 12 15 18",
"output": "9"
},
{
"input": "2 5 0\n3 4",
"output": "3"
},
{
"input": "3 5 0\n4 4 4",
"output": "9"
},
{
"input": "3 6 0\n3 4 5",
"output": "6"
},
{
"input": "10 2 1\n2 2 2 2 2 2 2 1 2 1",
"output": "80"
},
{
"input": "100 2 1\n1 2 2 2 1 2 1 2 2 2 2 1 2 1 1 2 1 2 2 1 1 2 1 1 2 2 1 1 2 1 2 2 2 2 2 1 1 1 2 1 2 1 2 1 2 1 2 2 1 2 2 2 1 1 1 2 2 1 1 2 2 1 1 1 1 1 1 2 2 1 1 2 2 1 2 2 1 2 1 2 2 1 2 1 1 1 2 2 1 1 2 1 2 2 1 1 2 2 2 1",
"output": "5200"
},
{
"input": "1 13 1\n13",
"output": "1"
},
{
"input": "2 1 1000000000\n1 1000000000",
"output": "1"
},
{
"input": "2 1000000000 1\n1 1000000000",
"output": "2"
},
{
"input": "1 1 1\n1",
"output": "1"
},
{
"input": "5 1000000000 1\n1000000000 1 1 1 1",
"output": "5"
},
{
"input": "2 1000 1000000\n1 1000000000",
"output": "1"
},
{
"input": "6 2 10\n1 1 1 20 20 20",
"output": "9"
},
{
"input": "1 1000000000 1\n1000000000",
"output": "1"
},
{
"input": "4 65536 65536\n1 2 3 4",
"output": "0"
},
{
"input": "1 600000000 1\n500000000",
"output": "0"
},
{
"input": "5 3 2\n2 3 4 5 8",
"output": "2"
}
] | 1,632,325,343
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 7
| 108
| 20,582,400
|
from bisect import bisect_left as bl, bisect as br
from collections import Counter
def f(a,x,k):
#r-l+1 (l=a[l]//x r=a[r]//x
lo=0
hi=0
a.sort()
ans=0
lt=list(map(lambda s:s//x,a))
# k-(a[i]-1)//x
# print(lt)
for i in a:
val=k+((i-1)//x)
lr=bl(lt,val)
rr=br(lt,val)
ans+=rr-lr
return ans
n,x,k=map(int,input().strip().split())
l=list(map(int,input().strip().split()))
print(f(l,x, k))
|
Title: XK Segments
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
While Vasya finished eating his piece of pizza, the lesson has already started. For being late for the lesson, the teacher suggested Vasya to solve one interesting problem. Vasya has an array *a* and integer *x*. He should find the number of different ordered pairs of indexes (*i*,<=*j*) such that *a**i*<=≤<=*a**j* and there are exactly *k* integers *y* such that *a**i*<=≤<=*y*<=≤<=*a**j* and *y* is divisible by *x*.
In this problem it is meant that pair (*i*,<=*j*) is equal to (*j*,<=*i*) only if *i* is equal to *j*. For example pair (1,<=2) is not the same as (2,<=1).
Input Specification:
The first line contains 3 integers *n*,<=*x*,<=*k* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*x*<=≤<=109,<=0<=≤<=*k*<=≤<=109), where *n* is the size of the array *a* and *x* and *k* are numbers from the statement.
The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the elements of the array *a*.
Output Specification:
Print one integer — the answer to the problem.
Demo Input:
['4 2 1\n1 3 5 7\n', '4 2 0\n5 3 1 7\n', '5 3 1\n3 3 3 3 3\n']
Demo Output:
['3\n', '4\n', '25\n']
Note:
In first sample there are only three suitable pairs of indexes — (1, 2), (2, 3), (3, 4).
In second sample there are four suitable pairs of indexes(1, 1), (2, 2), (3, 3), (4, 4).
In third sample every pair (*i*, *j*) is suitable, so the answer is 5 * 5 = 25.
|
```python
from bisect import bisect_left as bl, bisect as br
from collections import Counter
def f(a,x,k):
#r-l+1 (l=a[l]//x r=a[r]//x
lo=0
hi=0
a.sort()
ans=0
lt=list(map(lambda s:s//x,a))
# k-(a[i]-1)//x
# print(lt)
for i in a:
val=k+((i-1)//x)
lr=bl(lt,val)
rr=br(lt,val)
ans+=rr-lr
return ans
n,x,k=map(int,input().strip().split())
l=list(map(int,input().strip().split()))
print(f(l,x, k))
```
| 0
|
|
551
|
A
|
GukiZ and Contest
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"sortings"
] | null | null |
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
|
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
|
[
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
] |
[
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
] |
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
| 500
|
[
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
] | 1,629,447,936
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 6,758,400
|
n = int(input())
a = list(map(int,input().split()))
b = sorted(a)
for i in range(n):
for j in range(len(b)-1,-1,-1):
if a[i] == b[j]:
a[i] = n -j
break
print(a)
|
Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position.
|
```python
n = int(input())
a = list(map(int,input().split()))
b = sorted(a)
for i in range(n):
for j in range(len(b)-1,-1,-1):
if a[i] == b[j]:
a[i] = n -j
break
print(a)
```
| 0
|
|
675
|
A
|
Infinite Sequence
|
PROGRAMMING
| 1,100
|
[
"math"
] | null | null |
Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help.
|
The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively.
|
If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes).
|
[
"1 7 3\n",
"10 10 0\n",
"1 -4 5\n",
"0 60 50\n"
] |
[
"YES\n",
"YES\n",
"NO\n",
"NO\n"
] |
In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element.
In the second sample, the favorite integer of Vasya is equal to the first element of the sequence.
In the third sample all elements of the sequence are greater than Vasya's favorite integer.
In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer.
| 500
|
[
{
"input": "1 7 3",
"output": "YES"
},
{
"input": "10 10 0",
"output": "YES"
},
{
"input": "1 -4 5",
"output": "NO"
},
{
"input": "0 60 50",
"output": "NO"
},
{
"input": "1 -4 -5",
"output": "YES"
},
{
"input": "0 1 0",
"output": "NO"
},
{
"input": "10 10 42",
"output": "YES"
},
{
"input": "-1000000000 1000000000 -1",
"output": "NO"
},
{
"input": "10 16 4",
"output": "NO"
},
{
"input": "-1000000000 1000000000 5",
"output": "YES"
},
{
"input": "1000000000 -1000000000 5",
"output": "NO"
},
{
"input": "1000000000 -1000000000 0",
"output": "NO"
},
{
"input": "1000000000 1000000000 0",
"output": "YES"
},
{
"input": "115078364 -899474523 -1",
"output": "YES"
},
{
"input": "-245436499 416383245 992",
"output": "YES"
},
{
"input": "-719636354 536952440 2",
"output": "YES"
},
{
"input": "-198350539 963391024 68337739",
"output": "YES"
},
{
"input": "-652811055 875986516 1091",
"output": "YES"
},
{
"input": "119057893 -516914539 -39748277",
"output": "YES"
},
{
"input": "989140430 731276607 -36837689",
"output": "YES"
},
{
"input": "677168390 494583489 -985071853",
"output": "NO"
},
{
"input": "58090193 777423708 395693923",
"output": "NO"
},
{
"input": "479823846 -403424770 -653472589",
"output": "NO"
},
{
"input": "-52536829 -132023273 -736287999",
"output": "NO"
},
{
"input": "-198893776 740026818 -547885271",
"output": "NO"
},
{
"input": "-2 -2 -2",
"output": "YES"
},
{
"input": "-2 -2 -1",
"output": "YES"
},
{
"input": "-2 -2 0",
"output": "YES"
},
{
"input": "-2 -2 1",
"output": "YES"
},
{
"input": "-2 -2 2",
"output": "YES"
},
{
"input": "-2 -1 -2",
"output": "NO"
},
{
"input": "-2 -1 -1",
"output": "NO"
},
{
"input": "-2 -1 0",
"output": "NO"
},
{
"input": "-2 -1 1",
"output": "YES"
},
{
"input": "-2 -1 2",
"output": "NO"
},
{
"input": "-2 0 -2",
"output": "NO"
},
{
"input": "-2 0 -1",
"output": "NO"
},
{
"input": "-2 0 0",
"output": "NO"
},
{
"input": "-2 0 1",
"output": "YES"
},
{
"input": "-2 0 2",
"output": "YES"
},
{
"input": "-2 1 -2",
"output": "NO"
},
{
"input": "-2 1 -1",
"output": "NO"
},
{
"input": "-2 1 0",
"output": "NO"
},
{
"input": "-2 1 1",
"output": "YES"
},
{
"input": "-2 1 2",
"output": "NO"
},
{
"input": "-2 2 -2",
"output": "NO"
},
{
"input": "-2 2 -1",
"output": "NO"
},
{
"input": "-2 2 0",
"output": "NO"
},
{
"input": "-2 2 1",
"output": "YES"
},
{
"input": "-2 2 2",
"output": "YES"
},
{
"input": "-1 -2 -2",
"output": "NO"
},
{
"input": "-1 -2 -1",
"output": "YES"
},
{
"input": "-1 -2 0",
"output": "NO"
},
{
"input": "-1 -2 1",
"output": "NO"
},
{
"input": "-1 -2 2",
"output": "NO"
},
{
"input": "-1 -1 -2",
"output": "YES"
},
{
"input": "-1 -1 -1",
"output": "YES"
},
{
"input": "-1 -1 0",
"output": "YES"
},
{
"input": "-1 -1 1",
"output": "YES"
},
{
"input": "-1 -1 2",
"output": "YES"
},
{
"input": "-1 0 -2",
"output": "NO"
},
{
"input": "-1 0 -1",
"output": "NO"
},
{
"input": "-1 0 0",
"output": "NO"
},
{
"input": "-1 0 1",
"output": "YES"
},
{
"input": "-1 0 2",
"output": "NO"
},
{
"input": "-1 1 -2",
"output": "NO"
},
{
"input": "-1 1 -1",
"output": "NO"
},
{
"input": "-1 1 0",
"output": "NO"
},
{
"input": "-1 1 1",
"output": "YES"
},
{
"input": "-1 1 2",
"output": "YES"
},
{
"input": "-1 2 -2",
"output": "NO"
},
{
"input": "-1 2 -1",
"output": "NO"
},
{
"input": "-1 2 0",
"output": "NO"
},
{
"input": "-1 2 1",
"output": "YES"
},
{
"input": "-1 2 2",
"output": "NO"
},
{
"input": "0 -2 -2",
"output": "YES"
},
{
"input": "0 -2 -1",
"output": "YES"
},
{
"input": "0 -2 0",
"output": "NO"
},
{
"input": "0 -2 1",
"output": "NO"
},
{
"input": "0 -2 2",
"output": "NO"
},
{
"input": "0 -1 -2",
"output": "NO"
},
{
"input": "0 -1 -1",
"output": "YES"
},
{
"input": "0 -1 0",
"output": "NO"
},
{
"input": "0 -1 1",
"output": "NO"
},
{
"input": "0 -1 2",
"output": "NO"
},
{
"input": "0 0 -2",
"output": "YES"
},
{
"input": "0 0 -1",
"output": "YES"
},
{
"input": "0 0 0",
"output": "YES"
},
{
"input": "0 0 1",
"output": "YES"
},
{
"input": "0 0 2",
"output": "YES"
},
{
"input": "0 1 -2",
"output": "NO"
},
{
"input": "0 1 -1",
"output": "NO"
},
{
"input": "0 1 0",
"output": "NO"
},
{
"input": "0 1 1",
"output": "YES"
},
{
"input": "0 1 2",
"output": "NO"
},
{
"input": "0 2 -2",
"output": "NO"
},
{
"input": "0 2 -1",
"output": "NO"
},
{
"input": "0 2 0",
"output": "NO"
},
{
"input": "0 2 1",
"output": "YES"
},
{
"input": "0 2 2",
"output": "YES"
},
{
"input": "1 -2 -2",
"output": "NO"
},
{
"input": "1 -2 -1",
"output": "YES"
},
{
"input": "1 -2 0",
"output": "NO"
},
{
"input": "1 -2 1",
"output": "NO"
},
{
"input": "1 -2 2",
"output": "NO"
},
{
"input": "1 -1 -2",
"output": "YES"
},
{
"input": "1 -1 -1",
"output": "YES"
},
{
"input": "1 -1 0",
"output": "NO"
},
{
"input": "1 -1 1",
"output": "NO"
},
{
"input": "1 -1 2",
"output": "NO"
},
{
"input": "1 0 -2",
"output": "NO"
},
{
"input": "1 0 -1",
"output": "YES"
},
{
"input": "1 0 0",
"output": "NO"
},
{
"input": "1 0 1",
"output": "NO"
},
{
"input": "1 0 2",
"output": "NO"
},
{
"input": "1 1 -2",
"output": "YES"
},
{
"input": "1 1 -1",
"output": "YES"
},
{
"input": "1 1 0",
"output": "YES"
},
{
"input": "1 1 1",
"output": "YES"
},
{
"input": "1 1 2",
"output": "YES"
},
{
"input": "1 2 -2",
"output": "NO"
},
{
"input": "1 2 -1",
"output": "NO"
},
{
"input": "1 2 0",
"output": "NO"
},
{
"input": "1 2 1",
"output": "YES"
},
{
"input": "1 2 2",
"output": "NO"
},
{
"input": "2 -2 -2",
"output": "YES"
},
{
"input": "2 -2 -1",
"output": "YES"
},
{
"input": "2 -2 0",
"output": "NO"
},
{
"input": "2 -2 1",
"output": "NO"
},
{
"input": "2 -2 2",
"output": "NO"
},
{
"input": "2 -1 -2",
"output": "NO"
},
{
"input": "2 -1 -1",
"output": "YES"
},
{
"input": "2 -1 0",
"output": "NO"
},
{
"input": "2 -1 1",
"output": "NO"
},
{
"input": "2 -1 2",
"output": "NO"
},
{
"input": "2 0 -2",
"output": "YES"
},
{
"input": "2 0 -1",
"output": "YES"
},
{
"input": "2 0 0",
"output": "NO"
},
{
"input": "2 0 1",
"output": "NO"
},
{
"input": "2 0 2",
"output": "NO"
},
{
"input": "2 1 -2",
"output": "NO"
},
{
"input": "2 1 -1",
"output": "YES"
},
{
"input": "2 1 0",
"output": "NO"
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "2 1 2",
"output": "NO"
},
{
"input": "2 2 -2",
"output": "YES"
},
{
"input": "2 2 -1",
"output": "YES"
},
{
"input": "2 2 0",
"output": "YES"
},
{
"input": "2 2 1",
"output": "YES"
},
{
"input": "2 2 2",
"output": "YES"
},
{
"input": "-1000000000 1000000000 1",
"output": "YES"
},
{
"input": "-1000000000 1000000000 2",
"output": "YES"
},
{
"input": "1000000000 -1000000000 -1",
"output": "YES"
},
{
"input": "5 2 3",
"output": "NO"
},
{
"input": "2 1 -1",
"output": "YES"
},
{
"input": "3 2 1",
"output": "NO"
},
{
"input": "0 -5 -3",
"output": "NO"
},
{
"input": "2 5 5",
"output": "NO"
},
{
"input": "0 10 1",
"output": "YES"
},
{
"input": "15 5 -5",
"output": "YES"
},
{
"input": "2 1 1",
"output": "NO"
},
{
"input": "20 10 0",
"output": "NO"
},
{
"input": "20 15 5",
"output": "NO"
},
{
"input": "1 6 1",
"output": "YES"
},
{
"input": "1000000000 0 -1000000000",
"output": "YES"
},
{
"input": "1 1 -5",
"output": "YES"
},
{
"input": "4 6 1",
"output": "YES"
},
{
"input": "-5 -10 -5",
"output": "YES"
},
{
"input": "2 0 0",
"output": "NO"
},
{
"input": "10 9 -1",
"output": "YES"
},
{
"input": "-2 -1 -1",
"output": "NO"
},
{
"input": "1 13 3",
"output": "YES"
},
{
"input": "2 3 0",
"output": "NO"
},
{
"input": "1 1 -1",
"output": "YES"
},
{
"input": "5 -10 -5",
"output": "YES"
},
{
"input": "5 3 1",
"output": "NO"
},
{
"input": "1 1000000000 1",
"output": "YES"
},
{
"input": "-1000000000 1000000000 1000000000",
"output": "YES"
}
] | 1,583,662,535
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 109
| 0
|
a, b, c = map(int, input().split())
ca, ba = c - a, b - a
try:
print(('YES', 'NO')[bool(ba % c) or (ba // abs(ba)) != (ca // abs(ca))])
except:
print(('YES', 'NO')[b != a])
|
Title: Infinite Sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya likes everything infinite. Now he is studying the properties of a sequence *s*, such that its first element is equal to *a* (*s*1<==<=*a*), and the difference between any two neighbouring elements is equal to *c* (*s**i*<=-<=*s**i*<=-<=1<==<=*c*). In particular, Vasya wonders if his favourite integer *b* appears in this sequence, that is, there exists a positive integer *i*, such that *s**i*<==<=*b*. Of course, you are the person he asks for a help.
Input Specification:
The first line of the input contain three integers *a*, *b* and *c* (<=-<=109<=≤<=*a*,<=*b*,<=*c*<=≤<=109) — the first element of the sequence, Vasya's favorite number and the difference between any two neighbouring elements of the sequence, respectively.
Output Specification:
If *b* appears in the sequence *s* print "YES" (without quotes), otherwise print "NO" (without quotes).
Demo Input:
['1 7 3\n', '10 10 0\n', '1 -4 5\n', '0 60 50\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n', 'NO\n']
Note:
In the first sample, the sequence starts from integers 1, 4, 7, so 7 is its element.
In the second sample, the favorite integer of Vasya is equal to the first element of the sequence.
In the third sample all elements of the sequence are greater than Vasya's favorite integer.
In the fourth sample, the sequence starts from 0, 50, 100, and all the following elements are greater than Vasya's favorite integer.
|
```python
a, b, c = map(int, input().split())
ca, ba = c - a, b - a
try:
print(('YES', 'NO')[bool(ba % c) or (ba // abs(ba)) != (ca // abs(ca))])
except:
print(('YES', 'NO')[b != a])
```
| 0
|
|
825
|
C
|
Multi-judge Solving
|
PROGRAMMING
| 1,600
|
[
"greedy",
"implementation"
] | null | null |
Makes solves problems on Decoforces and lots of other different online judges. Each problem is denoted by its difficulty — a positive integer number. Difficulties are measured the same across all the judges (the problem with difficulty *d* on Decoforces is as hard as the problem with difficulty *d* on any other judge).
Makes has chosen *n* problems to solve on Decoforces with difficulties *a*1,<=*a*2,<=...,<=*a**n*. He can solve these problems in arbitrary order. Though he can solve problem *i* with difficulty *a**i* only if he had already solved some problem with difficulty (no matter on what online judge was it).
Before starting this chosen list of problems, Makes has already solved problems with maximum difficulty *k*.
With given conditions it's easy to see that Makes sometimes can't solve all the chosen problems, no matter what order he chooses. So he wants to solve some problems on other judges to finish solving problems from his list.
For every positive integer *y* there exist some problem with difficulty *y* on at least one judge besides Decoforces.
Makes can solve problems on any judge at any time, it isn't necessary to do problems from the chosen list one right after another.
Makes doesn't have too much free time, so he asked you to calculate the minimum number of problems he should solve on other judges in order to solve all the chosen problems from Decoforces.
|
The first line contains two integer numbers *n*, *k* (1<=≤<=*n*<=≤<=103, 1<=≤<=*k*<=≤<=109).
The second line contains *n* space-separated integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
|
Print minimum number of problems Makes should solve on other judges in order to solve all chosen problems on Decoforces.
|
[
"3 3\n2 1 9\n",
"4 20\n10 3 6 3\n"
] |
[
"1\n",
"0\n"
] |
In the first example Makes at first solves problems 1 and 2. Then in order to solve the problem with difficulty 9, he should solve problem with difficulty no less than 5. The only available are difficulties 5 and 6 on some other judge. Solving any of these will give Makes opportunity to solve problem 3.
In the second example he can solve every problem right from the start.
| 0
|
[
{
"input": "3 3\n2 1 9",
"output": "1"
},
{
"input": "4 20\n10 3 6 3",
"output": "0"
},
{
"input": "1 1000000000\n1",
"output": "0"
},
{
"input": "1 1\n3",
"output": "1"
},
{
"input": "50 100\n74 55 33 5 83 24 75 59 30 36 13 4 62 28 96 17 6 35 45 53 33 11 37 93 34 79 61 72 13 31 44 75 7 3 63 46 18 16 44 89 62 25 32 12 38 55 75 56 61 82",
"output": "0"
},
{
"input": "100 10\n246 286 693 607 87 612 909 312 621 37 801 558 504 914 416 762 187 974 976 123 635 488 416 659 988 998 93 662 92 749 889 78 214 786 735 625 921 372 713 617 975 119 402 411 878 138 548 905 802 762 940 336 529 373 745 835 805 880 816 94 166 114 475 699 974 462 61 337 555 805 968 815 392 746 591 558 740 380 668 29 881 151 387 986 174 923 541 520 998 947 535 651 103 584 664 854 180 852 726 93",
"output": "1"
},
{
"input": "2 1\n1 1000000000",
"output": "29"
},
{
"input": "29 2\n1 3 7 15 31 63 127 255 511 1023 2047 4095 8191 16383 32767 65535 131071 262143 524287 1048575 2097151 4194303 8388607 16777215 33554431 67108863 134217727 268435455 536870911",
"output": "27"
},
{
"input": "1 1\n1000000000",
"output": "29"
},
{
"input": "7 6\n4 20 16 14 3 17 4",
"output": "1"
},
{
"input": "2 1\n3 6",
"output": "1"
},
{
"input": "1 1\n20",
"output": "4"
},
{
"input": "5 2\n86 81 53 25 18",
"output": "4"
},
{
"input": "4 1\n88 55 14 39",
"output": "4"
},
{
"input": "3 1\n2 3 6",
"output": "0"
},
{
"input": "3 2\n4 9 18",
"output": "1"
},
{
"input": "5 3\n6 6 6 13 27",
"output": "2"
},
{
"input": "5 1\n23 8 83 26 18",
"output": "4"
},
{
"input": "3 1\n4 5 6",
"output": "1"
},
{
"input": "3 1\n1 3 6",
"output": "1"
},
{
"input": "1 1\n2",
"output": "0"
},
{
"input": "3 2\n4 5 6",
"output": "0"
},
{
"input": "5 1\n100 200 400 1000 2000",
"output": "7"
},
{
"input": "2 1\n1 4",
"output": "1"
},
{
"input": "4 1\n2 4 8 32",
"output": "1"
},
{
"input": "2 10\n21 42",
"output": "1"
},
{
"input": "3 3\n1 7 13",
"output": "1"
},
{
"input": "3 1\n1 4 6",
"output": "1"
},
{
"input": "2 2\n2 8",
"output": "1"
},
{
"input": "1 1\n4",
"output": "1"
},
{
"input": "2 2\n8 16",
"output": "1"
},
{
"input": "3 1\n4 8 16",
"output": "1"
},
{
"input": "3 1\n3 6 9",
"output": "1"
},
{
"input": "2 1\n4 8",
"output": "1"
},
{
"input": "2 2\n7 14",
"output": "1"
},
{
"input": "1 4\n9",
"output": "1"
},
{
"input": "5 3\n1024 4096 16384 65536 536870913",
"output": "24"
},
{
"input": "2 5\n10 11",
"output": "0"
},
{
"input": "2 2\n3 6",
"output": "0"
},
{
"input": "2 2\n8 11",
"output": "1"
},
{
"input": "3 19905705\n263637263 417905394 108361057",
"output": "3"
},
{
"input": "4 25\n100 11 1 13",
"output": "1"
},
{
"input": "10 295206008\n67980321 440051990 883040288 135744260 96431758 242465794 576630162 972797687 356406646 547451696",
"output": "0"
},
{
"input": "4 2\n45 44 35 38",
"output": "4"
},
{
"input": "1 2\n9",
"output": "2"
},
{
"input": "3 6\n13 26 52",
"output": "1"
},
{
"input": "9 30111088\n824713578 11195876 458715185 731769293 680826358 189542586 550198537 860586039 101083021",
"output": "2"
},
{
"input": "3 72014068\n430005292 807436976 828082746",
"output": "2"
},
{
"input": "3 165219745\n737649884 652879952 506420386",
"output": "1"
},
{
"input": "2 60669400\n95037700 337255240",
"output": "1"
},
{
"input": "4 28\n34 1 86 90",
"output": "1"
},
{
"input": "2 1\n5 10",
"output": "2"
},
{
"input": "2 1\n4 1000000000",
"output": "28"
},
{
"input": "2 1\n2 3",
"output": "0"
},
{
"input": "2 1\n3 5",
"output": "1"
},
{
"input": "3 3\n1 5 20",
"output": "1"
},
{
"input": "9 1\n1 2 4 9 15 32 64 128 1024",
"output": "4"
}
] | 1,688,454,421
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 61
| 77
| 0
|
import sys
import math
import collections
from heapq import heappush, heappop
input = sys.stdin.readline
ints = lambda: list(map(int, input().split()))
n, k = ints()
a = ints()
ans = 0
a.sort()
i = 0
while i < n:
if k < a[i]/2:
ans += 1
k = 2 * k
else:
i += 1
k = max(k, a[i-1])
print(ans)
|
Title: Multi-judge Solving
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Makes solves problems on Decoforces and lots of other different online judges. Each problem is denoted by its difficulty — a positive integer number. Difficulties are measured the same across all the judges (the problem with difficulty *d* on Decoforces is as hard as the problem with difficulty *d* on any other judge).
Makes has chosen *n* problems to solve on Decoforces with difficulties *a*1,<=*a*2,<=...,<=*a**n*. He can solve these problems in arbitrary order. Though he can solve problem *i* with difficulty *a**i* only if he had already solved some problem with difficulty (no matter on what online judge was it).
Before starting this chosen list of problems, Makes has already solved problems with maximum difficulty *k*.
With given conditions it's easy to see that Makes sometimes can't solve all the chosen problems, no matter what order he chooses. So he wants to solve some problems on other judges to finish solving problems from his list.
For every positive integer *y* there exist some problem with difficulty *y* on at least one judge besides Decoforces.
Makes can solve problems on any judge at any time, it isn't necessary to do problems from the chosen list one right after another.
Makes doesn't have too much free time, so he asked you to calculate the minimum number of problems he should solve on other judges in order to solve all the chosen problems from Decoforces.
Input Specification:
The first line contains two integer numbers *n*, *k* (1<=≤<=*n*<=≤<=103, 1<=≤<=*k*<=≤<=109).
The second line contains *n* space-separated integer numbers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print minimum number of problems Makes should solve on other judges in order to solve all chosen problems on Decoforces.
Demo Input:
['3 3\n2 1 9\n', '4 20\n10 3 6 3\n']
Demo Output:
['1\n', '0\n']
Note:
In the first example Makes at first solves problems 1 and 2. Then in order to solve the problem with difficulty 9, he should solve problem with difficulty no less than 5. The only available are difficulties 5 and 6 on some other judge. Solving any of these will give Makes opportunity to solve problem 3.
In the second example he can solve every problem right from the start.
|
```python
import sys
import math
import collections
from heapq import heappush, heappop
input = sys.stdin.readline
ints = lambda: list(map(int, input().split()))
n, k = ints()
a = ints()
ans = 0
a.sort()
i = 0
while i < n:
if k < a[i]/2:
ans += 1
k = 2 * k
else:
i += 1
k = max(k, a[i-1])
print(ans)
```
| 3
|
|
888
|
B
|
Buggy Robot
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
Ivan has a robot which is situated on an infinite grid. Initially the robot is standing in the starting cell (0,<=0). The robot can process commands. There are four types of commands it can perform:
- U — move from the cell (*x*,<=*y*) to (*x*,<=*y*<=+<=1); - D — move from (*x*,<=*y*) to (*x*,<=*y*<=-<=1); - L — move from (*x*,<=*y*) to (*x*<=-<=1,<=*y*); - R — move from (*x*,<=*y*) to (*x*<=+<=1,<=*y*).
Ivan entered a sequence of *n* commands, and the robot processed it. After this sequence the robot ended up in the starting cell (0,<=0), but Ivan doubts that the sequence is such that after performing it correctly the robot ends up in the same cell. He thinks that some commands were ignored by robot. To acknowledge whether the robot is severely bugged, he needs to calculate the maximum possible number of commands that were performed correctly. Help Ivan to do the calculations!
|
The first line contains one number *n* — the length of sequence of commands entered by Ivan (1<=≤<=*n*<=≤<=100).
The second line contains the sequence itself — a string consisting of *n* characters. Each character can be U, D, L or R.
|
Print the maximum possible number of commands from the sequence the robot could perform to end up in the starting cell.
|
[
"4\nLDUR\n",
"5\nRRRUU\n",
"6\nLLRRRR\n"
] |
[
"4\n",
"0\n",
"4\n"
] |
none
| 0
|
[
{
"input": "4\nLDUR",
"output": "4"
},
{
"input": "5\nRRRUU",
"output": "0"
},
{
"input": "6\nLLRRRR",
"output": "4"
},
{
"input": "88\nLLUUULRDRRURDDLURRLRDRLLRULRUUDDLLLLRRDDURDURRLDURRLDRRRUULDDLRRRDDRRLUULLURDURUDDDDDLDR",
"output": "76"
},
{
"input": "89\nLDLLLDRDUDURRRRRUDULDDDLLUDLRLRLRLDLDUULRDUDLRRDLUDLURRDDRRDLDUDUUURUUUDRLUDUDLURDLDLLDDU",
"output": "80"
},
{
"input": "90\nRRRDUULLLRDUUDDRLDLRLUDURDRDUUURUURDDRRRURLDDDUUDRLLLULURDRDRURLDRRRRUULDULDDLLLRRLRDLLLLR",
"output": "84"
},
{
"input": "91\nRLDRLRRLLDLULULLURULLRRULUDUULLUDULDUULURUDRUDUURDULDUDDUUUDRRUUDLLRULRULURLDRDLDRURLLLRDDD",
"output": "76"
},
{
"input": "92\nRLRDDLULRLLUURRDDDLDDDLDDUURRRULLRDULDULLLUUULDUDLRLRRDRDRDDULDRLUDRDULDRURUDUULLRDRRLLDRLRR",
"output": "86"
},
{
"input": "93\nRLLURLULRURDDLUURLUDDRDLUURLRDLRRRDUULLRDRRLRLDURRDLLRDDLLLDDDLDRRURLLDRUDULDDRRULRRULRLDRDLR",
"output": "84"
},
{
"input": "94\nRDULDDDLULRDRUDRUUDUUDRRRULDRRUDURUULRDUUDLULLLUDURRDRDLUDRULRRRULUURUDDDDDUDLLRDLDRLLRUUURLUL",
"output": "86"
},
{
"input": "95\nRDLUUULLUURDDRLDLLRRRULRLRDULULRULRUDURLULDDDRLURLDRULDUDUUULLRDDURUULULLDDLDRDRLLLURLRDLLDDDDU",
"output": "86"
},
{
"input": "96\nRDDRLRLLDDULRLRURUDLRLDUDRURLLUUDLLURDLRRUURDRRUDRURLLDLLRDURDURLRLUDURULLLRDUURULUUULRRURRDLURL",
"output": "84"
},
{
"input": "97\nRURDDLRLLRULUDURDLRLLUUDURRLLUDLLLDUDRUULDRUUURURULRDLDRRLLUUUDLLLDDLLLLRLLDUDRRDLLUDLRURUDULRLUR",
"output": "82"
},
{
"input": "98\nRUDURLULLDDLLRDLLRDDLLLLRLDDDDRRRDDRRURLDRLLRUUUDLUUUDDDUDRUURLURUUDUUDRULRRULLRRLRULLULDLUURLULRD",
"output": "92"
},
{
"input": "99\nRRULLDULRRDRULLDUDRUDDDRLLUUDRDDUDURLDDRUUDRRUUURRRURDDLDUURDLRLURRDDLUDDLUDURDRUDDURLURURLRUDRURLD",
"output": "86"
},
{
"input": "100\nUDRLRRLLRRLRRRDDLLDDDLULLDDLURUURUULUDDDRDDLLRDLLUURLRDRLRRLRLLLULDUDDUURRLRDULDRDURRRRRRULDRRDLDRRL",
"output": "88"
},
{
"input": "1\nU",
"output": "0"
},
{
"input": "5\nUUULD",
"output": "2"
},
{
"input": "1\nD",
"output": "0"
},
{
"input": "5\nURLUL",
"output": "2"
},
{
"input": "5\nDDDRU",
"output": "2"
},
{
"input": "2\nLR",
"output": "2"
},
{
"input": "8\nDDRDLDUR",
"output": "4"
},
{
"input": "6\nLLLLUD",
"output": "2"
},
{
"input": "13\nRRRLLLLLLLLLL",
"output": "6"
}
] | 1,628,682,706
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 124
| 22,220,800
|
n = int(input())
Str1 = input()
Arr = [0, 0 ,0, 0]
for I in range(n):
if Str1[l] == 'L': Arr[0] += 1
if Str1[l] == 'R': Arr[1] += 1
if Str1[l] == 'D': Arr[2] += 1
if Str1[l] == 'U': Arr[3] += 1
print (min(Arr[0],Arr[1] ) + min(Arr[2], Arr[3]))
|
Title: Buggy Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivan has a robot which is situated on an infinite grid. Initially the robot is standing in the starting cell (0,<=0). The robot can process commands. There are four types of commands it can perform:
- U — move from the cell (*x*,<=*y*) to (*x*,<=*y*<=+<=1); - D — move from (*x*,<=*y*) to (*x*,<=*y*<=-<=1); - L — move from (*x*,<=*y*) to (*x*<=-<=1,<=*y*); - R — move from (*x*,<=*y*) to (*x*<=+<=1,<=*y*).
Ivan entered a sequence of *n* commands, and the robot processed it. After this sequence the robot ended up in the starting cell (0,<=0), but Ivan doubts that the sequence is such that after performing it correctly the robot ends up in the same cell. He thinks that some commands were ignored by robot. To acknowledge whether the robot is severely bugged, he needs to calculate the maximum possible number of commands that were performed correctly. Help Ivan to do the calculations!
Input Specification:
The first line contains one number *n* — the length of sequence of commands entered by Ivan (1<=≤<=*n*<=≤<=100).
The second line contains the sequence itself — a string consisting of *n* characters. Each character can be U, D, L or R.
Output Specification:
Print the maximum possible number of commands from the sequence the robot could perform to end up in the starting cell.
Demo Input:
['4\nLDUR\n', '5\nRRRUU\n', '6\nLLRRRR\n']
Demo Output:
['4\n', '0\n', '4\n']
Note:
none
|
```python
n = int(input())
Str1 = input()
Arr = [0, 0 ,0, 0]
for I in range(n):
if Str1[l] == 'L': Arr[0] += 1
if Str1[l] == 'R': Arr[1] += 1
if Str1[l] == 'D': Arr[2] += 1
if Str1[l] == 'U': Arr[3] += 1
print (min(Arr[0],Arr[1] ) + min(Arr[2], Arr[3]))
```
| -1
|
|
137
|
B
|
Permutation
|
PROGRAMMING
| 1,000
|
[
"greedy"
] | null | null |
"Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
|
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*).
|
Print the only number — the minimum number of changes needed to get the permutation.
|
[
"3\n3 1 2\n",
"2\n2 2\n",
"5\n5 3 3 3 1\n"
] |
[
"0\n",
"1\n",
"2\n"
] |
The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2.
| 1,000
|
[
{
"input": "3\n3 1 2",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "5\n5 3 3 3 1",
"output": "2"
},
{
"input": "5\n6 6 6 6 6",
"output": "5"
},
{
"input": "10\n1 1 2 2 8 8 7 7 9 9",
"output": "5"
},
{
"input": "8\n9 8 7 6 5 4 3 2",
"output": "1"
},
{
"input": "15\n1 2 3 4 5 5 4 3 2 1 1 2 3 4 5",
"output": "10"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n5000",
"output": "1"
},
{
"input": "4\n5000 5000 5000 5000",
"output": "4"
},
{
"input": "5\n3366 3461 4 5 4370",
"output": "3"
},
{
"input": "10\n8 2 10 3 4 6 1 7 9 5",
"output": "0"
},
{
"input": "10\n551 3192 3213 2846 3068 1224 3447 1 10 9",
"output": "7"
},
{
"input": "15\n4 1459 12 4281 3241 2748 10 3590 14 845 3518 1721 2 2880 1974",
"output": "10"
},
{
"input": "15\n15 1 8 2 13 11 12 7 3 14 6 10 9 4 5",
"output": "0"
},
{
"input": "15\n2436 2354 4259 1210 2037 2665 700 3578 2880 973 1317 1024 24 3621 4142",
"output": "15"
},
{
"input": "30\n28 1 3449 9 3242 4735 26 3472 15 21 2698 7 4073 3190 10 3 29 1301 4526 22 345 3876 19 12 4562 2535 2 630 18 27",
"output": "14"
},
{
"input": "100\n50 39 95 30 66 78 2169 4326 81 31 74 34 80 40 19 48 97 63 82 6 88 16 21 57 92 77 10 1213 17 93 32 91 38 4375 29 75 44 22 4 45 14 2395 3254 59 3379 2 85 96 8 83 27 94 1512 2960 100 9 73 79 7 25 55 69 90 99 51 87 98 62 18 35 43 4376 4668 28 72 56 4070 61 65 36 54 4106 11 24 15 86 70 71 4087 23 13 76 20 4694 26 4962 4726 37 14 64",
"output": "18"
},
{
"input": "100\n340 14 3275 2283 2673 1107 817 2243 1226 32 2382 3638 4652 418 68 4962 387 764 4647 159 1846 225 2760 4904 3150 403 3 2439 91 4428 92 4705 75 348 1566 1465 69 6 49 4 62 4643 564 1090 3447 1871 2255 139 24 99 2669 969 86 61 4550 158 4537 3993 1589 872 2907 1888 401 80 1825 1483 63 1 2264 4068 4113 2548 41 885 4806 36 67 167 4447 34 1248 2593 82 202 81 1783 1284 4973 16 43 95 7 865 2091 3008 1793 20 947 4912 3604",
"output": "70"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "2\n5000 5000",
"output": "2"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 3",
"output": "1"
},
{
"input": "2\n3 4",
"output": "2"
},
{
"input": "10\n1 2 3 4 5 6 7 1000 10 10",
"output": "2"
}
] | 1,441,020,189
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 124
| 409,600
|
N = int(input())
A = list(int(i) for i in input().split())
S = set()
for k in A:
if(1<=k and k<=N):
S.add(k)
print(N-len(S))
|
Title: Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"Hey, it's homework time" — thought Polycarpus and of course he started with his favourite subject, IT. Polycarpus managed to solve all tasks but for the last one in 20 minutes. However, as he failed to solve the last task after some considerable time, the boy asked you to help him.
The sequence of *n* integers is called a permutation if it contains all integers from 1 to *n* exactly once.
You are given an arbitrary sequence *a*1,<=*a*2,<=...,<=*a**n* containing *n* integers. Each integer is not less than 1 and not greater than 5000. Determine what minimum number of elements Polycarpus needs to change to get a permutation (he should not delete or add numbers). In a single change he can modify any single sequence element (i. e. replace it with another integer).
Input Specification:
The first line of the input data contains an integer *n* (1<=≤<=*n*<=≤<=5000) which represents how many numbers are in the sequence. The second line contains a sequence of integers *a**i* (1<=≤<=*a**i*<=≤<=5000,<=1<=≤<=*i*<=≤<=*n*).
Output Specification:
Print the only number — the minimum number of changes needed to get the permutation.
Demo Input:
['3\n3 1 2\n', '2\n2 2\n', '5\n5 3 3 3 1\n']
Demo Output:
['0\n', '1\n', '2\n']
Note:
The first sample contains the permutation, which is why no replacements are required.
In the second sample it is enough to replace the first element with the number 1 and that will make the sequence the needed permutation.
In the third sample we can replace the second element with number 4 and the fourth element with number 2.
|
```python
N = int(input())
A = list(int(i) for i in input().split())
S = set()
for k in A:
if(1<=k and k<=N):
S.add(k)
print(N-len(S))
```
| 3
|
|
965
|
B
|
Battleship
|
PROGRAMMING
| 1,300
|
[
"implementation"
] | null | null |
Arkady is playing Battleship. The rules of this game aren't really important.
There is a field of $n \times n$ cells. There should be exactly one $k$-decker on the field, i. e. a ship that is $k$ cells long oriented either horizontally or vertically. However, Arkady doesn't know where it is located. For each cell Arkady knows if it is definitely empty or can contain a part of the ship.
Consider all possible locations of the ship. Find such a cell that belongs to the maximum possible number of different locations of the ship.
|
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the size of the field and the size of the ship.
The next $n$ lines contain the field. Each line contains $n$ characters, each of which is either '#' (denotes a definitely empty cell) or '.' (denotes a cell that can belong to the ship).
|
Output two integers — the row and the column of a cell that belongs to the maximum possible number of different locations of the ship.
If there are multiple answers, output any of them. In particular, if no ship can be placed on the field, you can output any cell.
|
[
"4 3\n#..#\n#.#.\n....\n.###\n",
"10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#\n",
"19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#\n"
] |
[
"3 2\n",
"6 1\n",
"1 8\n"
] |
The picture below shows the three possible locations of the ship that contain the cell $(3, 2)$ in the first sample.
| 1,000
|
[
{
"input": "4 3\n#..#\n#.#.\n....\n.###",
"output": "3 2"
},
{
"input": "10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#",
"output": "6 1"
},
{
"input": "19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#",
"output": "1 8"
},
{
"input": "10 4\n##..######\n#...######\n#...######\n#......###\n#.......##\n.##.######\n.##.######\n.##.######\n.#....####\n....######",
"output": "4 4"
},
{
"input": "1 1\n.",
"output": "1 1"
},
{
"input": "1 1\n#",
"output": "1 1"
},
{
"input": "5 2\n..##.\n.###.\n#####\n#####\n..#..",
"output": "1 1"
},
{
"input": "5 2\n..##.\n####.\n#####\n.####\n..#..",
"output": "5 1"
},
{
"input": "5 2\n..##.\n####.\n#####\n####.\n..#..",
"output": "5 5"
},
{
"input": "5 2\n.##..\n.###.\n#####\n#####\n..#..",
"output": "1 5"
},
{
"input": "2 2\n##\n##",
"output": "1 1"
},
{
"input": "4 1\n####\n####\n####\n###.",
"output": "4 4"
},
{
"input": "2 2\n#.\n.#",
"output": "1 1"
},
{
"input": "3 3\n###\n##.\n###",
"output": "1 1"
},
{
"input": "4 4\n####\n####\n####\n####",
"output": "1 1"
},
{
"input": "4 3\n####\n####\n####\n####",
"output": "1 1"
},
{
"input": "3 1\n###\n###\n###",
"output": "1 1"
},
{
"input": "3 2\n###\n###\n###",
"output": "1 1"
},
{
"input": "3 3\n.#.\n#.#\n.#.",
"output": "1 1"
}
] | 1,610,976,761
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 12
| 716
| 307,200
|
def battleship(arr,k):
pts=[[0]*len(arr) for i in range(len(arr))]
ans=[0,0]
maxi=0
for i in range(len(arr)):
for j in range(len(arr)):
if arr[i][j]==".":
good=0
count=0
flag=True
s=i
temp=[]
while s >=0 :
if arr[s][j]==".":
temp.append([s,j])
count+=1
s-=1
if count==k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good+=1
break
else:
break
count=0
s=j
temp=[]
while s>=0:
if arr[i][s]==".":
temp.append([i, s])
count += 1
s -= 1
if count == k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good += 1
break
else:
break
count=0
s=i
temp=[]
while s<len(arr):
if arr[s][j]==".":
temp.append([s, j])
count += 1
s += 1
if count == k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good += 1
break
else:
break
count=0
s=j
temp=[]
while s<len(arr):
if arr[i][s]==".":
temp.append([i, s])
count+=1
s+=1
if count == k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good += 1
break
else:
break
print(*ans)
return ""
a,b=map(int,input().strip().split())
blanck=[]
for i in range(a):
blanck.append(input())
print(battleship(blanck,b))
|
Title: Battleship
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arkady is playing Battleship. The rules of this game aren't really important.
There is a field of $n \times n$ cells. There should be exactly one $k$-decker on the field, i. e. a ship that is $k$ cells long oriented either horizontally or vertically. However, Arkady doesn't know where it is located. For each cell Arkady knows if it is definitely empty or can contain a part of the ship.
Consider all possible locations of the ship. Find such a cell that belongs to the maximum possible number of different locations of the ship.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the size of the field and the size of the ship.
The next $n$ lines contain the field. Each line contains $n$ characters, each of which is either '#' (denotes a definitely empty cell) or '.' (denotes a cell that can belong to the ship).
Output Specification:
Output two integers — the row and the column of a cell that belongs to the maximum possible number of different locations of the ship.
If there are multiple answers, output any of them. In particular, if no ship can be placed on the field, you can output any cell.
Demo Input:
['4 3\n#..#\n#.#.\n....\n.###\n', '10 4\n#....##...\n.#...#....\n..#..#..#.\n...#.#....\n.#..##.#..\n.....#...#\n...#.##...\n.#...#.#..\n.....#..#.\n...#.#...#\n', '19 6\n##..............###\n#......#####.....##\n.....#########.....\n....###########....\n...#############...\n..###############..\n.#################.\n.#################.\n.#################.\n.#################.\n#####....##....####\n####............###\n####............###\n#####...####...####\n.#####..####..#####\n...###........###..\n....###########....\n.........##........\n#.................#\n']
Demo Output:
['3 2\n', '6 1\n', '1 8\n']
Note:
The picture below shows the three possible locations of the ship that contain the cell $(3, 2)$ in the first sample.
|
```python
def battleship(arr,k):
pts=[[0]*len(arr) for i in range(len(arr))]
ans=[0,0]
maxi=0
for i in range(len(arr)):
for j in range(len(arr)):
if arr[i][j]==".":
good=0
count=0
flag=True
s=i
temp=[]
while s >=0 :
if arr[s][j]==".":
temp.append([s,j])
count+=1
s-=1
if count==k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good+=1
break
else:
break
count=0
s=j
temp=[]
while s>=0:
if arr[i][s]==".":
temp.append([i, s])
count += 1
s -= 1
if count == k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good += 1
break
else:
break
count=0
s=i
temp=[]
while s<len(arr):
if arr[s][j]==".":
temp.append([s, j])
count += 1
s += 1
if count == k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good += 1
break
else:
break
count=0
s=j
temp=[]
while s<len(arr):
if arr[i][s]==".":
temp.append([i, s])
count+=1
s+=1
if count == k:
for x, y in temp:
pts[x][y] += 1
if pts[x][y]>maxi:
maxi=pts[x][y]
ans=[x+1,y+1]
good += 1
break
else:
break
print(*ans)
return ""
a,b=map(int,input().strip().split())
blanck=[]
for i in range(a):
blanck.append(input())
print(battleship(blanck,b))
```
| 0
|
|
148
|
A
|
Insomnia cure
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"implementation",
"math"
] | null | null |
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
|
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
|
Output the number of damaged dragons.
|
[
"1\n2\n3\n4\n12\n",
"2\n3\n4\n5\n24\n"
] |
[
"12\n",
"17\n"
] |
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
| 1,000
|
[
{
"input": "1\n2\n3\n4\n12",
"output": "12"
},
{
"input": "2\n3\n4\n5\n24",
"output": "17"
},
{
"input": "1\n1\n1\n1\n100000",
"output": "100000"
},
{
"input": "10\n9\n8\n7\n6",
"output": "0"
},
{
"input": "8\n4\n4\n3\n65437",
"output": "32718"
},
{
"input": "8\n4\n1\n10\n59392",
"output": "59392"
},
{
"input": "4\n1\n8\n7\n44835",
"output": "44835"
},
{
"input": "6\n1\n7\n2\n62982",
"output": "62982"
},
{
"input": "2\n7\n4\n9\n56937",
"output": "35246"
},
{
"input": "2\n9\n8\n1\n75083",
"output": "75083"
},
{
"input": "8\n7\n7\n6\n69038",
"output": "24656"
},
{
"input": "4\n4\n2\n3\n54481",
"output": "36320"
},
{
"input": "6\n4\n9\n8\n72628",
"output": "28244"
},
{
"input": "9\n7\n8\n10\n42357",
"output": "16540"
},
{
"input": "5\n6\n4\n3\n60504",
"output": "36302"
},
{
"input": "7\n2\n3\n8\n21754",
"output": "15539"
},
{
"input": "1\n2\n10\n4\n39901",
"output": "39901"
},
{
"input": "3\n4\n7\n1\n58048",
"output": "58048"
},
{
"input": "9\n10\n4\n6\n52003",
"output": "21956"
},
{
"input": "5\n10\n9\n3\n70149",
"output": "32736"
},
{
"input": "5\n5\n5\n10\n55592",
"output": "11118"
},
{
"input": "1\n5\n2\n6\n49547",
"output": "49547"
},
{
"input": "3\n7\n7\n7\n84046",
"output": "36019"
},
{
"input": "10\n2\n1\n8\n63537",
"output": "63537"
},
{
"input": "7\n2\n10\n5\n81684",
"output": "53678"
},
{
"input": "7\n1\n6\n8\n99831",
"output": "99831"
},
{
"input": "3\n9\n3\n3\n61082",
"output": "20360"
},
{
"input": "5\n5\n8\n9\n79228",
"output": "29931"
},
{
"input": "1\n5\n5\n6\n89535",
"output": "89535"
},
{
"input": "5\n5\n2\n1\n7682",
"output": "7682"
},
{
"input": "7\n4\n8\n8\n25829",
"output": "9224"
},
{
"input": "3\n4\n3\n3\n87079",
"output": "43539"
},
{
"input": "5\n8\n4\n9\n5226",
"output": "2438"
},
{
"input": "4\n9\n6\n6\n1070",
"output": "415"
},
{
"input": "10\n10\n10\n10\n100000",
"output": "10000"
},
{
"input": "1\n1\n1\n1\n1",
"output": "1"
},
{
"input": "10\n10\n10\n10\n1",
"output": "0"
},
{
"input": "10\n10\n1\n10\n10",
"output": "10"
},
{
"input": "10\n10\n1\n10\n100",
"output": "100"
},
{
"input": "2\n2\n2\n2\n1",
"output": "0"
}
] | 1,696,432,193
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 122
| 0
|
# -*- coding: utf-8 -*-
"""
Created on Wed Oct 4 21:12:31 2023
@author: 25419
"""
k=int(input())
l=int(input())
m=int(input())
n=int(input())
d=int(input())
sum=0
for i in range(1,d+1):
if i%k!=0 and i%l!=0 and i%m!=0 and i%n!=0:
sum=sum+1
else:pass
print(d-sum)
|
Title: Insomnia cure
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
«One dragon. Two dragon. Three dragon», — the princess was counting. She had trouble falling asleep, and she got bored of counting lambs when she was nine.
However, just counting dragons was boring as well, so she entertained herself at best she could. Tonight she imagined that all dragons were here to steal her, and she was fighting them off. Every *k*-th dragon got punched in the face with a frying pan. Every *l*-th dragon got his tail shut into the balcony door. Every *m*-th dragon got his paws trampled with sharp heels. Finally, she threatened every *n*-th dragon to call her mom, and he withdrew in panic.
How many imaginary dragons suffered moral or physical damage tonight, if the princess counted a total of *d* dragons?
Input Specification:
Input data contains integer numbers *k*,<=*l*,<=*m*,<=*n* and *d*, each number in a separate line (1<=≤<=*k*,<=*l*,<=*m*,<=*n*<=≤<=10, 1<=≤<=*d*<=≤<=105).
Output Specification:
Output the number of damaged dragons.
Demo Input:
['1\n2\n3\n4\n12\n', '2\n3\n4\n5\n24\n']
Demo Output:
['12\n', '17\n']
Note:
In the first case every first dragon got punched with a frying pan. Some of the dragons suffered from other reasons as well, but the pan alone would be enough.
In the second case dragons 1, 7, 11, 13, 17, 19 and 23 escaped unharmed.
|
```python
# -*- coding: utf-8 -*-
"""
Created on Wed Oct 4 21:12:31 2023
@author: 25419
"""
k=int(input())
l=int(input())
m=int(input())
n=int(input())
d=int(input())
sum=0
for i in range(1,d+1):
if i%k!=0 and i%l!=0 and i%m!=0 and i%n!=0:
sum=sum+1
else:pass
print(d-sum)
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,648,288,820
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 62
| 0
|
a=str(input())
s=0
d=0
for i in a:
if i>='A' and i<='Z':
s+=1
else:
d+=1
if d<s:
print(a.upper())
elif d>=s:
print(a.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
a=str(input())
s=0
d=0
for i in a:
if i>='A' and i<='Z':
s+=1
else:
d+=1
if d<s:
print(a.upper())
elif d>=s:
print(a.lower())
```
| 3.9845
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,670,933,390
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 61
| 0
|
newword = ""
uword = input("Input word: ")
if len(uword) > 10:
for x in range(len(uword)):
if uword != "4":
uword.replace(uword[x], "")
uword.split()
newword = f"{uword[0]}{len(uword)-2}{uword[len(uword)-1]}"
else:
newword = "word"
print(newword)
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
newword = ""
uword = input("Input word: ")
if len(uword) > 10:
for x in range(len(uword)):
if uword != "4":
uword.replace(uword[x], "")
uword.split()
newword = f"{uword[0]}{len(uword)-2}{uword[len(uword)-1]}"
else:
newword = "word"
print(newword)
```
| 0
|
672
|
A
|
Summer Camp
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print.
|
Print the *n*-th digit of the line.
|
[
"3\n",
"11\n"
] |
[
"3\n",
"0\n"
] |
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
| 500
|
[
{
"input": "3",
"output": "3"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "29",
"output": "9"
},
{
"input": "30",
"output": "2"
},
{
"input": "1000",
"output": "3"
},
{
"input": "999",
"output": "9"
},
{
"input": "100",
"output": "5"
},
{
"input": "123",
"output": "6"
},
{
"input": "8",
"output": "8"
},
{
"input": "157",
"output": "3"
},
{
"input": "289",
"output": "1"
},
{
"input": "179",
"output": "4"
},
{
"input": "942",
"output": "0"
},
{
"input": "879",
"output": "9"
},
{
"input": "394",
"output": "1"
},
{
"input": "423",
"output": "7"
},
{
"input": "952",
"output": "3"
},
{
"input": "121",
"output": "5"
},
{
"input": "613",
"output": "2"
},
{
"input": "945",
"output": "1"
},
{
"input": "270",
"output": "6"
},
{
"input": "781",
"output": "2"
},
{
"input": "453",
"output": "7"
},
{
"input": "171",
"output": "0"
},
{
"input": "643",
"output": "2"
},
{
"input": "570",
"output": "6"
},
{
"input": "750",
"output": "6"
},
{
"input": "500",
"output": "0"
},
{
"input": "2",
"output": "2"
},
{
"input": "1",
"output": "1"
},
{
"input": "108",
"output": "5"
},
{
"input": "500",
"output": "0"
},
{
"input": "189",
"output": "9"
},
{
"input": "491",
"output": "0"
},
{
"input": "191",
"output": "0"
}
] | 1,660,667,702
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 37
| 46
| 0
|
def l(n):
if(n==0):
return 0
else:
return 1 + l(n//10)
n = int(input())
s = 0
i = 0
while(s < n):
t = l(i)
if(s + t < n):
s += t
i += 1
else:
break
st = str(i)
print(st[(n-s)-1])
|
Title: Summer Camp
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Every year, hundreds of people come to summer camps, they learn new algorithms and solve hard problems.
This is your first year at summer camp, and you are asked to solve the following problem. All integers starting with 1 are written in one line. The prefix of these line is "123456789101112131415...". Your task is to print the *n*-th digit of this string (digits are numbered starting with 1.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the position of the digit you need to print.
Output Specification:
Print the *n*-th digit of the line.
Demo Input:
['3\n', '11\n']
Demo Output:
['3\n', '0\n']
Note:
In the first sample the digit at position 3 is '3', as both integers 1 and 2 consist on one digit.
In the second sample, the digit at position 11 is '0', it belongs to the integer 10.
|
```python
def l(n):
if(n==0):
return 0
else:
return 1 + l(n//10)
n = int(input())
s = 0
i = 0
while(s < n):
t = l(i)
if(s + t < n):
s += t
i += 1
else:
break
st = str(i)
print(st[(n-s)-1])
```
| 3
|
|
166
|
E
|
Tetrahedron
|
PROGRAMMING
| 1,500
|
[
"dp",
"math",
"matrices"
] | null | null |
You are given a tetrahedron. Let's mark its vertices with letters *A*, *B*, *C* and *D* correspondingly.
An ant is standing in the vertex *D* of the tetrahedron. The ant is quite active and he wouldn't stay idle. At each moment of time he makes a step from one vertex to another one along some edge of the tetrahedron. The ant just can't stand on one place.
You do not have to do much to solve the problem: your task is to count the number of ways in which the ant can go from the initial vertex *D* to itself in exactly *n* steps. In other words, you are asked to find out the number of different cyclic paths with the length of *n* from vertex *D* to itself. As the number can be quite large, you should print it modulo 1000000007 (109<=+<=7).
|
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=107) — the required length of the cyclic path.
|
Print the only integer — the required number of ways modulo 1000000007 (109<=+<=7).
|
[
"2\n",
"4\n"
] |
[
"3\n",
"21\n"
] |
The required paths in the first sample are:
- *D* - *A* - *D* - *D* - *B* - *D* - *D* - *C* - *D*
| 1,000
|
[
{
"input": "2",
"output": "3"
},
{
"input": "4",
"output": "21"
},
{
"input": "1",
"output": "0"
},
{
"input": "3",
"output": "6"
},
{
"input": "5",
"output": "60"
},
{
"input": "6",
"output": "183"
},
{
"input": "7",
"output": "546"
},
{
"input": "8",
"output": "1641"
},
{
"input": "9",
"output": "4920"
},
{
"input": "10",
"output": "14763"
},
{
"input": "15",
"output": "3587226"
},
{
"input": "30",
"output": "782663359"
},
{
"input": "10000000",
"output": "192336614"
},
{
"input": "100",
"output": "721510432"
},
{
"input": "300",
"output": "327873818"
},
{
"input": "900",
"output": "295068084"
},
{
"input": "1500",
"output": "451187545"
},
{
"input": "3000",
"output": "645417275"
},
{
"input": "5000",
"output": "755610910"
},
{
"input": "10000",
"output": "723907367"
},
{
"input": "50000",
"output": "969527595"
},
{
"input": "90000",
"output": "548978368"
},
{
"input": "99999",
"output": "909741855"
},
{
"input": "100000",
"output": "729225554"
},
{
"input": "300000",
"output": "93822635"
},
{
"input": "800000",
"output": "178940616"
},
{
"input": "1000000",
"output": "266233856"
},
{
"input": "4000000",
"output": "882155933"
},
{
"input": "9000000",
"output": "295060537"
},
{
"input": "9999999",
"output": "730778875"
},
{
"input": "1000000",
"output": "266233856"
},
{
"input": "9999999",
"output": "730778875"
},
{
"input": "10000000",
"output": "192336614"
},
{
"input": "9999998",
"output": "576926295"
},
{
"input": "30",
"output": "782663359"
},
{
"input": "31",
"output": "347990060"
}
] | 1,658,476,782
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 12
| 2,000
| 716,800
|
from operator import itemgetter
from typing import *
from collections import deque, Counter, defaultdict
from bisect import *
import heapq, math
from functools import cmp_to_key, reduce
# from sortedcontainers import SortedSet
def main():
n = int(input())
mod = int(1e9 + 7)
def get_bn(x):
if x == 0:
return 0
elif x == 1:
return 1
else:
a, b = 1, 0
for _ in range(x - 1):
tmp = a
a = (2 * a + 3 * b) % mod
b = tmp
return a
print((get_bn(n) + (1 if n % 2 == 0 else -1) + mod) % mod)
main()
|
Title: Tetrahedron
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a tetrahedron. Let's mark its vertices with letters *A*, *B*, *C* and *D* correspondingly.
An ant is standing in the vertex *D* of the tetrahedron. The ant is quite active and he wouldn't stay idle. At each moment of time he makes a step from one vertex to another one along some edge of the tetrahedron. The ant just can't stand on one place.
You do not have to do much to solve the problem: your task is to count the number of ways in which the ant can go from the initial vertex *D* to itself in exactly *n* steps. In other words, you are asked to find out the number of different cyclic paths with the length of *n* from vertex *D* to itself. As the number can be quite large, you should print it modulo 1000000007 (109<=+<=7).
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=107) — the required length of the cyclic path.
Output Specification:
Print the only integer — the required number of ways modulo 1000000007 (109<=+<=7).
Demo Input:
['2\n', '4\n']
Demo Output:
['3\n', '21\n']
Note:
The required paths in the first sample are:
- *D* - *A* - *D* - *D* - *B* - *D* - *D* - *C* - *D*
|
```python
from operator import itemgetter
from typing import *
from collections import deque, Counter, defaultdict
from bisect import *
import heapq, math
from functools import cmp_to_key, reduce
# from sortedcontainers import SortedSet
def main():
n = int(input())
mod = int(1e9 + 7)
def get_bn(x):
if x == 0:
return 0
elif x == 1:
return 1
else:
a, b = 1, 0
for _ in range(x - 1):
tmp = a
a = (2 * a + 3 * b) % mod
b = tmp
return a
print((get_bn(n) + (1 if n % 2 == 0 else -1) + mod) % mod)
main()
```
| 0
|
|
493
|
B
|
Vasya and Wrestling
|
PROGRAMMING
| 1,400
|
[
"implementation"
] | null | null |
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
|
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
|
If the first wrestler wins, print string "first", otherwise print "second"
|
[
"5\n1\n2\n-3\n-4\n3\n",
"3\n-1\n-2\n3\n",
"2\n4\n-4\n"
] |
[
"second\n",
"first\n",
"second\n"
] |
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*.
| 1,000
|
[
{
"input": "5\n1\n2\n-3\n-4\n3",
"output": "second"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "2\n4\n-4",
"output": "second"
},
{
"input": "7\n1\n2\n-3\n4\n5\n-6\n7",
"output": "first"
},
{
"input": "14\n1\n2\n3\n4\n5\n6\n7\n-8\n-9\n-10\n-11\n-12\n-13\n-14",
"output": "second"
},
{
"input": "4\n16\n12\n19\n-98",
"output": "second"
},
{
"input": "5\n-6\n-1\n-1\n5\n3",
"output": "second"
},
{
"input": "11\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1",
"output": "first"
},
{
"input": "1\n-534365",
"output": "second"
},
{
"input": "1\n10253033",
"output": "first"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "8\n1\n-2\n-3\n4\n5\n-6\n-7\n8",
"output": "second"
},
{
"input": "2\n1\n-1",
"output": "second"
},
{
"input": "5\n1\n2\n3\n4\n5",
"output": "first"
},
{
"input": "5\n-1\n-2\n-3\n-4\n-5",
"output": "second"
},
{
"input": "10\n-1\n-2\n-3\n-4\n-5\n5\n4\n3\n2\n1",
"output": "first"
},
{
"input": "131\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n-1\n-1\n2",
"output": "first"
},
{
"input": "6\n-1\n-2\n-3\n1\n2\n3",
"output": "first"
},
{
"input": "3\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "12\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-1000000000",
"output": "first"
},
{
"input": "20\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "5\n1000000000\n1000000000\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "4\n1\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "5\n1000000000\n1000000000\n1000000000\n-1000000000\n-1000000000",
"output": "first"
},
{
"input": "4\n-1\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "11\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "2\n-4\n4",
"output": "first"
},
{
"input": "3\n-12\n3\n9",
"output": "second"
},
{
"input": "3\n9\n1\n-10",
"output": "second"
},
{
"input": "3\n1\n2\n-3",
"output": "second"
},
{
"input": "4\n55\n5\n-5\n-55",
"output": "first"
},
{
"input": "4\n5\n-1\n1\n-5",
"output": "first"
},
{
"input": "2\n-5\n6",
"output": "first"
},
{
"input": "4\n5\n-4\n3\n-40",
"output": "second"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-5",
"output": "first"
},
{
"input": "6\n3\n2\n1\n-3\n-1\n-2",
"output": "first"
},
{
"input": "5\n4\n1\n1\n-3\n-3",
"output": "first"
},
{
"input": "5\n208\n-52\n-52\n-52\n-52",
"output": "first"
},
{
"input": "3\n-100\n-200\n300",
"output": "first"
},
{
"input": "3\n400\n-200\n-200",
"output": "first"
},
{
"input": "3\n208\n-207\n-1",
"output": "first"
},
{
"input": "3\n98888887\n98888888\n-197777775",
"output": "second"
}
] | 1,530,332,027
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 37
| 686
| 3,788,800
|
n = int(input())
a = 0
a1 = ""
b = 0
b1 = ""
last = 0
for i in range(n):
k = int(input())
if k > 0:
last = 1
a += k
a1 = a1 + str(k)
elif k < 0:
last = 2
k = -k
b += k
b1 = b1 + str(k)
if a > b:
print("first")
elif b > a:
print("second")
else:
if a1 > b1:
print("first")
elif b1 > a1:
print("second")
else:
if last == 1:
print("first")
else:
print("second")
|
Title: Vasya and Wrestling
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
Input Specification:
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
Output Specification:
If the first wrestler wins, print string "first", otherwise print "second"
Demo Input:
['5\n1\n2\n-3\n-4\n3\n', '3\n-1\n-2\n3\n', '2\n4\n-4\n']
Demo Output:
['second\n', 'first\n', 'second\n']
Note:
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*.
|
```python
n = int(input())
a = 0
a1 = ""
b = 0
b1 = ""
last = 0
for i in range(n):
k = int(input())
if k > 0:
last = 1
a += k
a1 = a1 + str(k)
elif k < 0:
last = 2
k = -k
b += k
b1 = b1 + str(k)
if a > b:
print("first")
elif b > a:
print("second")
else:
if a1 > b1:
print("first")
elif b1 > a1:
print("second")
else:
if last == 1:
print("first")
else:
print("second")
```
| 0
|
|
384
|
A
|
Coder
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
|
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
|
[
"2\n"
] |
[
"2\nC.\n.C\n"
] |
none
| 500
|
[
{
"input": "2",
"output": "2\nC.\n.C"
},
{
"input": "3",
"output": "5\nC.C\n.C.\nC.C"
},
{
"input": "4",
"output": "8\nC.C.\n.C.C\nC.C.\n.C.C"
},
{
"input": "10",
"output": "50\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C\nC.C.C.C.C.\n.C.C.C.C.C"
},
{
"input": "15",
"output": "113\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C"
},
{
"input": "100",
"output": "5000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "101",
"output": "5101\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "500",
"output": "125000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.\n...."
},
{
"input": "501",
"output": "125501\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C\n..."
},
{
"input": "755",
"output": "285013\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "888",
"output": "394272\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "998",
"output": "498002\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "999",
"output": "499001\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1000",
"output": "500000\nC.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C.C..."
},
{
"input": "1",
"output": "1\nC"
}
] | 1,514,012,104
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 15
| 545
| 6,963,200
|
n = int(input())
d = []
for k in range(n):
if k % 2 == 0:
w = 'C'
else:
w = '.'
while True:
if len(w) == n:
break
else:
if w[-1] == '.':
w += 'C'
else:
w += '.'
d.append(w)
print(int(((n*n+1)/2)//1))
for k in d:
print(k)
|
Title: Coder
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub likes chess very much. He even invented a new chess piece named Coder. A Coder can move (and attack) one square horizontally or vertically. More precisely, if the Coder is located at position (*x*,<=*y*), he can move to (or attack) positions (*x*<=+<=1,<=*y*), (*x*–1,<=*y*), (*x*,<=*y*<=+<=1) and (*x*,<=*y*–1).
Iahub wants to know how many Coders can be placed on an *n*<=×<=*n* chessboard, so that no Coder attacks any other Coder.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000).
Output Specification:
On the first line print an integer, the maximum number of Coders that can be placed on the chessboard.
On each of the next *n* lines print *n* characters, describing the configuration of the Coders. For an empty cell print an '.', and for a Coder print a 'C'.
If there are multiple correct answers, you can print any.
Demo Input:
['2\n']
Demo Output:
['2\nC.\n.C\n']
Note:
none
|
```python
n = int(input())
d = []
for k in range(n):
if k % 2 == 0:
w = 'C'
else:
w = '.'
while True:
if len(w) == n:
break
else:
if w[-1] == '.':
w += 'C'
else:
w += '.'
d.append(w)
print(int(((n*n+1)/2)//1))
for k in d:
print(k)
```
| 3
|
|
340
|
A
|
The Wall
|
PROGRAMMING
| 1,200
|
[
"math"
] | null | null |
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on.
Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink.
After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
|
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
|
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
|
[
"2 3 6 18\n"
] |
[
"3"
] |
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
| 500
|
[
{
"input": "2 3 6 18",
"output": "3"
},
{
"input": "4 6 20 201",
"output": "15"
},
{
"input": "15 27 100 10000",
"output": "74"
},
{
"input": "105 60 3456 78910",
"output": "179"
},
{
"input": "1 1 1000 100000",
"output": "99001"
},
{
"input": "3 2 5 5",
"output": "0"
},
{
"input": "555 777 1 1000000",
"output": "257"
},
{
"input": "1000 1000 1 32323",
"output": "32"
},
{
"input": "45 125 93451125 100000000",
"output": "5821"
},
{
"input": "101 171 1 1000000000",
"output": "57900"
},
{
"input": "165 255 69696 1000000000",
"output": "356482"
},
{
"input": "555 777 666013 1000000000",
"output": "257229"
},
{
"input": "23 46 123321 900000000",
"output": "19562537"
},
{
"input": "321 123 15 1000000",
"output": "75"
},
{
"input": "819 1000 9532 152901000",
"output": "186"
},
{
"input": "819 1000 10000 1000000",
"output": "1"
},
{
"input": "1 1 1 1",
"output": "1"
},
{
"input": "1 2 2 1000003",
"output": "500001"
},
{
"input": "1 1 1 1000000000",
"output": "1000000000"
},
{
"input": "10 15 69 195610342",
"output": "6520342"
},
{
"input": "2 1 1 1000000000",
"output": "500000000"
},
{
"input": "1000 1000 1 20",
"output": "0"
},
{
"input": "1 1 1 2000000000",
"output": "2000000000"
},
{
"input": "1 2 1 2000000000",
"output": "1000000000"
},
{
"input": "2 1 1 2000000000",
"output": "1000000000"
},
{
"input": "2 3 1 1000000000",
"output": "166666666"
},
{
"input": "2 3 1 2000000000",
"output": "333333333"
},
{
"input": "3 7 1 1000000000",
"output": "47619047"
},
{
"input": "1 1 1000000000 2000000000",
"output": "1000000001"
},
{
"input": "2 2 1 2000000000",
"output": "1000000000"
},
{
"input": "1 1 2 2000000000",
"output": "1999999999"
},
{
"input": "3 2 1 2000000000",
"output": "333333333"
},
{
"input": "1 1 2000000000 2000000000",
"output": "1"
},
{
"input": "2 3 7 7",
"output": "0"
},
{
"input": "3 3 3 7",
"output": "2"
}
] | 1,527,074,476
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 8
| 1,000
| 307,200
|
x, y, a, b = list(map(int,input().split()))
count = 0
for i in range(a,b+1):
if (i)%x==0 and (i)%y ==0:
count += 1
print(count)
|
Title: The Wall
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub and his friend Floyd have started painting a wall. Iahub is painting the wall red and Floyd is painting it pink. You can consider the wall being made of a very large number of bricks, numbered 1, 2, 3 and so on.
Iahub has the following scheme of painting: he skips *x*<=-<=1 consecutive bricks, then he paints the *x*-th one. That is, he'll paint bricks *x*, 2·*x*, 3·*x* and so on red. Similarly, Floyd skips *y*<=-<=1 consecutive bricks, then he paints the *y*-th one. Hence he'll paint bricks *y*, 2·*y*, 3·*y* and so on pink.
After painting the wall all day, the boys observed that some bricks are painted both red and pink. Iahub has a lucky number *a* and Floyd has a lucky number *b*. Boys wonder how many bricks numbered no less than *a* and no greater than *b* are painted both red and pink. This is exactly your task: compute and print the answer to the question.
Input Specification:
The input will have a single line containing four integers in this order: *x*, *y*, *a*, *b*. (1<=≤<=*x*,<=*y*<=≤<=1000, 1<=≤<=*a*,<=*b*<=≤<=2·109, *a*<=≤<=*b*).
Output Specification:
Output a single integer — the number of bricks numbered no less than *a* and no greater than *b* that are painted both red and pink.
Demo Input:
['2 3 6 18\n']
Demo Output:
['3']
Note:
Let's look at the bricks from *a* to *b* (*a* = 6, *b* = 18). The bricks colored in red are numbered 6, 8, 10, 12, 14, 16, 18. The bricks colored in pink are numbered 6, 9, 12, 15, 18. The bricks colored in both red and pink are numbered with 6, 12 and 18.
|
```python
x, y, a, b = list(map(int,input().split()))
count = 0
for i in range(a,b+1):
if (i)%x==0 and (i)%y ==0:
count += 1
print(count)
```
| 0
|
|
519
|
B
|
A and B and Compilation Errors
|
PROGRAMMING
| 1,100
|
[
"data structures",
"implementation",
"sortings"
] | null | null |
A and B are preparing themselves for programming contests.
B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code.
Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake.
However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change.
Can you help B find out exactly what two errors he corrected?
|
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time.
The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one.
The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one.
|
Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively.
|
[
"5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n",
"6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n"
] |
[
"8\n123\n",
"1\n3\n"
] |
In the first test sample B first corrects the error number 8, then the error number 123.
In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
| 1,000
|
[
{
"input": "5\n1 5 8 123 7\n123 7 5 1\n5 1 7",
"output": "8\n123"
},
{
"input": "6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5",
"output": "1\n3"
},
{
"input": "3\n1 2 3\n3 2\n2",
"output": "1\n3"
},
{
"input": "10\n460626451 802090732 277246428 661369649 388684428 784303821 376287098 656422756 9301599 25720377\n277246428 388684428 661369649 460626451 656422756 802090732 9301599 784303821 376287098\n376287098 802090732 388684428 9301599 656422756 784303821 460626451 277246428",
"output": "25720377\n661369649"
},
{
"input": "3\n796067435 964699482 819602309\n964699482 796067435\n964699482",
"output": "819602309\n796067435"
},
{
"input": "3\n374054998 726316780 902899520\n902899520 726316780\n726316780",
"output": "374054998\n902899520"
},
{
"input": "3\n168638990 939116221 323703261\n168638990 323703261\n168638990",
"output": "939116221\n323703261"
},
{
"input": "3\n77 77 77\n77 77\n77",
"output": "77\n77"
},
{
"input": "3\n84 30 9\n9 84\n9",
"output": "30\n84"
},
{
"input": "6\n5 4 3 3 5 5\n3 5 5 4 3\n3 5 4 3",
"output": "5\n5"
},
{
"input": "4\n1 5 7 8\n1 5 7\n1 5",
"output": "8\n7"
}
] | 1,626,351,342
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 33
| 373
| 34,611,200
|
#BOILER CODE ....
map_inputs = lambda Type=int : map(Type,input().strip().split())
array_input = lambda n,Type=int : list(map_inputs(Type)) [:n]
matrix_input = lambda row,col,Type=int: [array_input(col,Type) for _ in range(row)]
str_matrix = lambda row,col: [input().strip()[:col] for _ in range(row)]
str_listed_matrix = lambda row,col:[list(input().strip())[:col] for _ in range(row)]
test_cases = lambda t=1: [i for i in range(t)]
#MAIN CODE
def main():
n = int(input())
a = array_input(n)
c_sum = sum(a)
for i in range(1,3):
temp = array_input(n-i)
sums = sum(temp)
print(c_sum-sums)
c_sum = sums
if __name__ == '__main__':
for test in test_cases():
main()
|
Title: A and B and Compilation Errors
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A and B are preparing themselves for programming contests.
B loves to debug his code. But before he runs the solution and starts debugging, he has to first compile the code.
Initially, the compiler displayed *n* compilation errors, each of them is represented as a positive integer. After some effort, B managed to fix some mistake and then another one mistake.
However, despite the fact that B is sure that he corrected the two errors, he can not understand exactly what compilation errors disappeared — the compiler of the language which B uses shows errors in the new order every time! B is sure that unlike many other programming languages, compilation errors for his programming language do not depend on each other, that is, if you correct one error, the set of other error does not change.
Can you help B find out exactly what two errors he corrected?
Input Specification:
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=105) — the initial number of compilation errors.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the errors the compiler displayed for the first time.
The third line contains *n*<=-<=1 space-separated integers *b*1,<=*b*2,<=...,<=*b**n*<=-<=1 — the errors displayed at the second compilation. It is guaranteed that the sequence in the third line contains all numbers of the second string except for exactly one.
The fourth line contains *n*<=-<=2 space-separated integers *с*1,<=*с*2,<=...,<=*с**n*<=-<=2 — the errors displayed at the third compilation. It is guaranteed that the sequence in the fourth line contains all numbers of the third line except for exactly one.
Output Specification:
Print two numbers on a single line: the numbers of the compilation errors that disappeared after B made the first and the second correction, respectively.
Demo Input:
['5\n1 5 8 123 7\n123 7 5 1\n5 1 7\n', '6\n1 4 3 3 5 7\n3 7 5 4 3\n4 3 7 5\n']
Demo Output:
['8\n123\n', '1\n3\n']
Note:
In the first test sample B first corrects the error number 8, then the error number 123.
In the second test sample B first corrects the error number 1, then the error number 3. Note that if there are multiple errors with the same number, B can correct only one of them in one step.
|
```python
#BOILER CODE ....
map_inputs = lambda Type=int : map(Type,input().strip().split())
array_input = lambda n,Type=int : list(map_inputs(Type)) [:n]
matrix_input = lambda row,col,Type=int: [array_input(col,Type) for _ in range(row)]
str_matrix = lambda row,col: [input().strip()[:col] for _ in range(row)]
str_listed_matrix = lambda row,col:[list(input().strip())[:col] for _ in range(row)]
test_cases = lambda t=1: [i for i in range(t)]
#MAIN CODE
def main():
n = int(input())
a = array_input(n)
c_sum = sum(a)
for i in range(1,3):
temp = array_input(n-i)
sums = sum(temp)
print(c_sum-sums)
c_sum = sums
if __name__ == '__main__':
for test in test_cases():
main()
```
| 3
|
|
59
|
A
|
Word
|
PROGRAMMING
| 800
|
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500
|
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,619,348,195
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 124
| 0
|
n = input()
up = 0
low = 0
for i in n:
if i.isupper():
up += 1
else:
low += 1
if up > low:
print(n.upper())
elif low > up:
print(n.lower())
else:
print(n.lower())
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
n = input()
up = 0
low = 0
for i in n:
if i.isupper():
up += 1
else:
low += 1
if up > low:
print(n.upper())
elif low > up:
print(n.lower())
else:
print(n.lower())
```
| 3.969
|
66
|
B
|
Petya and Countryside
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] |
B. Petya and Countryside
|
2
|
256
|
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
|
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
|
[
"1\n2\n",
"5\n1 2 1 2 1\n",
"8\n1 2 1 1 1 3 3 4\n"
] |
[
"1\n",
"3\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 2 1 2 1",
"output": "3"
},
{
"input": "8\n1 2 1 1 1 3 3 4",
"output": "6"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "10"
},
{
"input": "2\n100 100",
"output": "2"
},
{
"input": "3\n100 100 100",
"output": "3"
},
{
"input": "11\n1 2 3 4 5 6 5 4 3 2 1",
"output": "11"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 100 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 1 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 1 82 83 84 85 86 87 88 89 90 91 92 93 94 100 5 4 3 2 1",
"output": "81"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 1 86 87 88 89 90 91 92 93 100 6 5 4 3 2 1",
"output": "85"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 1 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 100 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 100 8 7 6 1 4 3 2 1",
"output": "96"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 100 10 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 1 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 100 11 10 9 8 7 6 5 4 3 2 1",
"output": "55"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 1 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 100 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "59"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 100 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "86"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 100 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "83"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 100 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 1 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "74"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 100 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 100 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 1 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "52"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 100 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 1 2 1",
"output": "98"
},
{
"input": "10\n1 4 4 4 4 4 1 2 4 3",
"output": "7"
}
] | 1,552,378,951
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 80
| 1,372
| 512,000
|
n = int(input())
s = list(map(int, input().split()))
c = 1
d = 0
z = list()
for i in range(n):
for k in range(len(s[i:n])):
if k + i == n - 1:
break
if s[k+i] >= s[k + i + 1]:
c += 1
else:
break
for j in range(len(s[0:i+1])):
if j - i == 0:
break
if s[i-j] >= s[i-j-1]:
d += 1
else:
break
z.append(c+d)
c = 1
d = 0
print(max(z))
|
Title: Petya and Countryside
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
Output Specification:
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
Demo Input:
['1\n2\n', '5\n1 2 1 2 1\n', '8\n1 2 1 1 1 3 3 4\n']
Demo Output:
['1\n', '3\n', '6\n']
Note:
none
|
```python
n = int(input())
s = list(map(int, input().split()))
c = 1
d = 0
z = list()
for i in range(n):
for k in range(len(s[i:n])):
if k + i == n - 1:
break
if s[k+i] >= s[k + i + 1]:
c += 1
else:
break
for j in range(len(s[0:i+1])):
if j - i == 0:
break
if s[i-j] >= s[i-j-1]:
d += 1
else:
break
z.append(c+d)
c = 1
d = 0
print(max(z))
```
| 3.656046
|
899
|
B
|
Months and Years
|
PROGRAMMING
| 1,200
|
[
"implementation"
] | null | null |
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
|
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
|
[
"4\n31 31 30 31\n",
"2\n30 30\n",
"5\n29 31 30 31 30\n",
"3\n31 28 30\n",
"3\n31 31 28\n"
] |
[
"Yes\n\n",
"No\n\n",
"Yes\n\n",
"No\n\n",
"Yes\n\n"
] |
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
| 1,000
|
[
{
"input": "4\n31 31 30 31",
"output": "Yes"
},
{
"input": "2\n30 30",
"output": "No"
},
{
"input": "5\n29 31 30 31 30",
"output": "Yes"
},
{
"input": "3\n31 28 30",
"output": "No"
},
{
"input": "3\n31 31 28",
"output": "Yes"
},
{
"input": "24\n29 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "4\n31 29 31 30",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "8\n31 29 31 30 31 31 31 31",
"output": "No"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31",
"output": "Yes"
},
{
"input": "4\n31 28 28 30",
"output": "No"
},
{
"input": "2\n30 31",
"output": "Yes"
},
{
"input": "7\n28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n28 31 30 31",
"output": "Yes"
},
{
"input": "17\n28 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "9\n31 31 29 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "4\n31 28 31 30",
"output": "Yes"
},
{
"input": "21\n30 31 30 31 31 28 31 30 31 30 31 29 30 31 30 31 31 28 31 30 31",
"output": "No"
},
{
"input": "2\n31 31",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "4\n30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "11\n30 31 30 31 31 30 31 30 31 29 28",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 31 30",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 31 30 31 30 31 31 30",
"output": "Yes"
},
{
"input": "4\n31 29 29 30",
"output": "No"
},
{
"input": "7\n28 28 30 31 30 31 31",
"output": "No"
},
{
"input": "9\n29 31 29 31 30 31 30 31 31",
"output": "No"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "2\n31 29",
"output": "Yes"
},
{
"input": "12\n31 28 31 30 31 30 31 31 30 31 28 31",
"output": "No"
},
{
"input": "2\n29 31",
"output": "Yes"
},
{
"input": "12\n31 29 31 30 31 30 31 30 30 31 30 31",
"output": "No"
},
{
"input": "12\n31 28 31 30 31 29 31 31 30 31 30 31",
"output": "No"
},
{
"input": "22\n31 30 31 30 31 31 30 31 30 31 31 28 31 30 28 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "14\n31 30 31 31 28 31 30 31 30 31 31 30 29 30",
"output": "No"
},
{
"input": "19\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31",
"output": "Yes"
},
{
"input": "20\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "1\n28",
"output": "Yes"
},
{
"input": "1\n29",
"output": "Yes"
},
{
"input": "17\n31 30 31 30 31 31 29 31 30 31 31 31 31 30 31 30 31",
"output": "No"
},
{
"input": "1\n30",
"output": "Yes"
},
{
"input": "1\n31",
"output": "Yes"
},
{
"input": "24\n31 28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "12\n31 30 31 31 28 28 30 31 30 31 31 30",
"output": "No"
},
{
"input": "24\n29 31 30 31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n28 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31 31",
"output": "Yes"
},
{
"input": "24\n31 29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "13\n28 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "15\n31 31 28 31 30 31 30 31 31 30 31 30 31 31 29",
"output": "Yes"
},
{
"input": "23\n31 30 31 31 30 31 30 31 31 28 31 30 31 30 31 31 30 31 30 31 31 29 31",
"output": "Yes"
},
{
"input": "24\n31 30 31 30 31 31 30 31 30 31 31 30 31 30 31 30 31 31 30 31 30 31 31 30",
"output": "No"
},
{
"input": "23\n29 31 30 31 30 31 31 30 31 30 31 31 29 31 30 31 30 31 31 30 31 30 31",
"output": "No"
},
{
"input": "15\n31 31 29 31 30 31 30 31 31 30 31 30 31 31 28",
"output": "Yes"
},
{
"input": "12\n31 30 31 30 31 30 31 31 30 31 30 31",
"output": "No"
}
] | 1,513,541,597
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 13
| 62
| 5,529,600
|
def solution():
normal_year=[31,29,31,30,31,30,31,31,30,31,30,31]
leap_year=[31,28,31,30,31,30,31,31,30,31,30,31]
a=normal_year *2
b=leap_year *2
c=normal_year +leap_year
d=leap_year + normal_year
#f=open('input.txt', 'r')
n=int(input().strip())
inp=[int(a) for a in input().strip().split(' ')]
for k in range(25-n):
if inp == a[k:k+n] or inp == b[k:k+n] or inp== c[k:k+n] or inp == d[k:k+n]:
print('YES')
return
print("NO")
return
solution()
|
Title: Months and Years
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody in Russia uses Gregorian calendar. In this calendar there are 31 days in January, 28 or 29 days in February (depending on whether the year is leap or not), 31 days in March, 30 days in April, 31 days in May, 30 in June, 31 in July, 31 in August, 30 in September, 31 in October, 30 in November, 31 in December.
A year is leap in one of two cases: either its number is divisible by 4, but not divisible by 100, or is divisible by 400. For example, the following years are leap: 2000, 2004, but years 1900 and 2018 are not leap.
In this problem you are given *n* (1<=≤<=*n*<=≤<=24) integers *a*1,<=*a*2,<=...,<=*a**n*, and you have to check if these integers could be durations in days of *n* consecutive months, according to Gregorian calendar. Note that these months could belong to several consecutive years. In other words, check if there is a month in some year, such that its duration is *a*1 days, duration of the next month is *a*2 days, and so on.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=24) — the number of integers.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (28<=≤<=*a**i*<=≤<=31) — the numbers you are to check.
Output Specification:
If there are several consecutive months that fit the sequence, print "YES" (without quotes). Otherwise, print "NO" (without quotes).
You can print each letter in arbitrary case (small or large).
Demo Input:
['4\n31 31 30 31\n', '2\n30 30\n', '5\n29 31 30 31 30\n', '3\n31 28 30\n', '3\n31 31 28\n']
Demo Output:
['Yes\n\n', 'No\n\n', 'Yes\n\n', 'No\n\n', 'Yes\n\n']
Note:
In the first example the integers can denote months July, August, September and October.
In the second example the answer is no, because there are no two consecutive months each having 30 days.
In the third example the months are: February (leap year) — March — April – May — June.
In the fourth example the number of days in the second month is 28, so this is February. March follows February and has 31 days, but not 30, so the answer is NO.
In the fifth example the months are: December — January — February (non-leap year).
|
```python
def solution():
normal_year=[31,29,31,30,31,30,31,31,30,31,30,31]
leap_year=[31,28,31,30,31,30,31,31,30,31,30,31]
a=normal_year *2
b=leap_year *2
c=normal_year +leap_year
d=leap_year + normal_year
#f=open('input.txt', 'r')
n=int(input().strip())
inp=[int(a) for a in input().strip().split(' ')]
for k in range(25-n):
if inp == a[k:k+n] or inp == b[k:k+n] or inp== c[k:k+n] or inp == d[k:k+n]:
print('YES')
return
print("NO")
return
solution()
```
| 0
|
|
712
|
A
|
Memory and Crow
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
There are *n* integers *b*1,<=*b*2,<=...,<=*b**n* written in a row. For all *i* from 1 to *n*, values *a**i* are defined by the crows performing the following procedure:
- The crow sets *a**i* initially 0. - The crow then adds *b**i* to *a**i*, subtracts *b**i*<=+<=1, adds the *b**i*<=+<=2 number, and so on until the *n*'th number. Thus, *a**i*<==<=*b**i*<=-<=*b**i*<=+<=1<=+<=*b**i*<=+<=2<=-<=*b**i*<=+<=3....
Memory gives you the values *a*1,<=*a*2,<=...,<=*a**n*, and he now wants you to find the initial numbers *b*1,<=*b*2,<=...,<=*b**n* written in the row? Can you do it?
|
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of integers written in the row.
The next line contains *n*, the *i*'th of which is *a**i* (<=-<=109<=≤<=*a**i*<=≤<=109) — the value of the *i*'th number.
|
Print *n* integers corresponding to the sequence *b*1,<=*b*2,<=...,<=*b**n*. It's guaranteed that the answer is unique and fits in 32-bit integer type.
|
[
"5\n6 -4 8 -2 3\n",
"5\n3 -2 -1 5 6\n"
] |
[
"2 4 6 1 3 \n",
"1 -3 4 11 6 \n"
] |
In the first sample test, the crows report the numbers 6, - 4, 8, - 2, and 3 when he starts at indices 1, 2, 3, 4 and 5 respectively. It is easy to check that the sequence 2 4 6 1 3 satisfies the reports. For example, 6 = 2 - 4 + 6 - 1 + 3, and - 4 = 4 - 6 + 1 - 3.
In the second sample test, the sequence 1, - 3, 4, 11, 6 satisfies the reports. For example, 5 = 11 - 6 and 6 = 6.
| 500
|
[
{
"input": "5\n6 -4 8 -2 3",
"output": "2 4 6 1 3 "
},
{
"input": "5\n3 -2 -1 5 6",
"output": "1 -3 4 11 6 "
},
{
"input": "10\n13 -2 532 -63 -23 -63 -64 -23 12 10",
"output": "11 530 469 -86 -86 -127 -87 -11 22 10 "
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 0 0 0 "
},
{
"input": "10\n1 -1 1 -1 1 -1 1 -1 1 -1",
"output": "0 0 0 0 0 0 0 0 0 -1 "
},
{
"input": "10\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000 -1000000000 1000000000",
"output": "0 0 0 0 0 0 0 0 0 1000000000 "
},
{
"input": "10\n124 532 -642 6482 -124 952 -235 7594 34 -12",
"output": "656 -110 5840 6358 828 717 7359 7628 22 -12 "
},
{
"input": "10\n1294 35852 32749 537295 12048 53729 29357 58320 64739 1240",
"output": "37146 68601 570044 549343 65777 83086 87677 123059 65979 1240 "
}
] | 1,473,527,794
| 1,894
|
Python 3
|
OK
|
TESTS
| 49
| 296
| 8,192,000
|
n = int(input())
arr = [int(x) for x in input().split()]
brr = [arr[n-1]]
for i in range(n-2,-1,-1):
x = +arr[i+1]+arr[i]
brr.append(x)
crr = brr[::-1]
s = str(crr[0])
for i in range(1,n):
s += ' '+str(crr[i])
print(s)
|
Title: Memory and Crow
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* integers *b*1,<=*b*2,<=...,<=*b**n* written in a row. For all *i* from 1 to *n*, values *a**i* are defined by the crows performing the following procedure:
- The crow sets *a**i* initially 0. - The crow then adds *b**i* to *a**i*, subtracts *b**i*<=+<=1, adds the *b**i*<=+<=2 number, and so on until the *n*'th number. Thus, *a**i*<==<=*b**i*<=-<=*b**i*<=+<=1<=+<=*b**i*<=+<=2<=-<=*b**i*<=+<=3....
Memory gives you the values *a*1,<=*a*2,<=...,<=*a**n*, and he now wants you to find the initial numbers *b*1,<=*b*2,<=...,<=*b**n* written in the row? Can you do it?
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of integers written in the row.
The next line contains *n*, the *i*'th of which is *a**i* (<=-<=109<=≤<=*a**i*<=≤<=109) — the value of the *i*'th number.
Output Specification:
Print *n* integers corresponding to the sequence *b*1,<=*b*2,<=...,<=*b**n*. It's guaranteed that the answer is unique and fits in 32-bit integer type.
Demo Input:
['5\n6 -4 8 -2 3\n', '5\n3 -2 -1 5 6\n']
Demo Output:
['2 4 6 1 3 \n', '1 -3 4 11 6 \n']
Note:
In the first sample test, the crows report the numbers 6, - 4, 8, - 2, and 3 when he starts at indices 1, 2, 3, 4 and 5 respectively. It is easy to check that the sequence 2 4 6 1 3 satisfies the reports. For example, 6 = 2 - 4 + 6 - 1 + 3, and - 4 = 4 - 6 + 1 - 3.
In the second sample test, the sequence 1, - 3, 4, 11, 6 satisfies the reports. For example, 5 = 11 - 6 and 6 = 6.
|
```python
n = int(input())
arr = [int(x) for x in input().split()]
brr = [arr[n-1]]
for i in range(n-2,-1,-1):
x = +arr[i+1]+arr[i]
brr.append(x)
crr = brr[::-1]
s = str(crr[0])
for i in range(1,n):
s += ' '+str(crr[i])
print(s)
```
| 3
|
|
578
|
A
|
A Problem about Polyline
|
PROGRAMMING
| 1,700
|
[
"geometry",
"math"
] | null | null |
There is a polyline going through points (0,<=0)<=–<=(*x*,<=*x*)<=–<=(2*x*,<=0)<=–<=(3*x*,<=*x*)<=–<=(4*x*,<=0)<=–<=...<=-<=(2*kx*,<=0)<=–<=(2*kx*<=+<=*x*,<=*x*)<=–<=....
We know that the polyline passes through the point (*a*,<=*b*). Find minimum positive value *x* such that it is true or determine that there is no such *x*.
|
Only one line containing two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=109).
|
Output the only line containing the answer. Your answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9. If there is no such *x* then output <=-<=1 as the answer.
|
[
"3 1\n",
"1 3\n",
"4 1\n"
] |
[
"1.000000000000\n",
"-1\n",
"1.250000000000\n"
] |
You can see following graphs for sample 1 and sample 3.
| 250
|
[
{
"input": "3 1",
"output": "1.000000000000"
},
{
"input": "1 3",
"output": "-1"
},
{
"input": "4 1",
"output": "1.250000000000"
},
{
"input": "1000000000 1000000000",
"output": "1000000000.000000000000"
},
{
"input": "1000000000 1",
"output": "1.000000001000"
},
{
"input": "991691248 43166756",
"output": "47039000.181818180000"
},
{
"input": "973970808 679365826",
"output": "826668317.000000000000"
},
{
"input": "404878182 80324806",
"output": "80867164.666666672000"
},
{
"input": "405262931 391908625",
"output": "398585778.000000000000"
},
{
"input": "758323881 37209930",
"output": "39776690.549999997000"
},
{
"input": "405647680 36668977",
"output": "36859721.416666664000"
},
{
"input": "750322953 61458580",
"output": "67648461.083333328000"
},
{
"input": "406032429 31993512",
"output": "36502161.750000000000"
},
{
"input": "1000000000 111111111",
"output": "111111111.099999990000"
},
{
"input": "999999999 111111111",
"output": "111111111.000000000000"
},
{
"input": "999999998 111111111",
"output": "138888888.625000000000"
},
{
"input": "888888888 111111111",
"output": "124999999.875000000000"
},
{
"input": "1 1000000000",
"output": "-1"
},
{
"input": "999899988 13",
"output": "13.000000117012"
},
{
"input": "481485937 21902154",
"output": "22881276.863636363000"
},
{
"input": "836218485 1720897",
"output": "1724155.106995884800"
},
{
"input": "861651807 2239668",
"output": "2249717.382812500000"
},
{
"input": "829050416 2523498",
"output": "2535286.323170731800"
},
{
"input": "1000000000 999999999",
"output": "999999999.500000000000"
},
{
"input": "999999999 1000000000",
"output": "-1"
},
{
"input": "11 5",
"output": "8.000000000000"
},
{
"input": "100000000 1",
"output": "1.000000010000"
},
{
"input": "1488 1",
"output": "1.000672043011"
},
{
"input": "11 3",
"output": "3.500000000000"
},
{
"input": "30 5",
"output": "5.833333333333"
},
{
"input": "5 1",
"output": "1.000000000000"
}
] | 1,443,865,923
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 3
| 46
| 0
|
a, b = map(int, input().split())
if b > a:
print(-1)
else:
x1 = a + b
x2 = a - b
x = b
print(min(x1 / 2 / (x1 // (2 * x)), x2 / 2 / (x2 // (2 * x))))
|
Title: A Problem about Polyline
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a polyline going through points (0,<=0)<=–<=(*x*,<=*x*)<=–<=(2*x*,<=0)<=–<=(3*x*,<=*x*)<=–<=(4*x*,<=0)<=–<=...<=-<=(2*kx*,<=0)<=–<=(2*kx*<=+<=*x*,<=*x*)<=–<=....
We know that the polyline passes through the point (*a*,<=*b*). Find minimum positive value *x* such that it is true or determine that there is no such *x*.
Input Specification:
Only one line containing two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=109).
Output Specification:
Output the only line containing the answer. Your answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=9. If there is no such *x* then output <=-<=1 as the answer.
Demo Input:
['3 1\n', '1 3\n', '4 1\n']
Demo Output:
['1.000000000000\n', '-1\n', '1.250000000000\n']
Note:
You can see following graphs for sample 1 and sample 3.
|
```python
a, b = map(int, input().split())
if b > a:
print(-1)
else:
x1 = a + b
x2 = a - b
x = b
print(min(x1 / 2 / (x1 // (2 * x)), x2 / 2 / (x2 // (2 * x))))
```
| -1
|
|
1,008
|
A
|
Romaji
|
PROGRAMMING
| 900
|
[
"implementation",
"strings"
] | null | null |
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
|
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
|
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
|
[
"sumimasen\n",
"ninja\n",
"codeforces\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
| 500
|
[
{
"input": "sumimasen",
"output": "YES"
},
{
"input": "ninja",
"output": "YES"
},
{
"input": "codeforces",
"output": "NO"
},
{
"input": "auuaoonntanonnuewannnnpuuinniwoonennyolonnnvienonpoujinndinunnenannmuveoiuuhikucuziuhunnnmunzancenen",
"output": "YES"
},
{
"input": "n",
"output": "YES"
},
{
"input": "necnei",
"output": "NO"
},
{
"input": "nternn",
"output": "NO"
},
{
"input": "aucunuohja",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "b",
"output": "NO"
},
{
"input": "nn",
"output": "YES"
},
{
"input": "nnnzaaa",
"output": "YES"
},
{
"input": "zn",
"output": "NO"
},
{
"input": "ab",
"output": "NO"
},
{
"input": "aaaaaaaaaa",
"output": "YES"
},
{
"input": "aaaaaaaaab",
"output": "NO"
},
{
"input": "aaaaaaaaan",
"output": "YES"
},
{
"input": "baaaaaaaaa",
"output": "YES"
},
{
"input": "naaaaaaaaa",
"output": "YES"
},
{
"input": "nbaaaaaaaa",
"output": "YES"
},
{
"input": "bbaaaaaaaa",
"output": "NO"
},
{
"input": "bnaaaaaaaa",
"output": "NO"
},
{
"input": "eonwonojannonnufimiiniewuqaienokacevecinfuqihatenhunliquuyebayiaenifuexuanenuaounnboancaeowonu",
"output": "YES"
},
{
"input": "uixinnepnlinqaingieianndeakuniooudidonnnqeaituioeneiroionxuowudiooonayenfeonuino",
"output": "NO"
},
{
"input": "nnnnnyigaveteononnnnxaalenxuiiwannntoxonyoqonlejuoxuoconnnentoinnul",
"output": "NO"
},
{
"input": "ndonneasoiunhomuunnhuitonnntunntoanerekonoupunanuauenu",
"output": "YES"
},
{
"input": "anujemogawautiedoneobninnibonuunaoennnyoorufonxionntinimiboonununnnnnleenqunminzayoutanlalo",
"output": "NO"
},
{
"input": "y",
"output": "NO"
},
{
"input": "by",
"output": "NO"
},
{
"input": "yy",
"output": "NO"
},
{
"input": "nbn",
"output": "NO"
},
{
"input": "nz",
"output": "NO"
},
{
"input": "king",
"output": "NO"
},
{
"input": "g",
"output": "NO"
},
{
"input": "az",
"output": "NO"
},
{
"input": "x",
"output": "NO"
},
{
"input": "z",
"output": "NO"
},
{
"input": "yn",
"output": "NO"
},
{
"input": "aeo",
"output": "YES"
},
{
"input": "nb",
"output": "NO"
},
{
"input": "npn",
"output": "NO"
},
{
"input": "kini",
"output": "YES"
},
{
"input": "pya",
"output": "NO"
},
{
"input": "m",
"output": "NO"
},
{
"input": "p",
"output": "NO"
},
{
"input": "aaaaaaaak",
"output": "NO"
},
{
"input": "aab",
"output": "NO"
},
{
"input": "d",
"output": "NO"
},
{
"input": "at",
"output": "NO"
},
{
"input": "aaaaaak",
"output": "NO"
},
{
"input": "aaz",
"output": "NO"
},
{
"input": "aaab",
"output": "NO"
},
{
"input": "s",
"output": "NO"
},
{
"input": "nzzen",
"output": "NO"
},
{
"input": "aeionnhhhn",
"output": "NO"
},
{
"input": "h",
"output": "NO"
},
{
"input": "ny",
"output": "NO"
}
] | 1,681,140,318
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 46
| 0
|
string = input()
ref =[ "a", "o", "u", "i", "e"]
res = 'YES'
for i in range(0 , len(string)-1) :
if string[i] not in ref and string[i+1] not in ref and string[i] !="n" :
res ="NO"
break
print(res)
|
Title: Romaji
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
Input Specification:
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
Output Specification:
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
Demo Input:
['sumimasen\n', 'ninja\n', 'codeforces\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese.
|
```python
string = input()
ref =[ "a", "o", "u", "i", "e"]
res = 'YES'
for i in range(0 , len(string)-1) :
if string[i] not in ref and string[i+1] not in ref and string[i] !="n" :
res ="NO"
break
print(res)
```
| 0
|
|
300
|
A
|
Array
|
PROGRAMMING
| 1,100
|
[
"brute force",
"constructive algorithms",
"implementation"
] | null | null |
Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold:
1. The product of all numbers in the first set is less than zero (<=<<=0). 1. The product of all numbers in the second set is greater than zero (<=><=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set.
Help Vitaly. Divide the given array.
|
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements.
|
In the first line print integer *n*1 (*n*1<=><=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set.
In the next line print integer *n*2 (*n*2<=><=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set.
In the next line print integer *n*3 (*n*3<=><=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set.
The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them.
|
[
"3\n-1 2 0\n",
"4\n-1 -2 -3 0\n"
] |
[
"1 -1\n1 2\n1 0\n",
"1 -1\n2 -3 -2\n1 0\n"
] |
none
| 500
|
[
{
"input": "3\n-1 2 0",
"output": "1 -1\n1 2\n1 0"
},
{
"input": "4\n-1 -2 -3 0",
"output": "1 -1\n2 -3 -2\n1 0"
},
{
"input": "5\n-1 -2 1 2 0",
"output": "1 -1\n2 1 2\n2 0 -2"
},
{
"input": "100\n-64 -51 -75 -98 74 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 52 -35 4 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 86 -25 -94 -56 60 -24 -37 -72 -41 -31 11 -48 28 -38 -42 -39 -33 -70 -84 0 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 17 -2 -63 -89 88 13 -58 -82",
"output": "89 -64 -51 -75 -98 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 -35 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 -25 -94 -56 -24 -37 -72 -41 -31 -48 -38 -42 -39 -33 -70 -84 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 -2 -63 -89 -58 -82\n10 74 52 4 86 60 11 28 17 88 13\n1 0"
},
{
"input": "100\n3 -66 -17 54 24 -29 76 89 32 -37 93 -16 99 -25 51 78 23 68 -95 59 18 34 -45 77 9 39 -10 19 8 73 -5 60 12 31 0 2 26 40 48 30 52 49 27 4 87 57 85 58 -61 50 83 80 69 67 91 97 -96 11 100 56 82 53 13 -92 -72 70 1 -94 -63 47 21 14 74 7 6 33 55 65 64 -41 81 42 36 28 38 20 43 71 90 -88 22 84 -86 15 75 62 44 35 98 46",
"output": "19 -66 -17 -29 -37 -16 -25 -95 -45 -10 -5 -61 -96 -92 -72 -94 -63 -41 -88 -86\n80 3 54 24 76 89 32 93 99 51 78 23 68 59 18 34 77 9 39 19 8 73 60 12 31 2 26 40 48 30 52 49 27 4 87 57 85 58 50 83 80 69 67 91 97 11 100 56 82 53 13 70 1 47 21 14 74 7 6 33 55 65 64 81 42 36 28 38 20 43 71 90 22 84 15 75 62 44 35 98 46\n1 0"
},
{
"input": "100\n-17 16 -70 32 -60 75 -100 -9 -68 -30 -42 86 -88 -98 -47 -5 58 -14 -94 -73 -80 -51 -66 -85 -53 49 -25 -3 -45 -69 -11 -64 83 74 -65 67 13 -91 81 6 -90 -54 -12 -39 0 -24 -71 -41 -44 57 -93 -20 -92 18 -43 -52 -55 -84 -89 -19 40 -4 -99 -26 -87 -36 -56 -61 -62 37 -95 -28 63 23 35 -82 1 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 46 -15 -48 -34 -59 -7 -29 50 -33 -72 -79 22 38",
"output": "75 -17 -70 -60 -100 -9 -68 -30 -42 -88 -98 -47 -5 -14 -94 -73 -80 -51 -66 -85 -53 -25 -3 -45 -69 -11 -64 -65 -91 -90 -54 -12 -39 -24 -71 -41 -44 -93 -20 -92 -43 -52 -55 -84 -89 -19 -4 -99 -26 -87 -36 -56 -61 -62 -95 -28 -82 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 -15 -48 -34 -59 -7 -29 -33 -72 -79\n24 16 32 75 86 58 49 83 74 67 13 81 6 57 18 40 37 63 23 35 1 46 50 22 38\n1 0"
},
{
"input": "100\n-97 -90 61 78 87 -52 -3 65 83 38 30 -60 35 -50 -73 -77 44 -32 -81 17 -67 58 -6 -34 47 -28 71 -45 69 -80 -4 -7 -57 -79 43 -27 -31 29 16 -89 -21 -93 95 -82 74 -5 -70 -20 -18 36 -64 -66 72 53 62 -68 26 15 76 -40 -99 8 59 88 49 -23 9 10 56 -48 -98 0 100 -54 25 94 13 -63 42 39 -1 55 24 -12 75 51 41 84 -96 -85 -2 -92 14 -46 -91 -19 -11 -86 22 -37",
"output": "51 -97 -90 -52 -3 -60 -50 -73 -77 -32 -81 -67 -6 -34 -28 -45 -80 -4 -7 -57 -79 -27 -31 -89 -21 -93 -82 -5 -70 -20 -18 -64 -66 -68 -40 -99 -23 -48 -98 -54 -63 -1 -12 -96 -85 -2 -92 -46 -91 -19 -11 -86\n47 61 78 87 65 83 38 30 35 44 17 58 47 71 69 43 29 16 95 74 36 72 53 62 26 15 76 8 59 88 49 9 10 56 100 25 94 13 42 39 55 24 75 51 41 84 14 22\n2 0 -37"
},
{
"input": "100\n-75 -60 -18 -92 -71 -9 -37 -34 -82 28 -54 93 -83 -76 -58 -88 -17 -97 64 -39 -96 -81 -10 -98 -47 -100 -22 27 14 -33 -19 -99 87 -66 57 -21 -90 -70 -32 -26 24 -77 -74 13 -44 16 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 69 0 -20 -79 59 -48 -4 -72 -67 -46 62 51 -52 -86 -40 56 -53 85 -35 -8 49 50 65 29 11 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 78 94 -23 -63 84 89 -61",
"output": "73 -75 -60 -18 -92 -71 -9 -37 -34 -82 -54 -83 -76 -58 -88 -17 -97 -39 -96 -81 -10 -98 -47 -100 -22 -33 -19 -99 -66 -21 -90 -70 -32 -26 -77 -74 -44 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 -20 -79 -48 -4 -72 -67 -46 -52 -86 -40 -53 -35 -8 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 -23 -63\n25 28 93 64 27 14 87 57 24 13 16 69 59 62 51 56 85 49 50 65 29 11 78 94 84 89\n2 0 -61"
},
{
"input": "100\n-87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 49 38 -20 -45 -64 44 -96 -35 -74 -65 -41 -21 -75 37 -12 -67 0 -3 5 -80 -93 -81 -97 -47 -63 53 -100 95 -79 -83 -90 -32 88 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 60 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 8 -72 18 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 84 -86 -7 -57 -14 40 -33 51 -26 46 59 -31 -58 -66",
"output": "83 -87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 -20 -45 -64 -96 -35 -74 -65 -41 -21 -75 -12 -67 -3 -80 -93 -81 -97 -47 -63 -100 -79 -83 -90 -32 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 -72 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 -86 -7 -57 -14 -33 -26 -31 -58 -66\n16 49 38 44 37 5 53 95 88 60 8 18 84 40 51 46 59\n1 0"
},
{
"input": "100\n-95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 77 -69 -10 -12 -78 -14 -52 -57 -40 -75 4 -98 -6 7 -53 -3 -90 -63 -8 -20 88 -91 -32 -76 -80 -97 -34 -27 -19 0 70 -38 -9 -49 -67 73 -36 2 81 -39 -65 -83 -64 -18 -94 -79 -58 -16 87 -22 -74 -25 -13 -46 -89 -47 5 -15 -54 -99 56 -30 -60 -21 -86 33 -1 -50 -68 -100 -85 -29 92 -48 -61 42 -84 -93 -41 -82",
"output": "85 -95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 -69 -10 -12 -78 -14 -52 -57 -40 -75 -98 -6 -53 -3 -90 -63 -8 -20 -91 -32 -76 -80 -97 -34 -27 -19 -38 -9 -49 -67 -36 -39 -65 -83 -64 -18 -94 -79 -58 -16 -22 -74 -25 -13 -46 -89 -47 -15 -54 -99 -30 -60 -21 -86 -1 -50 -68 -100 -85 -29 -48 -61 -84 -93 -41 -82\n14 77 4 7 88 70 73 2 81 87 5 56 33 92 42\n1 0"
},
{
"input": "100\n-12 -41 57 13 83 -36 53 69 -6 86 -75 87 11 -5 -4 -14 -37 -84 70 2 -73 16 31 34 -45 94 -9 26 27 52 -42 46 96 21 32 7 -18 61 66 -51 95 -48 -76 90 80 -40 89 77 78 54 -30 8 88 33 -24 82 -15 19 1 59 44 64 -97 -60 43 56 35 47 39 50 29 28 -17 -67 74 23 85 -68 79 0 65 55 -3 92 -99 72 93 -71 38 -10 -100 -98 81 62 91 -63 -58 49 -20 22",
"output": "35 -12 -41 -36 -6 -75 -5 -4 -14 -37 -84 -73 -45 -9 -42 -18 -51 -48 -76 -40 -30 -24 -15 -97 -60 -17 -67 -68 -3 -99 -71 -10 -100 -98 -63 -58\n63 57 13 83 53 69 86 87 11 70 2 16 31 34 94 26 27 52 46 96 21 32 7 61 66 95 90 80 89 77 78 54 8 88 33 82 19 1 59 44 64 43 56 35 47 39 50 29 28 74 23 85 79 65 55 92 72 93 38 81 62 91 49 22\n2 0 -20"
},
{
"input": "100\n-34 81 85 -96 50 20 54 86 22 10 -19 52 65 44 30 53 63 71 17 98 -92 4 5 -99 89 -23 48 9 7 33 75 2 47 -56 42 70 -68 57 51 83 82 94 91 45 46 25 95 11 -12 62 -31 -87 58 38 67 97 -60 66 73 -28 13 93 29 59 -49 77 37 -43 -27 0 -16 72 15 79 61 78 35 21 3 8 84 1 -32 36 74 -88 26 100 6 14 40 76 18 90 24 69 80 64 55 41",
"output": "19 -34 -96 -19 -92 -99 -23 -56 -68 -12 -31 -87 -60 -28 -49 -43 -27 -16 -32 -88\n80 81 85 50 20 54 86 22 10 52 65 44 30 53 63 71 17 98 4 5 89 48 9 7 33 75 2 47 42 70 57 51 83 82 94 91 45 46 25 95 11 62 58 38 67 97 66 73 13 93 29 59 77 37 72 15 79 61 78 35 21 3 8 84 1 36 74 26 100 6 14 40 76 18 90 24 69 80 64 55 41\n1 0"
},
{
"input": "100\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952 -935",
"output": "97 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983\n2 -935 -952\n1 0"
},
{
"input": "99\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952",
"output": "95 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941\n2 -952 -983\n2 0 -961"
},
{
"input": "59\n-990 -876 -641 -726 718 -53 803 -954 894 -265 -587 -665 904 349 754 -978 441 794 -768 -428 -569 -476 188 -620 -290 -333 45 705 -201 109 165 446 13 122 714 -562 -15 -86 -960 43 329 578 287 -776 -14 -71 915 886 -259 337 -495 913 -498 -669 -673 818 225 647 0",
"output": "29 -990 -876 -641 -726 -53 -954 -265 -587 -665 -978 -768 -428 -569 -476 -620 -290 -333 -201 -562 -15 -86 -960 -776 -14 -71 -259 -495 -498 -669\n28 718 803 894 904 349 754 441 794 188 45 705 109 165 446 13 122 714 43 329 578 287 915 886 337 913 818 225 647\n2 0 -673"
},
{
"input": "64\n502 885 -631 -906 735 687 642 -29 -696 -165 -524 15 -129 -663 -846 -501 -651 895 -341 -833 -142 33 -847 688 945 -192 -587 -930 603 849 736 676 788 256 863 -509 319 -49 -807 -158 218 -886 -143 -639 118 -156 -291 325 892 -916 -622 -960 -959 -731 -943 436 -535 861 745 589 -159 376 -182 0",
"output": "35 -631 -906 -29 -696 -165 -524 -129 -663 -846 -501 -651 -341 -833 -142 -847 -192 -587 -930 -509 -49 -807 -158 -886 -143 -639 -156 -291 -916 -622 -960 -959 -731 -943 -535 -159\n27 502 885 735 687 642 15 895 33 688 945 603 849 736 676 788 256 863 319 218 118 325 892 436 861 745 589 376\n2 0 -182"
},
{
"input": "5\n-1 -2 -3 -4 0",
"output": "1 -1\n2 -4 -3\n2 0 -2"
},
{
"input": "3\n-101 101 0",
"output": "1 -101\n1 101\n1 0"
},
{
"input": "21\n-100 -200 -300 -400 -500 -600 -700 -800 -900 -1000 0 100 200 300 400 500 600 700 800 900 1000",
"output": "9 -100 -200 -300 -400 -500 -600 -700 -800 -900\n10 100 200 300 400 500 600 700 800 900 1000\n2 0 -1000"
},
{
"input": "4\n0 -1 -2 -3",
"output": "1 -1\n2 -3 -2\n1 0"
}
] | 1,688,867,714
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 92
| 0
|
n = int(input())
arr = list(map(int, input().split()))
nArr, pArr, zArr = [], [], []
sortedArr = sorted(arr)
l0 = sortedArr.index(0)
c0 = sortedArr.count(0)
r0 = l0 if c0 == 1 else l0 + c0
if sortedArr[-1] == 0:
nArr = sortedArr[0:1]
pArr = sortedArr[1:l0]
zArr = sortedArr[l0:]
else:
nArr = sortedArr[:l0]
zArr = sortedArr[l0:r0]
pArr = sortedArr[r0:]
print(f"{len(nArr)} {str(nArr)}")
print(f"{len(pArr)} {str(pArr)}")
print(f"{len(zArr)} {str(zArr)}")
|
Title: Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold:
1. The product of all numbers in the first set is less than zero (<=<<=0). 1. The product of all numbers in the second set is greater than zero (<=><=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set.
Help Vitaly. Divide the given array.
Input Specification:
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements.
Output Specification:
In the first line print integer *n*1 (*n*1<=><=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set.
In the next line print integer *n*2 (*n*2<=><=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set.
In the next line print integer *n*3 (*n*3<=><=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set.
The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them.
Demo Input:
['3\n-1 2 0\n', '4\n-1 -2 -3 0\n']
Demo Output:
['1 -1\n1 2\n1 0\n', '1 -1\n2 -3 -2\n1 0\n']
Note:
none
|
```python
n = int(input())
arr = list(map(int, input().split()))
nArr, pArr, zArr = [], [], []
sortedArr = sorted(arr)
l0 = sortedArr.index(0)
c0 = sortedArr.count(0)
r0 = l0 if c0 == 1 else l0 + c0
if sortedArr[-1] == 0:
nArr = sortedArr[0:1]
pArr = sortedArr[1:l0]
zArr = sortedArr[l0:]
else:
nArr = sortedArr[:l0]
zArr = sortedArr[l0:r0]
pArr = sortedArr[r0:]
print(f"{len(nArr)} {str(nArr)}")
print(f"{len(pArr)} {str(pArr)}")
print(f"{len(zArr)} {str(zArr)}")
```
| 0
|
|
710
|
B
|
Optimal Point on a Line
|
PROGRAMMING
| 1,400
|
[
"brute force",
"sortings"
] | null | null |
You are given *n* points on a line with their coordinates *x**i*. Find the point *x* so the sum of distances to the given points is minimal.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of points on the line.
The second line contains *n* integers *x**i* (<=-<=109<=≤<=*x**i*<=≤<=109) — the coordinates of the given *n* points.
|
Print the only integer *x* — the position of the optimal point on the line. If there are several optimal points print the position of the leftmost one. It is guaranteed that the answer is always the integer.
|
[
"4\n1 2 3 4\n"
] |
[
"2\n"
] |
none
| 0
|
[
{
"input": "4\n1 2 3 4",
"output": "2"
},
{
"input": "5\n-1 -10 2 6 7",
"output": "2"
},
{
"input": "10\n-68 10 87 22 30 89 82 -97 -52 25",
"output": "22"
},
{
"input": "100\n457 827 807 17 871 935 907 -415 536 170 551 -988 865 758 -457 -892 -875 -488 684 19 0 555 -807 -624 -239 826 318 811 20 -732 -91 460 551 -610 555 -493 -154 442 -141 946 -913 -104 704 -380 699 32 106 -455 -518 214 -464 -861 243 -798 -472 559 529 -844 -32 871 -459 236 387 626 -318 -580 -611 -842 790 486 64 951 81 78 -693 403 -731 309 678 696 891 846 -106 918 212 -44 994 606 -829 -454 243 -477 -402 -818 -819 -310 -837 -209 736 424",
"output": "64"
},
{
"input": "2\n-1 0",
"output": "-1"
},
{
"input": "48\n-777 -767 -764 -713 -688 -682 -606 -586 -585 -483 -465 -440 -433 -397 -390 -377 -299 -252 -159 -147 -96 -29 -15 15 52 109 124 129 142 218 231 314 320 339 442 496 505 548 575 576 594 624 694 827 891 979 981 981",
"output": "15"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 1 1 1 1 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "4\n-1 -1 0 1",
"output": "-1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 1000000000",
"output": "0"
},
{
"input": "2\n1 -1",
"output": "-1"
},
{
"input": "2\n100 50",
"output": "50"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "3\n606194955 -856471310 117647402",
"output": "117647402"
},
{
"input": "2\n615002717 -843553590",
"output": "-843553590"
},
{
"input": "2\n-1 2",
"output": "-1"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "5\n-638512131 348325781 -550537933 -618161835 -567935532",
"output": "-567935532"
},
{
"input": "1\n120",
"output": "120"
},
{
"input": "2\n-1000000000 1000000000",
"output": "-1000000000"
},
{
"input": "1\n618309368",
"output": "618309368"
}
] | 1,614,564,686
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 124
| 2,150,400
|
while true:
try:
n=input().strip()
a=list(map(int,input().strip().split()))
b=sorted(a)
if (len(b)%2) == 0:
print(b[int((len(b)/2))-1])
else:
print(b[int((len(b)/2))])
except EOFError:
break
|
Title: Optimal Point on a Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* points on a line with their coordinates *x**i*. Find the point *x* so the sum of distances to the given points is minimal.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=3·105) — the number of points on the line.
The second line contains *n* integers *x**i* (<=-<=109<=≤<=*x**i*<=≤<=109) — the coordinates of the given *n* points.
Output Specification:
Print the only integer *x* — the position of the optimal point on the line. If there are several optimal points print the position of the leftmost one. It is guaranteed that the answer is always the integer.
Demo Input:
['4\n1 2 3 4\n']
Demo Output:
['2\n']
Note:
none
|
```python
while true:
try:
n=input().strip()
a=list(map(int,input().strip().split()))
b=sorted(a)
if (len(b)%2) == 0:
print(b[int((len(b)/2))-1])
else:
print(b[int((len(b)/2))])
except EOFError:
break
```
| -1
|
|
886
|
A
|
ACM ICPC
|
PROGRAMMING
| 1,000
|
[
"brute force"
] | null | null |
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
|
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
|
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
|
[
"1 3 2 1 2 1\n",
"1 1 1 1 1 99\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater.
| 500
|
[
{
"input": "1 3 2 1 2 1",
"output": "YES"
},
{
"input": "1 1 1 1 1 99",
"output": "NO"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "YES"
},
{
"input": "0 0 0 0 0 0",
"output": "YES"
},
{
"input": "633 609 369 704 573 416",
"output": "NO"
},
{
"input": "353 313 327 470 597 31",
"output": "NO"
},
{
"input": "835 638 673 624 232 266",
"output": "NO"
},
{
"input": "936 342 19 398 247 874",
"output": "NO"
},
{
"input": "417 666 978 553 271 488",
"output": "NO"
},
{
"input": "71 66 124 199 67 147",
"output": "YES"
},
{
"input": "54 26 0 171 239 12",
"output": "YES"
},
{
"input": "72 8 186 92 267 69",
"output": "YES"
},
{
"input": "180 179 188 50 75 214",
"output": "YES"
},
{
"input": "16 169 110 136 404 277",
"output": "YES"
},
{
"input": "101 400 9 200 300 10",
"output": "YES"
},
{
"input": "101 400 200 9 300 10",
"output": "YES"
},
{
"input": "101 200 400 9 300 10",
"output": "YES"
},
{
"input": "101 400 200 300 9 10",
"output": "YES"
},
{
"input": "101 200 400 300 9 10",
"output": "YES"
},
{
"input": "4 4 4 4 5 4",
"output": "NO"
},
{
"input": "2 2 2 2 2 1",
"output": "NO"
},
{
"input": "1000 1000 999 1000 1000 1000",
"output": "NO"
},
{
"input": "129 1 10 29 8 111",
"output": "NO"
},
{
"input": "1000 1000 1000 999 999 1000",
"output": "YES"
},
{
"input": "101 200 300 400 9 10",
"output": "YES"
},
{
"input": "101 400 200 300 10 9",
"output": "YES"
},
{
"input": "101 200 400 300 10 9",
"output": "YES"
},
{
"input": "101 200 300 400 10 9",
"output": "YES"
},
{
"input": "101 200 300 10 400 9",
"output": "YES"
},
{
"input": "1 1 1 1 1 5",
"output": "NO"
},
{
"input": "8 1 1 3 3 0",
"output": "NO"
},
{
"input": "1 1 2 2 3 3",
"output": "YES"
},
{
"input": "1 2 2 5 2 5",
"output": "NO"
},
{
"input": "1 2 3 6 6 6",
"output": "NO"
},
{
"input": "36 91 7 86 51 89",
"output": "NO"
},
{
"input": "10 1 1 1 23 24",
"output": "NO"
},
{
"input": "1 1 1 10 23 24",
"output": "NO"
},
{
"input": "20 10 1 2 3 44",
"output": "NO"
},
{
"input": "7 0 14 11 8 6",
"output": "NO"
},
{
"input": "100 496 1 1 1 1",
"output": "NO"
},
{
"input": "5 4 2 5 11 3",
"output": "NO"
},
{
"input": "1 3 7 8 8 9",
"output": "YES"
},
{
"input": "1 3 4 5 18 19",
"output": "YES"
},
{
"input": "5 5 1 2 2 15",
"output": "NO"
},
{
"input": "2 1 0 0 0 5",
"output": "NO"
},
{
"input": "1 6 6 1 20 2",
"output": "NO"
},
{
"input": "2 10 0 0 0 0",
"output": "NO"
},
{
"input": "1 1 3 1 1 11",
"output": "NO"
},
{
"input": "10 10 1 1 1 37",
"output": "NO"
},
{
"input": "1 1 0 0 0 4",
"output": "NO"
},
{
"input": "1 1 10 1 1 28",
"output": "NO"
},
{
"input": "1 5 5 5 6 8",
"output": "YES"
},
{
"input": "0 2 3 4 4 5",
"output": "YES"
}
] | 1,653,827,663
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 46
| 614,400
|
from typing import List
def solve(a: List[int]):
sum_a = sum(a)
for i in range(4):
for j in range(i + 1, 5):
for k in range(j + 1, 6):
if sum_a == (a[i]+a[j]+a[k]) * 2:
return "YES"
return "NO"
a = list(map(int, input().split()))
print(solve())
|
Title: ACM ICPC
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
Input Specification:
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
Output Specification:
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['1 3 2 1 2 1\n', '1 1 1 1 1 99\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater.
|
```python
from typing import List
def solve(a: List[int]):
sum_a = sum(a)
for i in range(4):
for j in range(i + 1, 5):
for k in range(j + 1, 6):
if sum_a == (a[i]+a[j]+a[k]) * 2:
return "YES"
return "NO"
a = list(map(int, input().split()))
print(solve())
```
| -1
|
|
462
|
A
|
Appleman and Easy Task
|
PROGRAMMING
| 1,000
|
[
"brute force",
"implementation"
] | null | null |
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
|
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
|
[
"3\nxxo\nxox\noxx\n",
"4\nxxxo\nxoxo\noxox\nxxxx\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "3\nxxo\nxox\noxx",
"output": "YES"
},
{
"input": "4\nxxxo\nxoxo\noxox\nxxxx",
"output": "NO"
},
{
"input": "1\no",
"output": "YES"
},
{
"input": "2\nox\nxo",
"output": "YES"
},
{
"input": "2\nxx\nxo",
"output": "NO"
},
{
"input": "3\nooo\noxo\nxoo",
"output": "NO"
},
{
"input": "3\nxxx\nxxo\nxxo",
"output": "NO"
},
{
"input": "4\nxooo\nooxo\noxoo\nooox",
"output": "YES"
},
{
"input": "4\noooo\noxxo\nxoxo\noooo",
"output": "NO"
},
{
"input": "5\noxoxo\nxxxxx\noxoxo\nxxxxx\noxoxo",
"output": "YES"
},
{
"input": "5\nxxxox\nxxxxo\nxoxox\noxoxx\nxoxxx",
"output": "NO"
},
{
"input": "10\nxoxooooooo\noxxoxxxxxo\nxxooxoooxo\noooxxoxoxo\noxxxooooxo\noxooooxxxo\noxoxoxxooo\noxoooxooxx\noxxxxxoxxo\noooooooxox",
"output": "YES"
},
{
"input": "10\nxxxxxxxoox\nxooxxooooo\noxoooxxooo\nxoxxxxxxxx\nxxoxooxxox\nooxoxxooox\nooxxxxxooo\nxxxxoxooox\nxoxxooxxxx\noooooxxoxo",
"output": "NO"
},
{
"input": "19\noxoxoxoxooxoooxxoox\nxxxxxxxxoxxoxoooooo\noxoxoxooxxxooxxxooo\nxxoxxxooxooxxxoxxox\noxoxooxxxooooxxoxox\nxxxoooxoxxoxxoxxxoo\noxooxxxoooooxxoooxo\nxxooxooxoxxoxxoxxoo\noxxxxooooxxxooooxxx\nooxooxoxxoxxoxooxoo\nxxxooooxxxooooxoxox\noooxoxooxxoxooxooxx\nxxoooxxxooooxxoooxo\nooxxxooxoxooxooxxxx\nxoxoxxooxoxxxooxoxo\nxoxxoxoxooxooxxxxxx\noooxxxooxxxooxoxoxo\nxoooooxoxooxxxxxxxo\nxooxxoooxxoxoxoxoxx",
"output": "NO"
},
{
"input": "12\nxxooxxoxxxoo\nxxoooxoxoxoo\nooxoxoxxooxx\nooxxooooxoxo\nxxxxxxxxoxxx\noxooooxxxooo\noxxoxoxoooxx\nxxxxxxxooxox\noxoooooxoxxx\nxxooxxoxxoxx\noxxxxxxxooxx\nooxoxooxxooo",
"output": "NO"
},
{
"input": "2\noo\nxx",
"output": "NO"
}
] | 1,424,093,955
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 62
| 102,400
|
n = int(input())
checker = [[0 for j in range(n)] for i in range(n)]
for i in range(n):
string = input()
for j in range(n):
checker[i][j] = string[j]
#print (checker)
for i in range(n):
for j in range(n):
count = 0
if i-1 >= 0 and checker[i-1][j] == 'o': count += 1
if i+1 < n and checker[i+1][j] == 'o': count += 1
if j-1 >= 0 and checker[i][j-1] == 'o': count += 1
if j+1 < n and checker[i][j+1] == 'o': count += 1
if count%2 == 1:
print ("NO")
exit()
print ("YES")
|
Title: Appleman and Easy Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
Output Specification:
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
Demo Input:
['3\nxxo\nxox\noxx\n', '4\nxxxo\nxoxo\noxox\nxxxx\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n = int(input())
checker = [[0 for j in range(n)] for i in range(n)]
for i in range(n):
string = input()
for j in range(n):
checker[i][j] = string[j]
#print (checker)
for i in range(n):
for j in range(n):
count = 0
if i-1 >= 0 and checker[i-1][j] == 'o': count += 1
if i+1 < n and checker[i+1][j] == 'o': count += 1
if j-1 >= 0 and checker[i][j-1] == 'o': count += 1
if j+1 < n and checker[i][j+1] == 'o': count += 1
if count%2 == 1:
print ("NO")
exit()
print ("YES")
```
| 3
|
|
669
|
A
|
Little Artem and Presents
|
PROGRAMMING
| 800
|
[
"math"
] | null | null |
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha?
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
|
Print the maximum possible number of times Artem can give presents to Masha.
|
[
"1\n",
"2\n",
"3\n",
"4\n"
] |
[
"1\n",
"1\n",
"2\n",
"3\n"
] |
In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
| 500
|
[
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "3"
},
{
"input": "100",
"output": "67"
},
{
"input": "101",
"output": "67"
},
{
"input": "102",
"output": "68"
},
{
"input": "1000000000",
"output": "666666667"
},
{
"input": "5",
"output": "3"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "666666666"
},
{
"input": "999999998",
"output": "666666665"
},
{
"input": "999999997",
"output": "666666665"
},
{
"input": "999999996",
"output": "666666664"
},
{
"input": "999999995",
"output": "666666663"
},
{
"input": "999999994",
"output": "666666663"
},
{
"input": "999999993",
"output": "666666662"
},
{
"input": "999999992",
"output": "666666661"
},
{
"input": "999999991",
"output": "666666661"
},
{
"input": "1000",
"output": "667"
},
{
"input": "10000",
"output": "6667"
},
{
"input": "100000",
"output": "66667"
},
{
"input": "1000000",
"output": "666667"
},
{
"input": "10000000",
"output": "6666667"
},
{
"input": "100000000",
"output": "66666667"
},
{
"input": "7",
"output": "5"
}
] | 1,461,515,998
| 298
|
Python 3
|
OK
|
TESTS
| 26
| 62
| 4,608,000
|
n = int(input())
print((n // 3) * 2 + (1 if n % 3 else 0))
|
Title: Little Artem and Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha?
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
Output Specification:
Print the maximum possible number of times Artem can give presents to Masha.
Demo Input:
['1\n', '2\n', '3\n', '4\n']
Demo Output:
['1\n', '1\n', '2\n', '3\n']
Note:
In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again.
|
```python
n = int(input())
print((n // 3) * 2 + (1 if n % 3 else 0))
```
| 3
|
|
618
|
A
|
Slime Combining
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right.
|
The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000).
|
Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left.
|
[
"1\n",
"2\n",
"3\n",
"8\n"
] |
[
"1\n",
"2\n",
"2 1\n",
"4\n"
] |
In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4
| 500
|
[
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "8",
"output": "4"
},
{
"input": "100000",
"output": "17 16 11 10 8 6"
},
{
"input": "12345",
"output": "14 13 6 5 4 1"
},
{
"input": "32",
"output": "6"
},
{
"input": "70958",
"output": "17 13 11 9 6 4 3 2"
},
{
"input": "97593",
"output": "17 15 14 13 12 11 9 6 5 4 1"
},
{
"input": "91706",
"output": "17 15 14 11 10 6 5 4 2"
},
{
"input": "85371",
"output": "17 15 12 11 9 7 6 5 4 2 1"
},
{
"input": "97205",
"output": "17 15 14 13 12 10 9 8 6 5 3 1"
},
{
"input": "34768",
"output": "16 11 10 9 8 7 5"
},
{
"input": "12705",
"output": "14 13 9 8 6 1"
},
{
"input": "30151",
"output": "15 14 13 11 9 8 7 3 2 1"
},
{
"input": "4974",
"output": "13 10 9 7 6 4 3 2"
},
{
"input": "32728",
"output": "15 14 13 12 11 10 9 8 7 5 4"
},
{
"input": "8192",
"output": "14"
},
{
"input": "65536",
"output": "17"
},
{
"input": "32",
"output": "6"
},
{
"input": "256",
"output": "9"
},
{
"input": "4096",
"output": "13"
},
{
"input": "33301",
"output": "16 10 5 3 1"
},
{
"input": "16725",
"output": "15 9 7 5 3 1"
},
{
"input": "149",
"output": "8 5 3 1"
},
{
"input": "16277",
"output": "14 13 12 11 10 9 8 5 3 1"
},
{
"input": "99701",
"output": "17 16 11 9 7 6 5 3 1"
}
] | 1,454,222,657
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 27
| 62
| 0
|
n=int(input())
i=1
k=1
a=[]
while i<=n:
if i&n:
a.append(k)
i<<=1
k+=1
for i in range(len(a)-1,-1,-1):
print(a[i],end=' ')
|
Title: Slime Combining
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right.
Input Specification:
The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000).
Output Specification:
Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left.
Demo Input:
['1\n', '2\n', '3\n', '8\n']
Demo Output:
['1\n', '2\n', '2 1\n', '4\n']
Note:
In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4
|
```python
n=int(input())
i=1
k=1
a=[]
while i<=n:
if i&n:
a.append(k)
i<<=1
k+=1
for i in range(len(a)-1,-1,-1):
print(a[i],end=' ')
```
| 3
|
|
946
|
B
|
Weird Subtraction Process
|
PROGRAMMING
| 1,100
|
[
"math",
"number theory"
] | null | null |
You have two variables *a* and *b*. Consider the following sequence of actions performed with these variables:
1. If *a*<==<=0 or *b*<==<=0, end the process. Otherwise, go to step 2;1. If *a*<=≥<=2·*b*, then set the value of *a* to *a*<=-<=2·*b*, and repeat step 1. Otherwise, go to step 3;1. If *b*<=≥<=2·*a*, then set the value of *b* to *b*<=-<=2·*a*, and repeat step 1. Otherwise, end the process.
Initially the values of *a* and *b* are positive integers, and so the process will be finite.
You have to determine the values of *a* and *b* after the process ends.
|
The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1018). *n* is the initial value of variable *a*, and *m* is the initial value of variable *b*.
|
Print two integers — the values of *a* and *b* after the end of the process.
|
[
"12 5\n",
"31 12\n"
] |
[
"0 1\n",
"7 12\n"
] |
Explanations to the samples:
1. *a* = 12, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 1 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 0, *b* = 1;1. *a* = 31, *b* = 12 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 7, *b* = 12.
| 0
|
[
{
"input": "12 5",
"output": "0 1"
},
{
"input": "31 12",
"output": "7 12"
},
{
"input": "1000000000000000000 7",
"output": "8 7"
},
{
"input": "31960284556200 8515664064180",
"output": "14928956427840 8515664064180"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "1000000000000000000 1000000000000000000"
},
{
"input": "1 1000",
"output": "1 0"
},
{
"input": "1 1000000",
"output": "1 0"
},
{
"input": "1 1000000000000000",
"output": "1 0"
},
{
"input": "1 99999999999999999",
"output": "1 1"
},
{
"input": "1 4",
"output": "1 0"
},
{
"input": "1000000000000001 500000000000000",
"output": "1 0"
},
{
"input": "1 1000000000000000000",
"output": "1 0"
},
{
"input": "2 4",
"output": "2 0"
},
{
"input": "2 1",
"output": "0 1"
},
{
"input": "6 19",
"output": "6 7"
},
{
"input": "22 5",
"output": "0 1"
},
{
"input": "10000000000000000 100000000000000001",
"output": "0 1"
},
{
"input": "1 1000000000000",
"output": "1 0"
},
{
"input": "2 1000000000000000",
"output": "2 0"
},
{
"input": "2 10",
"output": "2 2"
},
{
"input": "51 100",
"output": "51 100"
},
{
"input": "3 1000000000000000000",
"output": "3 4"
},
{
"input": "1000000000000000000 3",
"output": "4 3"
},
{
"input": "1 10000000000000000",
"output": "1 0"
},
{
"input": "8796203 7556",
"output": "1019 1442"
},
{
"input": "5 22",
"output": "1 0"
},
{
"input": "1000000000000000000 1",
"output": "0 1"
},
{
"input": "1 100000000000",
"output": "1 0"
},
{
"input": "2 1000000000000",
"output": "2 0"
},
{
"input": "5 4567865432345678",
"output": "5 8"
},
{
"input": "576460752303423487 288230376151711743",
"output": "1 1"
},
{
"input": "499999999999999999 1000000000000000000",
"output": "3 2"
},
{
"input": "1 9999999999999",
"output": "1 1"
},
{
"input": "103 1000000000000000000",
"output": "103 196"
},
{
"input": "7 1",
"output": "1 1"
},
{
"input": "100000000000000001 10000000000000000",
"output": "1 0"
},
{
"input": "5 10",
"output": "5 0"
},
{
"input": "7 11",
"output": "7 11"
},
{
"input": "1 123456789123456",
"output": "1 0"
},
{
"input": "5000000000000 100000000000001",
"output": "0 1"
},
{
"input": "1000000000000000 1",
"output": "0 1"
},
{
"input": "1000000000000000000 499999999999999999",
"output": "2 3"
},
{
"input": "10 5",
"output": "0 5"
},
{
"input": "9 18917827189272",
"output": "9 0"
},
{
"input": "179 100000000000497000",
"output": "179 270"
},
{
"input": "5 100000000000001",
"output": "1 1"
},
{
"input": "5 20",
"output": "5 0"
},
{
"input": "100000001 50000000",
"output": "1 0"
},
{
"input": "345869461223138161 835002744095575440",
"output": "1 0"
},
{
"input": "8589934592 4294967296",
"output": "0 4294967296"
},
{
"input": "4 8",
"output": "4 0"
},
{
"input": "1 100000000000000000",
"output": "1 0"
},
{
"input": "1000000000000000000 333333333333333",
"output": "1000 1333"
},
{
"input": "25 12",
"output": "1 0"
},
{
"input": "24 54",
"output": "0 6"
},
{
"input": "6 12",
"output": "6 0"
},
{
"input": "129200000000305 547300000001292",
"output": "1 0"
},
{
"input": "1000000000000000000 49999999999999999",
"output": "20 39"
},
{
"input": "1 2",
"output": "1 0"
},
{
"input": "1 123456789876",
"output": "1 0"
},
{
"input": "2 3",
"output": "2 3"
},
{
"input": "1 3",
"output": "1 1"
},
{
"input": "1 1",
"output": "1 1"
},
{
"input": "19 46",
"output": "3 2"
},
{
"input": "3 6",
"output": "3 0"
},
{
"input": "129 1000000000000000000",
"output": "1 0"
},
{
"input": "12 29",
"output": "0 1"
},
{
"input": "8589934592 2147483648",
"output": "0 2147483648"
},
{
"input": "2147483648 8589934592",
"output": "2147483648 0"
},
{
"input": "5 6",
"output": "5 6"
},
{
"input": "1000000000000000000 2",
"output": "0 2"
},
{
"input": "2 7",
"output": "2 3"
},
{
"input": "17174219820754872 61797504734333370",
"output": "17174219820754872 27449065092823626"
},
{
"input": "49 100",
"output": "1 0"
},
{
"input": "7 17",
"output": "1 1"
},
{
"input": "1000000000000000000 10000001",
"output": "0 1"
},
{
"input": "49999999999999999 2",
"output": "3 2"
},
{
"input": "49999999999999999 1",
"output": "1 1"
},
{
"input": "576460752303423487 2",
"output": "3 2"
},
{
"input": "19395 19395",
"output": "19395 19395"
},
{
"input": "19394 19394",
"output": "19394 19394"
}
] | 1,537,814,106
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
a,b=input("Inserte a y b respectivamente: ").split()
a,b=[int(a),int(b)]
n=a
m=b
def checkMahNums(n,m):
if(n<1 or m>=10**18):
return print("This number is not valid")
def ShowMeTheSub(a,b):
if a==0 or b==0:
#while a!=0 and b!=0:
#if a>=2*b:
#a=a-(2*b)
#elif b>=2*a:
#b=b-(2*a)
return print(a,b)
ShowMeTheSub(n,m)
|
Title: Weird Subtraction Process
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have two variables *a* and *b*. Consider the following sequence of actions performed with these variables:
1. If *a*<==<=0 or *b*<==<=0, end the process. Otherwise, go to step 2;1. If *a*<=≥<=2·*b*, then set the value of *a* to *a*<=-<=2·*b*, and repeat step 1. Otherwise, go to step 3;1. If *b*<=≥<=2·*a*, then set the value of *b* to *b*<=-<=2·*a*, and repeat step 1. Otherwise, end the process.
Initially the values of *a* and *b* are positive integers, and so the process will be finite.
You have to determine the values of *a* and *b* after the process ends.
Input Specification:
The only line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1018). *n* is the initial value of variable *a*, and *m* is the initial value of variable *b*.
Output Specification:
Print two integers — the values of *a* and *b* after the end of the process.
Demo Input:
['12 5\n', '31 12\n']
Demo Output:
['0 1\n', '7 12\n']
Note:
Explanations to the samples:
1. *a* = 12, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 5 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 2, *b* = 1 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 0, *b* = 1;1. *a* = 31, *b* = 12 <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> *a* = 7, *b* = 12.
|
```python
a,b=input("Inserte a y b respectivamente: ").split()
a,b=[int(a),int(b)]
n=a
m=b
def checkMahNums(n,m):
if(n<1 or m>=10**18):
return print("This number is not valid")
def ShowMeTheSub(a,b):
if a==0 or b==0:
#while a!=0 and b!=0:
#if a>=2*b:
#a=a-(2*b)
#elif b>=2*a:
#b=b-(2*a)
return print(a,b)
ShowMeTheSub(n,m)
```
| -1
|
|
102
|
B
|
Sum of Digits
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
B. Sum of Digits
|
2
|
265
|
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
|
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
|
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
|
[
"0\n",
"10\n",
"991\n"
] |
[
"0\n",
"1\n",
"3\n"
] |
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
| 1,000
|
[
{
"input": "0",
"output": "0"
},
{
"input": "10",
"output": "1"
},
{
"input": "991",
"output": "3"
},
{
"input": "99",
"output": "2"
},
{
"input": "100",
"output": "1"
},
{
"input": "123456789",
"output": "2"
},
{
"input": "32",
"output": "1"
},
{
"input": "86",
"output": "2"
},
{
"input": "2",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "34",
"output": "1"
},
{
"input": "13",
"output": "1"
},
{
"input": "28",
"output": "2"
},
{
"input": "23",
"output": "1"
},
{
"input": "57",
"output": "2"
},
{
"input": "29",
"output": "2"
},
{
"input": "353869285",
"output": "3"
},
{
"input": "549548646",
"output": "2"
},
{
"input": "858893424",
"output": "2"
},
{
"input": "644818852",
"output": "3"
},
{
"input": "360322525",
"output": "3"
},
{
"input": "122937520",
"output": "2"
},
{
"input": "288403032",
"output": "2"
},
{
"input": "677257481",
"output": "3"
},
{
"input": "58059561",
"output": "3"
},
{
"input": "211288847",
"output": "2"
},
{
"input": "339900034079539584",
"output": "2"
},
{
"input": "784084029310269952",
"output": "3"
},
{
"input": "774730557264864000",
"output": "3"
},
{
"input": "478233807148352256",
"output": "3"
},
{
"input": "165646874056812544",
"output": "3"
},
{
"input": "477533739511673792",
"output": "3"
},
{
"input": "660119944377002240",
"output": "3"
},
{
"input": "448375218506078080",
"output": "3"
},
{
"input": "77213334785795616",
"output": "3"
},
{
"input": "165767221702271872",
"output": "3"
},
{
"input": "1",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "156161456146164104103460452045416165146141414651641564105461465156445621465146514562146145465165145145614561465145614561",
"output": "3"
},
{
"input": "9",
"output": "0"
}
] | 1,596,712,617
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 51
| 1,308
| 28,160,000
|
import sys
import math
input = sys.stdin.readline
def solve():
def magic(n):
return sum([int(ch) for ch in str(n)])
n = int(input().strip())
ans = 0
while n >= 10:
ans += 1
n = magic(n)
print(ans)
if __name__ == '__main__':
solve()
|
Title: Sum of Digits
Time Limit: 2 seconds
Memory Limit: 265 megabytes
Problem Description:
Having watched the last Harry Potter film, little Gerald also decided to practice magic. He found in his father's magical book a spell that turns any number in the sum of its digits. At the moment Gerald learned that, he came across a number *n*. How many times can Gerald put a spell on it until the number becomes one-digit?
Input Specification:
The first line contains the only integer *n* (0<=≤<=*n*<=≤<=10100000). It is guaranteed that *n* doesn't contain any leading zeroes.
Output Specification:
Print the number of times a number can be replaced by the sum of its digits until it only contains one digit.
Demo Input:
['0\n', '10\n', '991\n']
Demo Output:
['0\n', '1\n', '3\n']
Note:
In the first sample the number already is one-digit — Herald can't cast a spell.
The second test contains number 10. After one casting of a spell it becomes 1, and here the process is completed. Thus, Gerald can only cast the spell once.
The third test contains number 991. As one casts a spell the following transformations take place: 991 → 19 → 10 → 1. After three transformations the number becomes one-digit.
|
```python
import sys
import math
input = sys.stdin.readline
def solve():
def magic(n):
return sum([int(ch) for ch in str(n)])
n = int(input().strip())
ans = 0
while n >= 10:
ans += 1
n = magic(n)
print(ans)
if __name__ == '__main__':
solve()
```
| 3.622329
|
883
|
A
|
Automatic Door
|
PROGRAMMING
| 2,200
|
[
"implementation"
] | null | null |
There is an automatic door at the entrance of a factory. The door works in the following way:
- when one or several people come to the door and it is closed, the door immediately opens automatically and all people immediately come inside, - when one or several people come to the door and it is open, all people immediately come inside, - opened door immediately closes in *d* seconds after its opening, - if the door is closing and one or several people are coming to the door at the same moment, then all of them will have enough time to enter and only after that the door will close.
For example, if *d*<==<=3 and four people are coming at four different moments of time *t*1<==<=4, *t*2<==<=7, *t*3<==<=9 and *t*4<==<=13 then the door will open three times: at moments 4, 9 and 13. It will close at moments 7 and 12.
It is known that *n* employees will enter at moments *a*,<=2·*a*,<=3·*a*,<=...,<=*n*·*a* (the value *a* is positive integer). Also *m* clients will enter at moments *t*1,<=*t*2,<=...,<=*t**m*.
Write program to find the number of times the automatic door will open. Assume that the door is initially closed.
|
The first line contains four integers *n*, *m*, *a* and *d* (1<=≤<=*n*,<=*a*<=≤<=109, 1<=≤<=*m*<=≤<=105, 1<=≤<=*d*<=≤<=1018) — the number of the employees, the number of the clients, the moment of time when the first employee will come and the period of time in which the door closes.
The second line contains integer sequence *t*1,<=*t*2,<=...,<=*t**m* (1<=≤<=*t**i*<=≤<=1018) — moments of time when clients will come. The values *t**i* are given in non-decreasing order.
|
Print the number of times the door will open.
|
[
"1 1 3 4\n7\n",
"4 3 4 2\n7 9 11\n"
] |
[
"1\n",
"4\n"
] |
In the first example the only employee will come at moment 3. At this moment the door will open and will stay open until the moment 7. At the same moment of time the client will come, so at first he will enter and only after it the door will close. Thus the door will open one time.
| 0
|
[
{
"input": "1 1 3 4\n7",
"output": "1"
},
{
"input": "4 3 4 2\n7 9 11",
"output": "4"
},
{
"input": "10 10 51 69\n154 170 170 183 251 337 412 426 445 452",
"output": "6"
},
{
"input": "70 10 26 17\n361 371 579 585 629 872 944 1017 1048 1541",
"output": "70"
},
{
"input": "100 20 49 52\n224 380 690 1585 1830 1973 2490 2592 3240 3341 3406 3429 3549 3560 3895 3944 4344 4390 4649 4800",
"output": "55"
},
{
"input": "100 30 36 47\n44 155 275 390 464 532 1186 1205 1345 1349 1432 1469 1482 1775 1832 1856 1869 2049 2079 2095 2374 2427 2577 2655 2792 2976 3020 3317 3482 3582",
"output": "51"
},
{
"input": "97 60 1 1\n5 6 6 7 9 10 10 11 11 11 12 13 13 13 13 14 14 15 16 18 20 23 23 24 25 26 29 31 32 35 38 41 43 43 46 47 48 48 49 52 53 54 55 56 58 59 68 70 72 74 78 81 81 82 91 92 96 96 97 98",
"output": "49"
},
{
"input": "1000000000 1 157 468\n57575875712",
"output": "333333334"
},
{
"input": "1000000000 1 1000000000 1000000000000000000\n1000000000000000000",
"output": "1"
}
] | 1,509,812,638
| 838
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 10
| 108
| 9,318,400
|
import sys
def readIntLine():
return [int(n) for n in next(sys.stdin).strip().split()]
N, M, A, D = readIntLine()
times = readIntLine()
eTimes = list(range(A, A + N * A, A))
times = sorted(times + eTimes)
c = -1
count = 0
for t in times:
if t <= c:
continue
c = t + D
count += 1
print(count)
|
Title: Automatic Door
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is an automatic door at the entrance of a factory. The door works in the following way:
- when one or several people come to the door and it is closed, the door immediately opens automatically and all people immediately come inside, - when one or several people come to the door and it is open, all people immediately come inside, - opened door immediately closes in *d* seconds after its opening, - if the door is closing and one or several people are coming to the door at the same moment, then all of them will have enough time to enter and only after that the door will close.
For example, if *d*<==<=3 and four people are coming at four different moments of time *t*1<==<=4, *t*2<==<=7, *t*3<==<=9 and *t*4<==<=13 then the door will open three times: at moments 4, 9 and 13. It will close at moments 7 and 12.
It is known that *n* employees will enter at moments *a*,<=2·*a*,<=3·*a*,<=...,<=*n*·*a* (the value *a* is positive integer). Also *m* clients will enter at moments *t*1,<=*t*2,<=...,<=*t**m*.
Write program to find the number of times the automatic door will open. Assume that the door is initially closed.
Input Specification:
The first line contains four integers *n*, *m*, *a* and *d* (1<=≤<=*n*,<=*a*<=≤<=109, 1<=≤<=*m*<=≤<=105, 1<=≤<=*d*<=≤<=1018) — the number of the employees, the number of the clients, the moment of time when the first employee will come and the period of time in which the door closes.
The second line contains integer sequence *t*1,<=*t*2,<=...,<=*t**m* (1<=≤<=*t**i*<=≤<=1018) — moments of time when clients will come. The values *t**i* are given in non-decreasing order.
Output Specification:
Print the number of times the door will open.
Demo Input:
['1 1 3 4\n7\n', '4 3 4 2\n7 9 11\n']
Demo Output:
['1\n', '4\n']
Note:
In the first example the only employee will come at moment 3. At this moment the door will open and will stay open until the moment 7. At the same moment of time the client will come, so at first he will enter and only after it the door will close. Thus the door will open one time.
|
```python
import sys
def readIntLine():
return [int(n) for n in next(sys.stdin).strip().split()]
N, M, A, D = readIntLine()
times = readIntLine()
eTimes = list(range(A, A + N * A, A))
times = sorted(times + eTimes)
c = -1
count = 0
for t in times:
if t <= c:
continue
c = t + D
count += 1
print(count)
```
| -1
|
|
622
|
A
|
Infinite Sequence
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] | null | null |
Consider the infinite sequence of integers: 1,<=1,<=2,<=1,<=2,<=3,<=1,<=2,<=3,<=4,<=1,<=2,<=3,<=4,<=5.... The sequence is built in the following way: at first the number 1 is written out, then the numbers from 1 to 2, then the numbers from 1 to 3, then the numbers from 1 to 4 and so on. Note that the sequence contains numbers, not digits. For example number 10 first appears in the sequence in position 55 (the elements are numerated from one).
Find the number on the *n*-th position of the sequence.
|
The only line contains integer *n* (1<=≤<=*n*<=≤<=1014) — the position of the number to find.
Note that the given number is too large, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
|
Print the element in the *n*-th position of the sequence (the elements are numerated from one).
|
[
"3\n",
"5\n",
"10\n",
"55\n",
"56\n"
] |
[
"2\n",
"2\n",
"4\n",
"10\n",
"1\n"
] |
none
| 0
|
[
{
"input": "3",
"output": "2"
},
{
"input": "5",
"output": "2"
},
{
"input": "10",
"output": "4"
},
{
"input": "55",
"output": "10"
},
{
"input": "56",
"output": "1"
},
{
"input": "1000000000000",
"output": "88209"
},
{
"input": "847194127849",
"output": "255708"
},
{
"input": "294719472984",
"output": "593358"
},
{
"input": "999999911791",
"output": "1414213"
},
{
"input": "999999911792",
"output": "1"
},
{
"input": "100000000000000",
"output": "1749820"
},
{
"input": "1",
"output": "1"
},
{
"input": "99993",
"output": "312"
},
{
"input": "99994",
"output": "313"
},
{
"input": "99995",
"output": "314"
},
{
"input": "99990",
"output": "309"
},
{
"input": "2",
"output": "1"
},
{
"input": "99991",
"output": "310"
},
{
"input": "99992",
"output": "311"
},
{
"input": "99996",
"output": "315"
},
{
"input": "99997",
"output": "316"
},
{
"input": "99998",
"output": "317"
},
{
"input": "99999",
"output": "318"
},
{
"input": "1021",
"output": "31"
},
{
"input": "4",
"output": "1"
},
{
"input": "23",
"output": "2"
},
{
"input": "9994",
"output": "124"
},
{
"input": "99939",
"output": "258"
},
{
"input": "99999998250180",
"output": "14142135"
},
{
"input": "6",
"output": "3"
},
{
"input": "8",
"output": "2"
},
{
"input": "35",
"output": "7"
},
{
"input": "100",
"output": "9"
},
{
"input": "10101010",
"output": "745"
},
{
"input": "103",
"output": "12"
},
{
"input": "102",
"output": "11"
},
{
"input": "101",
"output": "10"
}
] | 1,591,012,504
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 1,000
| 15,974,400
|
n = int(input())
pos = []
number = [1]
while len(pos)<n:
pos = pos + number
number.append(number[-1]+1)
print(pos[n-1])
|
Title: Infinite Sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Consider the infinite sequence of integers: 1,<=1,<=2,<=1,<=2,<=3,<=1,<=2,<=3,<=4,<=1,<=2,<=3,<=4,<=5.... The sequence is built in the following way: at first the number 1 is written out, then the numbers from 1 to 2, then the numbers from 1 to 3, then the numbers from 1 to 4 and so on. Note that the sequence contains numbers, not digits. For example number 10 first appears in the sequence in position 55 (the elements are numerated from one).
Find the number on the *n*-th position of the sequence.
Input Specification:
The only line contains integer *n* (1<=≤<=*n*<=≤<=1014) — the position of the number to find.
Note that the given number is too large, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
Output Specification:
Print the element in the *n*-th position of the sequence (the elements are numerated from one).
Demo Input:
['3\n', '5\n', '10\n', '55\n', '56\n']
Demo Output:
['2\n', '2\n', '4\n', '10\n', '1\n']
Note:
none
|
```python
n = int(input())
pos = []
number = [1]
while len(pos)<n:
pos = pos + number
number.append(number[-1]+1)
print(pos[n-1])
```
| 0
|
|
574
|
B
|
Bear and Three Musketeers
|
PROGRAMMING
| 1,500
|
[
"brute force",
"dfs and similar",
"graphs",
"hashing"
] | null | null |
Do you know a story about the three musketeers? Anyway, you will learn about its origins now.
Richelimakieu is a cardinal in the city of Bearis. He is tired of dealing with crime by himself. He needs three brave warriors to help him to fight against bad guys.
There are *n* warriors. Richelimakieu wants to choose three of them to become musketeers but it's not that easy. The most important condition is that musketeers must know each other to cooperate efficiently. And they shouldn't be too well known because they could be betrayed by old friends. For each musketeer his recognition is the number of warriors he knows, excluding other two musketeers.
Help Richelimakieu! Find if it is possible to choose three musketeers knowing each other, and what is minimum possible sum of their recognitions.
|
The first line contains two space-separated integers, *n* and *m* (3<=≤<=*n*<=≤<=4000, 0<=≤<=*m*<=≤<=4000) — respectively number of warriors and number of pairs of warriors knowing each other.
*i*-th of the following *m* lines contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*). Warriors *a**i* and *b**i* know each other. Each pair of warriors will be listed at most once.
|
If Richelimakieu can choose three musketeers, print the minimum possible sum of their recognitions. Otherwise, print "-1" (without the quotes).
|
[
"5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5\n",
"7 4\n2 1\n3 6\n5 1\n1 7\n"
] |
[
"2\n",
"-1\n"
] |
In the first sample Richelimakieu should choose a triple 1, 2, 3. The first musketeer doesn't know anyone except other two musketeers so his recognition is 0. The second musketeer has recognition 1 because he knows warrior number 4. The third musketeer also has recognition 1 because he knows warrior 4. Sum of recognitions is 0 + 1 + 1 = 2.
The other possible triple is 2, 3, 4 but it has greater sum of recognitions, equal to 1 + 1 + 1 = 3.
In the second sample there is no triple of warriors knowing each other.
| 1,000
|
[
{
"input": "5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5",
"output": "2"
},
{
"input": "7 4\n2 1\n3 6\n5 1\n1 7",
"output": "-1"
},
{
"input": "5 0",
"output": "-1"
},
{
"input": "7 14\n3 6\n2 3\n5 2\n5 6\n7 5\n7 4\n6 2\n3 5\n7 1\n4 1\n6 1\n7 6\n6 4\n5 4",
"output": "5"
},
{
"input": "15 15\n4 15\n12 1\n15 6\n11 6\n15 7\n6 8\n15 10\n6 12\n12 8\n15 8\n15 3\n11 9\n7 3\n6 4\n12 11",
"output": "4"
},
{
"input": "12 66\n9 12\n1 4\n8 4\n5 3\n10 5\n12 2\n3 2\n2 7\n1 7\n3 7\n6 2\n4 2\n6 10\n8 10\n4 6\n8 5\n12 6\n11 9\n7 12\n5 4\n11 7\n9 4\n10 4\n6 3\n1 6\n9 7\n3 8\n6 11\n10 9\n3 11\n11 1\n5 12\n8 2\n2 1\n3 1\n12 4\n3 9\n10 12\n8 11\n7 10\n11 5\n9 5\n8 7\n11 4\n8 1\n2 11\n5 1\n3 4\n8 12\n9 2\n10 11\n9 1\n5 7\n10 3\n11 12\n7 4\n2 10\n12 3\n6 8\n7 6\n2 5\n1 10\n12 1\n9 6\n8 9\n6 5",
"output": "27"
},
{
"input": "3 0",
"output": "-1"
},
{
"input": "3 2\n2 3\n2 1",
"output": "-1"
},
{
"input": "3 3\n3 1\n3 2\n2 1",
"output": "0"
},
{
"input": "4 6\n3 4\n1 3\n4 1\n3 2\n2 1\n4 2",
"output": "3"
},
{
"input": "8 10\n1 5\n4 1\n1 2\n2 8\n2 7\n6 3\n5 8\n3 5\n7 8\n1 6",
"output": "2"
},
{
"input": "15 17\n1 3\n7 10\n7 9\n8 13\n6 15\n8 2\n13 6\n10 5\n15 3\n4 15\n4 6\n5 11\n13 9\n12 2\n11 14\n4 12\n14 1",
"output": "3"
},
{
"input": "25 10\n19 11\n19 13\n13 11\n13 22\n19 23\n19 20\n13 17\n19 14\n13 15\n19 4",
"output": "7"
},
{
"input": "987 50\n221 959\n221 553\n959 695\n553 959\n819 437\n371 295\n695 553\n959 347\n595 699\n652 628\n553 347\n868 589\n695 221\n282 714\n351 703\n104 665\n755 436\n556 511\n695 347\n221 347\n243 874\n695 847\n863 501\n583 145\n786 221\n38 286\n72 397\n808 658\n724 437\n911 548\n405 759\n681 316\n648 328\n327 199\n772 139\n932 609\n859 576\n915 507\n379 316\n381 348\n918 871\n261 450\n443 389\n549 246\n901 515\n930 923\n336 545\n179 225\n213 677\n458 204",
"output": "6"
},
{
"input": "4000 0",
"output": "-1"
}
] | 1,557,423,101
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 39
| 2,000
| 34,816,000
|
def dfs(no_at, pai, princ, i):
if i == 3:
if princ in adj[no_at]:
respostas.append((princ, pai, no_at))
return
for child in adj[no_at]:
if child == pai: continue
dfs(child, no_at, princ, i+1)
m, n = map(int, input().split())
adj = [[] for i in range(m+1)]
for i in range(n):
a, b = map(int, input().split())
adj[a].append(b)
adj[b].append(a)
respostas = []
for i in range(1, m+1):
dfs(i,i,i,1)
menor = float("inf")
for x, y, z in respostas:
s = len(adj[x]) - 2 + len(adj[y]) - 2 + len(adj[z]) - 2
if s < menor: menor = s
print(-1) if menor == float("inf") else print(menor)
|
Title: Bear and Three Musketeers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Do you know a story about the three musketeers? Anyway, you will learn about its origins now.
Richelimakieu is a cardinal in the city of Bearis. He is tired of dealing with crime by himself. He needs three brave warriors to help him to fight against bad guys.
There are *n* warriors. Richelimakieu wants to choose three of them to become musketeers but it's not that easy. The most important condition is that musketeers must know each other to cooperate efficiently. And they shouldn't be too well known because they could be betrayed by old friends. For each musketeer his recognition is the number of warriors he knows, excluding other two musketeers.
Help Richelimakieu! Find if it is possible to choose three musketeers knowing each other, and what is minimum possible sum of their recognitions.
Input Specification:
The first line contains two space-separated integers, *n* and *m* (3<=≤<=*n*<=≤<=4000, 0<=≤<=*m*<=≤<=4000) — respectively number of warriors and number of pairs of warriors knowing each other.
*i*-th of the following *m* lines contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*). Warriors *a**i* and *b**i* know each other. Each pair of warriors will be listed at most once.
Output Specification:
If Richelimakieu can choose three musketeers, print the minimum possible sum of their recognitions. Otherwise, print "-1" (without the quotes).
Demo Input:
['5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5\n', '7 4\n2 1\n3 6\n5 1\n1 7\n']
Demo Output:
['2\n', '-1\n']
Note:
In the first sample Richelimakieu should choose a triple 1, 2, 3. The first musketeer doesn't know anyone except other two musketeers so his recognition is 0. The second musketeer has recognition 1 because he knows warrior number 4. The third musketeer also has recognition 1 because he knows warrior 4. Sum of recognitions is 0 + 1 + 1 = 2.
The other possible triple is 2, 3, 4 but it has greater sum of recognitions, equal to 1 + 1 + 1 = 3.
In the second sample there is no triple of warriors knowing each other.
|
```python
def dfs(no_at, pai, princ, i):
if i == 3:
if princ in adj[no_at]:
respostas.append((princ, pai, no_at))
return
for child in adj[no_at]:
if child == pai: continue
dfs(child, no_at, princ, i+1)
m, n = map(int, input().split())
adj = [[] for i in range(m+1)]
for i in range(n):
a, b = map(int, input().split())
adj[a].append(b)
adj[b].append(a)
respostas = []
for i in range(1, m+1):
dfs(i,i,i,1)
menor = float("inf")
for x, y, z in respostas:
s = len(adj[x]) - 2 + len(adj[y]) - 2 + len(adj[z]) - 2
if s < menor: menor = s
print(-1) if menor == float("inf") else print(menor)
```
| 0
|
|
239
|
A
|
Two Bags of Potatoes
|
PROGRAMMING
| 1,200
|
[
"greedy",
"implementation",
"math"
] | null | null |
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
|
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
|
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
|
[
"10 1 10\n",
"10 6 40\n"
] |
[
"-1\n",
"2 8 14 20 26 \n"
] |
none
| 500
|
[
{
"input": "10 1 10",
"output": "-1"
},
{
"input": "10 6 40",
"output": "2 8 14 20 26 "
},
{
"input": "10 1 20",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "1 10000 1000000000",
"output": "9999 19999 29999 39999 49999 59999 69999 79999 89999 99999 109999 119999 129999 139999 149999 159999 169999 179999 189999 199999 209999 219999 229999 239999 249999 259999 269999 279999 289999 299999 309999 319999 329999 339999 349999 359999 369999 379999 389999 399999 409999 419999 429999 439999 449999 459999 469999 479999 489999 499999 509999 519999 529999 539999 549999 559999 569999 579999 589999 599999 609999 619999 629999 639999 649999 659999 669999 679999 689999 699999 709999 719999 729999 739999 7499..."
},
{
"input": "84817 1 33457",
"output": "-1"
},
{
"input": "21 37 99",
"output": "16 53 "
},
{
"input": "78 7 15",
"output": "-1"
},
{
"input": "74 17 27",
"output": "-1"
},
{
"input": "79 23 43",
"output": "-1"
},
{
"input": "32 33 3",
"output": "-1"
},
{
"input": "55 49 44",
"output": "-1"
},
{
"input": "64 59 404",
"output": "54 113 172 231 290 "
},
{
"input": "61 69 820",
"output": "8 77 146 215 284 353 422 491 560 629 698 "
},
{
"input": "17 28 532",
"output": "11 39 67 95 123 151 179 207 235 263 291 319 347 375 403 431 459 487 515 "
},
{
"input": "46592 52 232",
"output": "-1"
},
{
"input": "1541 58 648",
"output": "-1"
},
{
"input": "15946 76 360",
"output": "-1"
},
{
"input": "30351 86 424",
"output": "-1"
},
{
"input": "1 2 37493",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "1 3 27764",
"output": "2 5 8 11 14 17 20 23 26 29 32 35 38 41 44 47 50 53 56 59 62 65 68 71 74 77 80 83 86 89 92 95 98 101 104 107 110 113 116 119 122 125 128 131 134 137 140 143 146 149 152 155 158 161 164 167 170 173 176 179 182 185 188 191 194 197 200 203 206 209 212 215 218 221 224 227 230 233 236 239 242 245 248 251 254 257 260 263 266 269 272 275 278 281 284 287 290 293 296 299 302 305 308 311 314 317 320 323 326 329 332 335 338 341 344 347 350 353 356 359 362 365 368 371 374 377 380 383 386 389 392 395 398 401 404 407 410..."
},
{
"input": "10 4 9174",
"output": "2 6 10 14 18 22 26 30 34 38 42 46 50 54 58 62 66 70 74 78 82 86 90 94 98 102 106 110 114 118 122 126 130 134 138 142 146 150 154 158 162 166 170 174 178 182 186 190 194 198 202 206 210 214 218 222 226 230 234 238 242 246 250 254 258 262 266 270 274 278 282 286 290 294 298 302 306 310 314 318 322 326 330 334 338 342 346 350 354 358 362 366 370 374 378 382 386 390 394 398 402 406 410 414 418 422 426 430 434 438 442 446 450 454 458 462 466 470 474 478 482 486 490 494 498 502 506 510 514 518 522 526 530 534 53..."
},
{
"input": "33 7 4971",
"output": "2 9 16 23 30 37 44 51 58 65 72 79 86 93 100 107 114 121 128 135 142 149 156 163 170 177 184 191 198 205 212 219 226 233 240 247 254 261 268 275 282 289 296 303 310 317 324 331 338 345 352 359 366 373 380 387 394 401 408 415 422 429 436 443 450 457 464 471 478 485 492 499 506 513 520 527 534 541 548 555 562 569 576 583 590 597 604 611 618 625 632 639 646 653 660 667 674 681 688 695 702 709 716 723 730 737 744 751 758 765 772 779 786 793 800 807 814 821 828 835 842 849 856 863 870 877 884 891 898 905 912 919..."
},
{
"input": "981 1 3387",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "386 1 2747",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "123 2 50000",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 99 101 103 105 107 109 111 113 115 117 119 121 123 125 127 129 131 133 135 137 139 141 143 145 147 149 151 153 155 157 159 161 163 165 167 169 171 173 175 177 179 181 183 185 187 189 191 193 195 197 199 201 203 205 207 209 211 213 215 217 219 221 223 225 227 229 231 233 235 237 239 241 243 245 247 249 251 253 255 257 259 261 263 265 267 269 271 273 275 277 279 281 28..."
},
{
"input": "3123 100 10000000",
"output": "77 177 277 377 477 577 677 777 877 977 1077 1177 1277 1377 1477 1577 1677 1777 1877 1977 2077 2177 2277 2377 2477 2577 2677 2777 2877 2977 3077 3177 3277 3377 3477 3577 3677 3777 3877 3977 4077 4177 4277 4377 4477 4577 4677 4777 4877 4977 5077 5177 5277 5377 5477 5577 5677 5777 5877 5977 6077 6177 6277 6377 6477 6577 6677 6777 6877 6977 7077 7177 7277 7377 7477 7577 7677 7777 7877 7977 8077 8177 8277 8377 8477 8577 8677 8777 8877 8977 9077 9177 9277 9377 9477 9577 9677 9777 9877 9977 10077 10177 10277 1037..."
},
{
"input": "2 10000 1000000000",
"output": "9998 19998 29998 39998 49998 59998 69998 79998 89998 99998 109998 119998 129998 139998 149998 159998 169998 179998 189998 199998 209998 219998 229998 239998 249998 259998 269998 279998 289998 299998 309998 319998 329998 339998 349998 359998 369998 379998 389998 399998 409998 419998 429998 439998 449998 459998 469998 479998 489998 499998 509998 519998 529998 539998 549998 559998 569998 579998 589998 599998 609998 619998 629998 639998 649998 659998 669998 679998 689998 699998 709998 719998 729998 739998 7499..."
},
{
"input": "3 10000 1000000000",
"output": "9997 19997 29997 39997 49997 59997 69997 79997 89997 99997 109997 119997 129997 139997 149997 159997 169997 179997 189997 199997 209997 219997 229997 239997 249997 259997 269997 279997 289997 299997 309997 319997 329997 339997 349997 359997 369997 379997 389997 399997 409997 419997 429997 439997 449997 459997 469997 479997 489997 499997 509997 519997 529997 539997 549997 559997 569997 579997 589997 599997 609997 619997 629997 639997 649997 659997 669997 679997 689997 699997 709997 719997 729997 739997 7499..."
},
{
"input": "12312223 10000 1000000000",
"output": "7777 17777 27777 37777 47777 57777 67777 77777 87777 97777 107777 117777 127777 137777 147777 157777 167777 177777 187777 197777 207777 217777 227777 237777 247777 257777 267777 277777 287777 297777 307777 317777 327777 337777 347777 357777 367777 377777 387777 397777 407777 417777 427777 437777 447777 457777 467777 477777 487777 497777 507777 517777 527777 537777 547777 557777 567777 577777 587777 597777 607777 617777 627777 637777 647777 657777 667777 677777 687777 697777 707777 717777 727777 737777 7477..."
},
{
"input": "500000000 1000000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 1000000000",
"output": "999999999 "
},
{
"input": "10 6 11",
"output": "-1"
},
{
"input": "2 100 10",
"output": "-1"
},
{
"input": "1 100000007 1000000000",
"output": "100000006 200000013 300000020 400000027 500000034 600000041 700000048 800000055 900000062 "
},
{
"input": "1 999999999 1000000000",
"output": "999999998 "
},
{
"input": "100000000 1000000000 1000000000",
"output": "900000000 "
},
{
"input": "11 2 12",
"output": "1 "
},
{
"input": "31 10 39",
"output": "-1"
},
{
"input": "48 6 50",
"output": "-1"
},
{
"input": "500000000 500000000 1000000000",
"output": "500000000 "
},
{
"input": "1 1000000000 999999999",
"output": "-1"
},
{
"input": "4 2 10",
"output": "2 4 6 "
},
{
"input": "1000000000 1 1",
"output": "-1"
},
{
"input": "1000000000 1 100000",
"output": "-1"
},
{
"input": "1000000000 1 10",
"output": "-1"
},
{
"input": "10 5 14",
"output": "-1"
},
{
"input": "500000000 499999999 1000000000",
"output": "499999998 "
},
{
"input": "1 999999997 1000000000",
"output": "999999996 "
}
] | 1,618,295,770
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 92
| 0
|
def solution():
#why
y,k,n=map(int,input().split())
ans=[]
mul=1
while mul*k<=n:
if (mul*k)>y:
ans.append((mul*k)-y)
mul+=1
if ans:
print(*ans[::-1])
else:
print(-1)
solution()
|
Title: Two Bags of Potatoes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera had two bags of potatoes, the first of these bags contains *x* (*x*<=≥<=1) potatoes, and the second — *y* (*y*<=≥<=1) potatoes. Valera — very scattered boy, so the first bag of potatoes (it contains *x* potatoes) Valera lost. Valera remembers that the total amount of potatoes (*x*<=+<=*y*) in the two bags, firstly, was not gerater than *n*, and, secondly, was divisible by *k*.
Help Valera to determine how many potatoes could be in the first bag. Print all such possible numbers in ascending order.
Input Specification:
The first line of input contains three integers *y*, *k*, *n* (1<=≤<=*y*,<=*k*,<=*n*<=≤<=109; <=≤<=105).
Output Specification:
Print the list of whitespace-separated integers — all possible values of *x* in ascending order. You should print each possible value of *x* exactly once.
If there are no such values of *x* print a single integer -1.
Demo Input:
['10 1 10\n', '10 6 40\n']
Demo Output:
['-1\n', '2 8 14 20 26 \n']
Note:
none
|
```python
def solution():
#why
y,k,n=map(int,input().split())
ans=[]
mul=1
while mul*k<=n:
if (mul*k)>y:
ans.append((mul*k)-y)
mul+=1
if ans:
print(*ans[::-1])
else:
print(-1)
solution()
```
| 0
|
|
389
|
A
|
Fox and Number Game
|
PROGRAMMING
| 1,000
|
[
"greedy",
"math"
] | null | null |
Fox Ciel is playing a game with numbers now.
Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* > *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible.
Please help Ciel to find this minimal sum.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100).
|
Output a single integer — the required minimal sum.
|
[
"2\n1 2\n",
"3\n2 4 6\n",
"2\n12 18\n",
"5\n45 12 27 30 18\n"
] |
[
"2\n",
"6\n",
"12\n",
"15\n"
] |
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
| 500
|
[
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n2 4 6",
"output": "6"
},
{
"input": "2\n12 18",
"output": "12"
},
{
"input": "5\n45 12 27 30 18",
"output": "15"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n100 100",
"output": "200"
},
{
"input": "2\n87 58",
"output": "58"
},
{
"input": "39\n52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52",
"output": "2028"
},
{
"input": "59\n96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96",
"output": "5664"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "10000"
},
{
"input": "100\n70 70 77 42 98 84 56 91 35 21 7 70 77 77 56 63 14 84 56 14 77 77 63 70 14 7 28 91 63 49 21 84 98 56 77 98 98 84 98 14 7 56 49 28 91 98 7 56 14 91 14 98 49 28 98 14 98 98 14 70 35 28 63 28 49 63 63 56 91 98 35 42 42 35 63 35 42 14 63 21 77 56 42 77 35 91 56 21 28 84 56 70 70 91 98 70 84 63 21 98",
"output": "700"
},
{
"input": "39\n63 21 21 42 21 63 21 84 42 21 84 63 42 63 84 84 84 42 42 84 21 63 42 63 42 42 63 42 42 63 84 42 21 84 21 63 42 21 42",
"output": "819"
},
{
"input": "59\n70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70",
"output": "4130"
},
{
"input": "87\n44 88 88 88 88 66 88 22 22 88 88 44 88 22 22 22 88 88 88 88 66 22 88 88 88 88 66 66 44 88 44 44 66 22 88 88 22 44 66 44 88 66 66 22 22 22 22 88 22 22 44 66 88 22 22 88 66 66 88 22 66 88 66 88 66 44 88 44 22 44 44 22 44 88 44 44 44 44 22 88 88 88 66 66 88 44 22",
"output": "1914"
},
{
"input": "15\n63 63 63 63 63 63 63 63 63 63 63 63 63 63 63",
"output": "945"
},
{
"input": "39\n63 77 21 14 14 35 21 21 70 42 21 70 28 77 28 77 7 42 63 7 98 49 98 84 35 70 70 91 14 42 98 7 42 7 98 42 56 35 91",
"output": "273"
},
{
"input": "18\n18 18 18 36 36 36 54 72 54 36 72 54 36 36 36 36 18 36",
"output": "324"
},
{
"input": "46\n71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71",
"output": "3266"
},
{
"input": "70\n66 11 66 11 44 11 44 99 55 22 88 11 11 22 55 44 22 77 44 77 77 22 44 55 88 11 99 99 88 22 77 77 66 11 11 66 99 55 55 44 66 44 77 44 44 55 33 55 44 88 77 77 22 66 33 44 11 22 55 44 22 66 77 33 33 44 44 44 22 33",
"output": "770"
},
{
"input": "10\n60 12 96 48 60 24 60 36 60 60",
"output": "120"
},
{
"input": "20\n51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51",
"output": "1020"
},
{
"input": "50\n58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58",
"output": "2900"
},
{
"input": "98\n70 60 100 30 70 20 30 50 50 30 90 40 30 40 60 80 60 60 80 50 10 80 20 10 20 10 50 70 30 80 30 50 60 90 90 100 60 30 90 20 30 60 90 80 60 60 10 90 10 50 40 40 80 90 100 40 70 40 30 50 60 50 60 30 40 20 90 60 20 20 20 70 60 70 50 100 90 50 20 40 80 60 10 60 50 40 40 10 50 10 40 10 80 100 100 90 10 90",
"output": "980"
},
{
"input": "100\n82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82",
"output": "8200"
},
{
"input": "100\n11 87 77 93 3 54 21 93 9 71 37 23 69 85 74 3 48 99 51 31 56 19 21 96 39 6 4 4 29 69 100 42 1 22 81 53 48 49 81 61 10 7 40 61 7 71 51 59 79 44 50 35 95 80 83 8 98 40 18 94 84 49 52 74 66 69 39 37 100 44 38 62 2 80 46 31 35 53 5 60 21 49 63 55 20 53 80 53 66 34 23 92 77 50 86 63 65 24 12 70",
"output": "100"
},
{
"input": "2\n100 1",
"output": "2"
},
{
"input": "2\n18 30",
"output": "12"
},
{
"input": "2\n3 5",
"output": "2"
},
{
"input": "2\n1 10",
"output": "2"
},
{
"input": "2\n8 5",
"output": "2"
},
{
"input": "5\n2 3 5 8 18",
"output": "5"
},
{
"input": "5\n2 4 1 6 8",
"output": "5"
},
{
"input": "3\n12 10 5",
"output": "3"
},
{
"input": "3\n6 10 15",
"output": "3"
}
] | 1,467,116,793
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 78
| 0
|
n = int(input())
a = [int(x) for x in input().split()]
while any(x != a[0] for x in a):
a.sort()
a = [a[i] - a[0] if a[i] > a[0] else a[i] for i in range(0, n)]
print(sum(a))
|
Title: Fox and Number Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel is playing a game with numbers now.
Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* > *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible.
Please help Ciel to find this minimal sum.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100).
Output Specification:
Output a single integer — the required minimal sum.
Demo Input:
['2\n1 2\n', '3\n2 4 6\n', '2\n12 18\n', '5\n45 12 27 30 18\n']
Demo Output:
['2\n', '6\n', '12\n', '15\n']
Note:
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
|
```python
n = int(input())
a = [int(x) for x in input().split()]
while any(x != a[0] for x in a):
a.sort()
a = [a[i] - a[0] if a[i] > a[0] else a[i] for i in range(0, n)]
print(sum(a))
```
| 3
|
|
124
|
A
|
The number of positions
|
PROGRAMMING
| 1,000
|
[
"math"
] | null | null |
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
|
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
|
Print the single number — the number of the sought positions.
|
[
"3 1 1\n",
"5 2 3\n"
] |
[
"2\n",
"3\n"
] |
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5.
| 500
|
[
{
"input": "3 1 1",
"output": "2"
},
{
"input": "5 2 3",
"output": "3"
},
{
"input": "5 4 0",
"output": "1"
},
{
"input": "6 5 5",
"output": "1"
},
{
"input": "9 4 3",
"output": "4"
},
{
"input": "11 4 6",
"output": "7"
},
{
"input": "13 8 7",
"output": "5"
},
{
"input": "14 5 5",
"output": "6"
},
{
"input": "16 6 9",
"output": "10"
},
{
"input": "20 13 17",
"output": "7"
},
{
"input": "22 4 8",
"output": "9"
},
{
"input": "23 8 14",
"output": "15"
},
{
"input": "26 18 22",
"output": "8"
},
{
"input": "28 6 1",
"output": "2"
},
{
"input": "29 5 23",
"output": "24"
},
{
"input": "32 27 15",
"output": "5"
},
{
"input": "33 11 5",
"output": "6"
},
{
"input": "37 21 15",
"output": "16"
},
{
"input": "39 34 33",
"output": "5"
},
{
"input": "41 27 11",
"output": "12"
},
{
"input": "42 25 16",
"output": "17"
},
{
"input": "45 7 43",
"output": "38"
},
{
"input": "47 16 17",
"output": "18"
},
{
"input": "49 11 37",
"output": "38"
},
{
"input": "51 38 39",
"output": "13"
},
{
"input": "52 29 7",
"output": "8"
},
{
"input": "56 43 12",
"output": "13"
},
{
"input": "58 57 28",
"output": "1"
},
{
"input": "59 12 39",
"output": "40"
},
{
"input": "62 9 52",
"output": "53"
},
{
"input": "63 29 44",
"output": "34"
},
{
"input": "65 30 22",
"output": "23"
},
{
"input": "66 27 38",
"output": "39"
},
{
"input": "71 33 53",
"output": "38"
},
{
"input": "73 14 12",
"output": "13"
},
{
"input": "73 37 35",
"output": "36"
},
{
"input": "76 69 44",
"output": "7"
},
{
"input": "79 25 20",
"output": "21"
},
{
"input": "81 60 20",
"output": "21"
},
{
"input": "81 79 14",
"output": "2"
},
{
"input": "84 0 42",
"output": "43"
},
{
"input": "88 79 8",
"output": "9"
},
{
"input": "90 76 59",
"output": "14"
},
{
"input": "92 2 22",
"output": "23"
},
{
"input": "94 5 88",
"output": "89"
},
{
"input": "94 62 48",
"output": "32"
},
{
"input": "96 22 72",
"output": "73"
},
{
"input": "100 11 88",
"output": "89"
},
{
"input": "100 81 91",
"output": "19"
},
{
"input": "1 0 0",
"output": "1"
}
] | 1,653,633,553
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 50
| 186
| 0
|
'''
╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬ ▓▓█████▓▓ ╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬
###########################
// •︿• \\
/\\ //\
/\\ //\
/\\//\
###########################
'''
import sys
input = lambda : sys.stdin.readline().strip()
import math as mt
from math import ceil as cl
from math import log2 as l2
mod = 10**9 + 7
def ii():
return int(input())
def lii():
return list(map(int, input().split()))
def ss():
return input()
def lss():
return list(map(str, input().split()))
def yes():
print("YES")
def no():
print("NO")
'''
╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬
'''
n,a,b = lii()
print(n-max(a+1,n-b)+1)
|
Title: The number of positions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
Input Specification:
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
Output Specification:
Print the single number — the number of the sought positions.
Demo Input:
['3 1 1\n', '5 2 3\n']
Demo Output:
['2\n', '3\n']
Note:
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5.
|
```python
'''
╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬ ▓▓█████▓▓ ╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬ ▓▓ ▓▓ ╬╬
╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬
###########################
// •︿• \\
/\\ //\
/\\ //\
/\\//\
###########################
'''
import sys
input = lambda : sys.stdin.readline().strip()
import math as mt
from math import ceil as cl
from math import log2 as l2
mod = 10**9 + 7
def ii():
return int(input())
def lii():
return list(map(int, input().split()))
def ss():
return input()
def lss():
return list(map(str, input().split()))
def yes():
print("YES")
def no():
print("NO")
'''
╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬╬
'''
n,a,b = lii()
print(n-max(a+1,n-b)+1)
```
| 3
|
|
981
|
B
|
Businessmen Problems
|
PROGRAMMING
| 1,000
|
[
"sortings"
] | null | null |
Two famous competing companies ChemForces and TopChemist decided to show their sets of recently discovered chemical elements on an exhibition. However they know that no element should be present in the sets of both companies.
In order to avoid this representatives of both companies decided to make an agreement on the sets the companies should present. The sets should be chosen in the way that maximizes the total income of the companies.
All elements are enumerated with integers. The ChemForces company has discovered $n$ distinct chemical elements with indices $a_1, a_2, \ldots, a_n$, and will get an income of $x_i$ Berland rubles if the $i$-th element from this list is in the set of this company.
The TopChemist company discovered $m$ distinct chemical elements with indices $b_1, b_2, \ldots, b_m$, and it will get an income of $y_j$ Berland rubles for including the $j$-th element from this list to its set.
In other words, the first company can present any subset of elements from $\{a_1, a_2, \ldots, a_n\}$ (possibly empty subset), the second company can present any subset of elements from $\{b_1, b_2, \ldots, b_m\}$ (possibly empty subset). There shouldn't be equal elements in the subsets.
Help the representatives select the sets in such a way that no element is presented in both sets and the total income is the maximum possible.
|
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the number of elements discovered by ChemForces.
The $i$-th of the next $n$ lines contains two integers $a_i$ and $x_i$ ($1 \leq a_i \leq 10^9$, $1 \leq x_i \leq 10^9$) — the index of the $i$-th element and the income of its usage on the exhibition. It is guaranteed that all $a_i$ are distinct.
The next line contains a single integer $m$ ($1 \leq m \leq 10^5$) — the number of chemicals invented by TopChemist.
The $j$-th of the next $m$ lines contains two integers $b_j$ and $y_j$, ($1 \leq b_j \leq 10^9$, $1 \leq y_j \leq 10^9$) — the index of the $j$-th element and the income of its usage on the exhibition. It is guaranteed that all $b_j$ are distinct.
|
Print the maximum total income you can obtain by choosing the sets for both companies in such a way that no element is presented in both sets.
|
[
"3\n1 2\n7 2\n3 10\n4\n1 4\n2 4\n3 4\n4 4\n",
"1\n1000000000 239\n3\n14 15\n92 65\n35 89\n"
] |
[
"24\n",
"408\n"
] |
In the first example ChemForces can choose the set ($3, 7$), while TopChemist can choose ($1, 2, 4$). This way the total income is $(10 + 2) + (4 + 4 + 4) = 24$.
In the second example ChemForces can choose the only element $10^9$, while TopChemist can choose ($14, 92, 35$). This way the total income is $(239) + (15 + 65 + 89) = 408$.
| 750
|
[
{
"input": "3\n1 2\n7 2\n3 10\n4\n1 4\n2 4\n3 4\n4 4",
"output": "24"
},
{
"input": "1\n1000000000 239\n3\n14 15\n92 65\n35 89",
"output": "408"
},
{
"input": "10\n598654597 488228616\n544064902 21923894\n329635457 980089248\n988262691 654502493\n967529230 543358150\n835120075 128123793\n809901567 613170206\n152157661 479980560\n859252956 318029856\n614959273 735298093\n10\n849172317 361325206\n341655282 740807372\n453949939 809030434\n813199219 765838311\n725032511 427644854\n631233366 115983627\n825067417 721190169\n463026366 953335259\n881501578 987288937\n500099903 427659916",
"output": "11272808994"
},
{
"input": "10\n598654597 488228616\n544064902 21923894\n329635457 980089248\n988262691 654502493\n967529230 543358150\n835120075 128123793\n809901567 613170206\n152157661 479980560\n859252956 318029856\n614959273 735298093\n10\n544064902 740807372\n859252956 765838311\n835120075 115983627\n825067417 463026366\n809901567 500099903\n614959273 322932832\n33955432 657532637\n816892960 927933923\n916770606 754371712\n967529230 566149252",
"output": "8955052582"
},
{
"input": "1\n259021863 682413763\n1\n554146726 693647287",
"output": "1376061050"
},
{
"input": "1\n259021863 682413763\n1\n554146726 425883728",
"output": "1108297491"
},
{
"input": "1\n1000000000 1\n1\n1000000000 1000000000",
"output": "1000000000"
},
{
"input": "2\n1 4\n2 4\n2\n1 4\n2 4",
"output": "8"
},
{
"input": "1\n14 15\n3\n35 89\n92 65\n1000000000 239",
"output": "408"
}
] | 1,530,010,019
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 33
| 826
| 23,756,800
|
n=int(input())
dict1={}
for i in range(n):
a,x=map(int,input().split())
dict1[a]=[x]
m=int(input())
for i in range(m):
a,x=map(int,input().split())
try:
dict1[a].append(x)
except:
KeyError
dict1[a]=[x]
ans=0
for i in dict1:
ans+=max(dict1[i])
print(ans)
|
Title: Businessmen Problems
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two famous competing companies ChemForces and TopChemist decided to show their sets of recently discovered chemical elements on an exhibition. However they know that no element should be present in the sets of both companies.
In order to avoid this representatives of both companies decided to make an agreement on the sets the companies should present. The sets should be chosen in the way that maximizes the total income of the companies.
All elements are enumerated with integers. The ChemForces company has discovered $n$ distinct chemical elements with indices $a_1, a_2, \ldots, a_n$, and will get an income of $x_i$ Berland rubles if the $i$-th element from this list is in the set of this company.
The TopChemist company discovered $m$ distinct chemical elements with indices $b_1, b_2, \ldots, b_m$, and it will get an income of $y_j$ Berland rubles for including the $j$-th element from this list to its set.
In other words, the first company can present any subset of elements from $\{a_1, a_2, \ldots, a_n\}$ (possibly empty subset), the second company can present any subset of elements from $\{b_1, b_2, \ldots, b_m\}$ (possibly empty subset). There shouldn't be equal elements in the subsets.
Help the representatives select the sets in such a way that no element is presented in both sets and the total income is the maximum possible.
Input Specification:
The first line contains a single integer $n$ ($1 \leq n \leq 10^5$) — the number of elements discovered by ChemForces.
The $i$-th of the next $n$ lines contains two integers $a_i$ and $x_i$ ($1 \leq a_i \leq 10^9$, $1 \leq x_i \leq 10^9$) — the index of the $i$-th element and the income of its usage on the exhibition. It is guaranteed that all $a_i$ are distinct.
The next line contains a single integer $m$ ($1 \leq m \leq 10^5$) — the number of chemicals invented by TopChemist.
The $j$-th of the next $m$ lines contains two integers $b_j$ and $y_j$, ($1 \leq b_j \leq 10^9$, $1 \leq y_j \leq 10^9$) — the index of the $j$-th element and the income of its usage on the exhibition. It is guaranteed that all $b_j$ are distinct.
Output Specification:
Print the maximum total income you can obtain by choosing the sets for both companies in such a way that no element is presented in both sets.
Demo Input:
['3\n1 2\n7 2\n3 10\n4\n1 4\n2 4\n3 4\n4 4\n', '1\n1000000000 239\n3\n14 15\n92 65\n35 89\n']
Demo Output:
['24\n', '408\n']
Note:
In the first example ChemForces can choose the set ($3, 7$), while TopChemist can choose ($1, 2, 4$). This way the total income is $(10 + 2) + (4 + 4 + 4) = 24$.
In the second example ChemForces can choose the only element $10^9$, while TopChemist can choose ($14, 92, 35$). This way the total income is $(239) + (15 + 65 + 89) = 408$.
|
```python
n=int(input())
dict1={}
for i in range(n):
a,x=map(int,input().split())
dict1[a]=[x]
m=int(input())
for i in range(m):
a,x=map(int,input().split())
try:
dict1[a].append(x)
except:
KeyError
dict1[a]=[x]
ans=0
for i in dict1:
ans+=max(dict1[i])
print(ans)
```
| 3
|
|
258
|
A
|
Little Elephant and Bits
|
PROGRAMMING
| 1,100
|
[
"greedy",
"math"
] | null | null |
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
|
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
|
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
|
[
"101\n",
"110010\n"
] |
[
"11\n",
"11010\n"
] |
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
| 500
|
[
{
"input": "101",
"output": "11"
},
{
"input": "110010",
"output": "11010"
},
{
"input": "10000",
"output": "1000"
},
{
"input": "1111111110",
"output": "111111111"
},
{
"input": "10100101011110101",
"output": "1100101011110101"
},
{
"input": "111010010111",
"output": "11110010111"
},
{
"input": "11110111011100000000",
"output": "1111111011100000000"
},
{
"input": "11110010010100001110110101110011110110100111101",
"output": "1111010010100001110110101110011110110100111101"
},
{
"input": "1001011111010010100111111",
"output": "101011111010010100111111"
},
{
"input": "1111111111",
"output": "111111111"
},
{
"input": "1111111111111111111100111101001110110111111000001111110101001101001110011000001011001111111000110101",
"output": "111111111111111111110111101001110110111111000001111110101001101001110011000001011001111111000110101"
},
{
"input": "11010110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100",
"output": "1110110000100100101111110111001001010011000011011000010010100111010101000111010011101101111110001111000101000001100011101110100"
},
{
"input": "11111111111111111111111110110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011",
"output": "1111111111111111111111111110111001101100111010010101101101001011100011011000111010011110010101100010001011101011010010100001000011100001101101001100010100001001010010100100001111110100110011000101100001111111011010111001011111110111101000100101001001011"
},
{
"input": "11100010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011",
"output": "1110010010010000110101101101100111111001010001101101001001111010110010111001011010000001100110101000101111000001111101111110010000010101110011110101101010110001100011101111011100010011101100111110010111111100110101000000111101000000000110100100101111101000110101010101101001110001110000101011010101100011100100111100010001011010010001100011111110010011010011000111000100111100010110100011010010101011011011111110100001110000011011"
},
{
"input": "11",
"output": "1"
},
{
"input": "111",
"output": "11"
},
{
"input": "111111",
"output": "11111"
},
{
"input": "11111",
"output": "1111"
},
{
"input": "1111",
"output": "111"
}
] | 1,643,395,080
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
bin_str = input()
for i in bin_str:
if i == '0':
bin_str = bin_str.replace(i, '', 1)
break
if '0' not in bin_str:
bin_str = bin_str.replace('1', '', 1)
print(bin_str)
|
Title: Little Elephant and Bits
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has an integer *a*, written in the binary notation. He wants to write this number on a piece of paper.
To make sure that the number *a* fits on the piece of paper, the Little Elephant ought to delete exactly one any digit from number *a* in the binary record. At that a new number appears. It consists of the remaining binary digits, written in the corresponding order (possible, with leading zeroes).
The Little Elephant wants the number he is going to write on the paper to be as large as possible. Help him find the maximum number that he can obtain after deleting exactly one binary digit and print it in the binary notation.
Input Specification:
The single line contains integer *a*, written in the binary notation without leading zeroes. This number contains more than 1 and at most 105 digits.
Output Specification:
In the single line print the number that is written without leading zeroes in the binary notation — the answer to the problem.
Demo Input:
['101\n', '110010\n']
Demo Output:
['11\n', '11010\n']
Note:
In the first sample the best strategy is to delete the second digit. That results in number 11<sub class="lower-index">2</sub> = 3<sub class="lower-index">10</sub>.
In the second sample the best strategy is to delete the third or fourth digits — that results in number 11010<sub class="lower-index">2</sub> = 26<sub class="lower-index">10</sub>.
|
```python
bin_str = input()
for i in bin_str:
if i == '0':
bin_str = bin_str.replace(i, '', 1)
break
if '0' not in bin_str:
bin_str = bin_str.replace('1', '', 1)
print(bin_str)
```
| 0
|
|
701
|
B
|
Cells Not Under Attack
|
PROGRAMMING
| 1,200
|
[
"data structures",
"math"
] | null | null |
Vasya has the square chessboard of size *n*<=×<=*n* and *m* rooks. Initially the chessboard is empty. Vasya will consequently put the rooks on the board one after another.
The cell of the field is under rook's attack, if there is at least one rook located in the same row or in the same column with this cell. If there is a rook located in the cell, this cell is also under attack.
You are given the positions of the board where Vasya will put rooks. For each rook you have to determine the number of cells which are not under attack after Vasya puts it on the board.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*m*<=≤<=*min*(100<=000,<=*n*2)) — the size of the board and the number of rooks.
Each of the next *m* lines contains integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*) — the number of the row and the number of the column where Vasya will put the *i*-th rook. Vasya puts rooks on the board in the order they appear in the input. It is guaranteed that any cell will contain no more than one rook.
|
Print *m* integer, the *i*-th of them should be equal to the number of cells that are not under attack after first *i* rooks are put.
|
[
"3 3\n1 1\n3 1\n2 2\n",
"5 2\n1 5\n5 1\n",
"100000 1\n300 400\n"
] |
[
"4 2 0 \n",
"16 9 \n",
"9999800001 \n"
] |
On the picture below show the state of the board after put each of the three rooks. The cells which painted with grey color is not under the attack.
| 750
|
[
{
"input": "3 3\n1 1\n3 1\n2 2",
"output": "4 2 0 "
},
{
"input": "5 2\n1 5\n5 1",
"output": "16 9 "
},
{
"input": "100000 1\n300 400",
"output": "9999800001 "
},
{
"input": "10 4\n2 8\n1 8\n9 8\n6 9",
"output": "81 72 63 48 "
},
{
"input": "30 30\n3 13\n27 23\n18 24\n18 19\n14 20\n7 10\n27 13\n20 27\n11 1\n21 10\n2 9\n28 12\n29 19\n28 27\n27 29\n30 12\n27 2\n4 5\n8 19\n21 2\n24 27\n14 22\n20 3\n18 3\n23 9\n28 6\n15 12\n2 2\n16 27\n1 14",
"output": "841 784 729 702 650 600 600 552 506 484 441 400 380 380 361 342 324 289 272 272 255 240 225 225 210 196 182 182 168 143 "
},
{
"input": "70 31\n22 39\n33 43\n50 27\n70 9\n20 67\n61 24\n60 4\n60 28\n4 25\n30 29\n46 47\n51 48\n37 5\n14 29\n45 44\n68 35\n52 21\n7 37\n18 43\n44 22\n26 12\n39 37\n51 55\n50 23\n51 16\n16 49\n22 62\n35 45\n56 2\n20 51\n3 37",
"output": "4761 4624 4489 4356 4225 4096 3969 3906 3782 3660 3540 3422 3306 3249 3136 3025 2916 2809 2756 2652 2550 2499 2450 2401 2352 2256 2208 2115 2024 1978 1935 "
},
{
"input": "330 17\n259 262\n146 20\n235 69\n84 74\n131 267\n153 101\n32 232\n214 212\n239 157\n121 156\n10 45\n266 78\n52 258\n109 279\n193 276\n239 142\n321 89",
"output": "108241 107584 106929 106276 105625 104976 104329 103684 103041 102400 101761 101124 100489 99856 99225 98910 98282 "
},
{
"input": "500 43\n176 85\n460 171\n233 260\n73 397\n474 35\n290 422\n309 318\n280 415\n485 169\n106 22\n355 129\n180 301\n205 347\n197 93\n263 318\n336 382\n314 350\n476 214\n367 277\n333 166\n500 376\n236 17\n94 73\n116 204\n166 50\n168 218\n144 369\n340 91\n274 360\n171 360\n41 251\n262 478\n27 163\n151 491\n208 415\n448 386\n293 486\n371 479\n330 435\n220 374\n163 316\n155 158\n26 126",
"output": "249001 248004 247009 246016 245025 244036 243049 242064 241081 240100 239121 238144 237169 236196 235710 234740 233772 232806 231842 230880 229920 228962 228006 227052 226100 225150 224202 223256 222312 221840 220899 219960 219023 218088 217620 216688 215758 214830 213904 212980 212058 211138 210220 "
},
{
"input": "99999 1\n54016 16192",
"output": "9999600004 "
},
{
"input": "99991 9\n80814 65974\n12100 98787\n9390 76191\n5628 47659\n80075 25361\n75330 1630\n38758 99962\n33848 40352\n43732 52281",
"output": "9998000100 9997800121 9997600144 9997400169 9997200196 9997000225 9996800256 9996600289 9996400324 "
},
{
"input": "1 1\n1 1",
"output": "0 "
}
] | 1,650,485,144
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 436
| 10,649,600
|
n, m = map(int, input().split())
rows = set()
columns = set()
answers = []
for i in range(m):
r, c = map(int, input().split())
rows.add(r)
columns.add(c)
answers.append((n-len(rows)) * (n-len(columns)))
for i in range(m):
if i == m-1:
print(answers[i])
else:
print(answers[i], end=' ')
|
Title: Cells Not Under Attack
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has the square chessboard of size *n*<=×<=*n* and *m* rooks. Initially the chessboard is empty. Vasya will consequently put the rooks on the board one after another.
The cell of the field is under rook's attack, if there is at least one rook located in the same row or in the same column with this cell. If there is a rook located in the cell, this cell is also under attack.
You are given the positions of the board where Vasya will put rooks. For each rook you have to determine the number of cells which are not under attack after Vasya puts it on the board.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*m*<=≤<=*min*(100<=000,<=*n*2)) — the size of the board and the number of rooks.
Each of the next *m* lines contains integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*) — the number of the row and the number of the column where Vasya will put the *i*-th rook. Vasya puts rooks on the board in the order they appear in the input. It is guaranteed that any cell will contain no more than one rook.
Output Specification:
Print *m* integer, the *i*-th of them should be equal to the number of cells that are not under attack after first *i* rooks are put.
Demo Input:
['3 3\n1 1\n3 1\n2 2\n', '5 2\n1 5\n5 1\n', '100000 1\n300 400\n']
Demo Output:
['4 2 0 \n', '16 9 \n', '9999800001 \n']
Note:
On the picture below show the state of the board after put each of the three rooks. The cells which painted with grey color is not under the attack.
|
```python
n, m = map(int, input().split())
rows = set()
columns = set()
answers = []
for i in range(m):
r, c = map(int, input().split())
rows.add(r)
columns.add(c)
answers.append((n-len(rows)) * (n-len(columns)))
for i in range(m):
if i == m-1:
print(answers[i])
else:
print(answers[i], end=' ')
```
| 3
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Hongcow is ruler of the world. As ruler of the world, he wants to make it easier for people to travel by road within their own countries.
The world can be modeled as an undirected graph with *n* nodes and *m* edges. *k* of the nodes are home to the governments of the *k* countries that make up the world.
There is at most one edge connecting any two nodes and no edge connects a node to itself. Furthermore, for any two nodes corresponding to governments, there is no path between those two nodes. Any graph that satisfies all of these conditions is stable.
Hongcow wants to add as many edges as possible to the graph while keeping it stable. Determine the maximum number of edges Hongcow can add.
|
The first line of input will contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=1<=000, 0<=≤<=*m*<=≤<=100<=000, 1<=≤<=*k*<=≤<=*n*) — the number of vertices and edges in the graph, and the number of vertices that are homes of the government.
The next line of input will contain *k* integers *c*1,<=*c*2,<=...,<=*c**k* (1<=≤<=*c**i*<=≤<=*n*). These integers will be pairwise distinct and denote the nodes that are home to the governments in this world.
The following *m* lines of input will contain two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*). This denotes an undirected edge between nodes *u**i* and *v**i*.
It is guaranteed that the graph described by the input is stable.
|
Output a single integer, the maximum number of edges Hongcow can add to the graph while keeping it stable.
|
[
"4 1 2\n1 3\n1 2\n",
"3 3 1\n2\n1 2\n1 3\n2 3\n"
] |
[
"2\n",
"0\n"
] |
For the first sample test, the graph looks like this:
For the second sample test, the graph looks like this:
| 0
|
[
{
"input": "4 1 2\n1 3\n1 2",
"output": "2"
},
{
"input": "3 3 1\n2\n1 2\n1 3\n2 3",
"output": "0"
},
{
"input": "10 3 2\n1 10\n1 2\n1 3\n4 5",
"output": "33"
},
{
"input": "1 0 1\n1",
"output": "0"
},
{
"input": "1000 0 1\n72",
"output": "499500"
},
{
"input": "24 38 2\n4 13\n7 1\n24 1\n2 8\n17 2\n2 18\n22 2\n23 3\n5 9\n21 5\n6 7\n6 19\n6 20\n11 7\n7 20\n13 8\n16 8\n9 10\n14 9\n21 9\n12 10\n10 22\n23 10\n17 11\n11 24\n20 12\n13 16\n13 23\n15 14\n17 14\n14 20\n19 16\n17 20\n17 23\n18 22\n18 23\n22 19\n21 20\n23 24",
"output": "215"
},
{
"input": "10 30 1\n4\n1 2\n3 1\n4 1\n1 6\n1 8\n10 1\n2 4\n2 7\n3 4\n3 5\n7 3\n3 9\n10 3\n5 4\n6 4\n7 4\n9 4\n10 4\n6 5\n5 8\n9 5\n10 5\n6 7\n9 6\n10 6\n7 8\n9 7\n10 7\n9 8\n10 8",
"output": "15"
},
{
"input": "10 13 2\n5 10\n2 1\n1 4\n2 3\n2 8\n3 4\n7 3\n4 6\n8 4\n4 9\n6 7\n6 9\n10 6\n7 8",
"output": "23"
},
{
"input": "10 10 3\n2 5 6\n1 3\n4 1\n4 3\n5 3\n3 9\n8 4\n9 4\n5 10\n8 7\n10 8",
"output": "18"
},
{
"input": "10 5 3\n1 5 9\n1 3\n1 8\n2 3\n8 4\n5 7",
"output": "17"
},
{
"input": "6 4 2\n1 4\n1 2\n2 3\n4 5\n5 6",
"output": "2"
},
{
"input": "7 8 2\n1 4\n1 2\n2 3\n4 5\n4 6\n4 7\n5 6\n5 7\n6 7",
"output": "1"
},
{
"input": "5 2 3\n1 3 4\n1 5\n2 4",
"output": "0"
},
{
"input": "5 3 2\n1 2\n2 3\n2 4\n1 5",
"output": "1"
},
{
"input": "9 5 2\n1 5\n1 2\n2 3\n3 4\n5 6\n6 7",
"output": "13"
},
{
"input": "6 4 1\n1\n2 3\n3 4\n4 5\n5 6",
"output": "11"
},
{
"input": "6 4 2\n1 5\n1 2\n2 3\n3 4\n5 6",
"output": "3"
},
{
"input": "7 3 3\n1 5 6\n1 2\n1 3\n6 7",
"output": "4"
},
{
"input": "5 2 2\n1 2\n1 3\n2 4",
"output": "2"
},
{
"input": "11 7 2\n1 4\n1 2\n1 3\n4 5\n4 6\n5 6\n9 10\n1 11",
"output": "24"
},
{
"input": "20 4 5\n1 3 9 10 20\n5 6\n1 2\n7 9\n4 10",
"output": "89"
}
] | 1,481,996,981
| 4,481
|
Python 3
|
OK
|
TESTS
| 61
| 374
| 7,782,400
|
def dfs(vertex, summ, has_capital, am):
summ += len(neigh[vertex])
am += 1
if vertex in capitals:
has_capital = True
used[vertex] = True
for nei in neigh[vertex]:
if not used[nei]:
tmp_c, am, summ = dfs(nei, summ, has_capital, am)
has_capital |= tmp_c
return [has_capital, am, summ]
n, m, k = [int(i) for i in input().split()]
neigh = []
for i in range(n):
neigh.append([])
capitals = [int(i) - 1 for i in input().split()]
for i in range(m):
u, v = [int(i) - 1 for i in input().split()]
neigh[u].append(v)
neigh[v].append(u)
result = 0
used = [False] * n
comp = []
while False in used:
comp.append(dfs(used.index(False), 0, False, 0))
comp[len(comp) - 1][2] /= 2
for i in range(len(comp)):
result -= comp[i][2]
comp.sort(reverse=True)
total_ns = comp[0][1]
for i in range(1, len(comp)):
if not comp[i][0]:
total_ns += comp[i][1]
else:
result += comp[i][1] * (comp[i][1] - 1) / 2
result += (total_ns) * (total_ns - 1) / 2
print(int(result))
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Hongcow is ruler of the world. As ruler of the world, he wants to make it easier for people to travel by road within their own countries.
The world can be modeled as an undirected graph with *n* nodes and *m* edges. *k* of the nodes are home to the governments of the *k* countries that make up the world.
There is at most one edge connecting any two nodes and no edge connects a node to itself. Furthermore, for any two nodes corresponding to governments, there is no path between those two nodes. Any graph that satisfies all of these conditions is stable.
Hongcow wants to add as many edges as possible to the graph while keeping it stable. Determine the maximum number of edges Hongcow can add.
Input Specification:
The first line of input will contain three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=1<=000, 0<=≤<=*m*<=≤<=100<=000, 1<=≤<=*k*<=≤<=*n*) — the number of vertices and edges in the graph, and the number of vertices that are homes of the government.
The next line of input will contain *k* integers *c*1,<=*c*2,<=...,<=*c**k* (1<=≤<=*c**i*<=≤<=*n*). These integers will be pairwise distinct and denote the nodes that are home to the governments in this world.
The following *m* lines of input will contain two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*). This denotes an undirected edge between nodes *u**i* and *v**i*.
It is guaranteed that the graph described by the input is stable.
Output Specification:
Output a single integer, the maximum number of edges Hongcow can add to the graph while keeping it stable.
Demo Input:
['4 1 2\n1 3\n1 2\n', '3 3 1\n2\n1 2\n1 3\n2 3\n']
Demo Output:
['2\n', '0\n']
Note:
For the first sample test, the graph looks like this:
For the second sample test, the graph looks like this:
|
```python
def dfs(vertex, summ, has_capital, am):
summ += len(neigh[vertex])
am += 1
if vertex in capitals:
has_capital = True
used[vertex] = True
for nei in neigh[vertex]:
if not used[nei]:
tmp_c, am, summ = dfs(nei, summ, has_capital, am)
has_capital |= tmp_c
return [has_capital, am, summ]
n, m, k = [int(i) for i in input().split()]
neigh = []
for i in range(n):
neigh.append([])
capitals = [int(i) - 1 for i in input().split()]
for i in range(m):
u, v = [int(i) - 1 for i in input().split()]
neigh[u].append(v)
neigh[v].append(u)
result = 0
used = [False] * n
comp = []
while False in used:
comp.append(dfs(used.index(False), 0, False, 0))
comp[len(comp) - 1][2] /= 2
for i in range(len(comp)):
result -= comp[i][2]
comp.sort(reverse=True)
total_ns = comp[0][1]
for i in range(1, len(comp)):
if not comp[i][0]:
total_ns += comp[i][1]
else:
result += comp[i][1] * (comp[i][1] - 1) / 2
result += (total_ns) * (total_ns - 1) / 2
print(int(result))
```
| 3
|
|
610
|
A
|
Pasha and Stick
|
PROGRAMMING
| 1,000
|
[
"combinatorics",
"math"
] | null | null |
Pasha has a wooden stick of some positive integer length *n*. He wants to perform exactly three cuts to get four parts of the stick. Each part must have some positive integer length and the sum of these lengths will obviously be *n*.
Pasha likes rectangles but hates squares, so he wonders, how many ways are there to split a stick into four parts so that it's possible to form a rectangle using these parts, but is impossible to form a square.
Your task is to help Pasha and count the number of such ways. Two ways to cut the stick are considered distinct if there exists some integer *x*, such that the number of parts of length *x* in the first way differ from the number of parts of length *x* in the second way.
|
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=2·109) — the length of Pasha's stick.
|
The output should contain a single integer — the number of ways to split Pasha's stick into four parts of positive integer length so that it's possible to make a rectangle by connecting the ends of these parts, but is impossible to form a square.
|
[
"6\n",
"20\n"
] |
[
"1\n",
"4\n"
] |
There is only one way to divide the stick in the first sample {1, 1, 2, 2}.
Four ways to divide the stick in the second sample are {1, 1, 9, 9}, {2, 2, 8, 8}, {3, 3, 7, 7} and {4, 4, 6, 6}. Note that {5, 5, 5, 5} doesn't work.
| 500
|
[
{
"input": "6",
"output": "1"
},
{
"input": "20",
"output": "4"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "2000000000",
"output": "499999999"
},
{
"input": "1924704072",
"output": "481176017"
},
{
"input": "73740586",
"output": "18435146"
},
{
"input": "1925088820",
"output": "481272204"
},
{
"input": "593070992",
"output": "148267747"
},
{
"input": "1925473570",
"output": "481368392"
},
{
"input": "629490186",
"output": "157372546"
},
{
"input": "1980649112",
"output": "495162277"
},
{
"input": "36661322",
"output": "9165330"
},
{
"input": "1943590793",
"output": "0"
},
{
"input": "71207034",
"output": "17801758"
},
{
"input": "1757577394",
"output": "439394348"
},
{
"input": "168305294",
"output": "42076323"
},
{
"input": "1934896224",
"output": "483724055"
},
{
"input": "297149088",
"output": "74287271"
},
{
"input": "1898001634",
"output": "474500408"
},
{
"input": "176409698",
"output": "44102424"
},
{
"input": "1873025522",
"output": "468256380"
},
{
"input": "5714762",
"output": "1428690"
},
{
"input": "1829551192",
"output": "457387797"
},
{
"input": "16269438",
"output": "4067359"
},
{
"input": "1663283390",
"output": "415820847"
},
{
"input": "42549941",
"output": "0"
},
{
"input": "1967345604",
"output": "491836400"
},
{
"input": "854000",
"output": "213499"
},
{
"input": "1995886626",
"output": "498971656"
},
{
"input": "10330019",
"output": "0"
},
{
"input": "1996193634",
"output": "499048408"
},
{
"input": "9605180",
"output": "2401294"
},
{
"input": "1996459740",
"output": "499114934"
},
{
"input": "32691948",
"output": "8172986"
},
{
"input": "1975903308",
"output": "493975826"
},
{
"input": "1976637136",
"output": "494159283"
},
{
"input": "29803038",
"output": "7450759"
},
{
"input": "1977979692",
"output": "494494922"
},
{
"input": "1978595336",
"output": "494648833"
},
{
"input": "27379344",
"output": "6844835"
},
{
"input": "1979729912",
"output": "494932477"
},
{
"input": "1980253780",
"output": "495063444"
},
{
"input": "1980751584",
"output": "495187895"
},
{
"input": "53224878",
"output": "13306219"
},
{
"input": "5",
"output": "0"
},
{
"input": "7",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "9",
"output": "0"
},
{
"input": "10",
"output": "2"
},
{
"input": "11",
"output": "0"
},
{
"input": "12",
"output": "2"
},
{
"input": "13",
"output": "0"
},
{
"input": "14",
"output": "3"
},
{
"input": "15",
"output": "0"
},
{
"input": "16",
"output": "3"
},
{
"input": "17",
"output": "0"
},
{
"input": "18",
"output": "4"
},
{
"input": "19",
"output": "0"
},
{
"input": "21",
"output": "0"
},
{
"input": "22",
"output": "5"
},
{
"input": "23",
"output": "0"
},
{
"input": "24",
"output": "5"
},
{
"input": "25",
"output": "0"
},
{
"input": "26",
"output": "6"
},
{
"input": "27",
"output": "0"
},
{
"input": "28",
"output": "6"
},
{
"input": "29",
"output": "0"
},
{
"input": "30",
"output": "7"
},
{
"input": "111",
"output": "0"
},
{
"input": "55",
"output": "0"
},
{
"input": "105",
"output": "0"
},
{
"input": "199",
"output": "0"
},
{
"input": "151",
"output": "0"
}
] | 1,540,796,233
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 0
|
n=int(input())
x=n//4
if x%4==0:
x-=1
if x%2==1:
x=0
print(x)
|
Title: Pasha and Stick
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has a wooden stick of some positive integer length *n*. He wants to perform exactly three cuts to get four parts of the stick. Each part must have some positive integer length and the sum of these lengths will obviously be *n*.
Pasha likes rectangles but hates squares, so he wonders, how many ways are there to split a stick into four parts so that it's possible to form a rectangle using these parts, but is impossible to form a square.
Your task is to help Pasha and count the number of such ways. Two ways to cut the stick are considered distinct if there exists some integer *x*, such that the number of parts of length *x* in the first way differ from the number of parts of length *x* in the second way.
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=2·109) — the length of Pasha's stick.
Output Specification:
The output should contain a single integer — the number of ways to split Pasha's stick into four parts of positive integer length so that it's possible to make a rectangle by connecting the ends of these parts, but is impossible to form a square.
Demo Input:
['6\n', '20\n']
Demo Output:
['1\n', '4\n']
Note:
There is only one way to divide the stick in the first sample {1, 1, 2, 2}.
Four ways to divide the stick in the second sample are {1, 1, 9, 9}, {2, 2, 8, 8}, {3, 3, 7, 7} and {4, 4, 6, 6}. Note that {5, 5, 5, 5} doesn't work.
|
```python
n=int(input())
x=n//4
if x%4==0:
x-=1
if x%2==1:
x=0
print(x)
```
| 0
|
|
471
|
A
|
MUH and Sticks
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
|
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
|
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
|
[
"4 2 5 4 4 4\n",
"4 4 5 4 4 5\n",
"1 2 3 4 5 6\n"
] |
[
"Bear",
"Elephant",
"Alien"
] |
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
| 500
|
[
{
"input": "4 2 5 4 4 4",
"output": "Bear"
},
{
"input": "4 4 5 4 4 5",
"output": "Elephant"
},
{
"input": "1 2 3 4 5 6",
"output": "Alien"
},
{
"input": "5 5 5 5 5 5",
"output": "Elephant"
},
{
"input": "1 1 1 2 3 5",
"output": "Alien"
},
{
"input": "1 1 1 1 1 1",
"output": "Elephant"
},
{
"input": "9 9 9 9 9 9",
"output": "Elephant"
},
{
"input": "1 8 9 1 1 1",
"output": "Bear"
},
{
"input": "9 9 9 1 9 9",
"output": "Bear"
},
{
"input": "1 2 3 8 9 7",
"output": "Alien"
},
{
"input": "5 5 5 6 6 6",
"output": "Alien"
},
{
"input": "1 1 2 2 3 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 2",
"output": "Bear"
},
{
"input": "2 2 3 3 4 4",
"output": "Alien"
},
{
"input": "4 4 4 4 4 5",
"output": "Bear"
},
{
"input": "1 1 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 2 5 5 5 5",
"output": "Bear"
},
{
"input": "4 4 2 2 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 1 2",
"output": "Bear"
},
{
"input": "2 2 4 4 4 4",
"output": "Elephant"
},
{
"input": "4 4 4 4 4 3",
"output": "Bear"
},
{
"input": "4 4 5 6 7 8",
"output": "Alien"
},
{
"input": "4 4 4 4 2 2",
"output": "Elephant"
},
{
"input": "1 1 1 1 2 2",
"output": "Elephant"
},
{
"input": "1 1 3 3 3 5",
"output": "Alien"
},
{
"input": "1 2 2 3 3 3",
"output": "Alien"
},
{
"input": "1 2 2 2 2 2",
"output": "Bear"
},
{
"input": "1 3 3 3 4 5",
"output": "Alien"
},
{
"input": "5 1 1 1 1 1",
"output": "Bear"
}
] | 1,536,917,631
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 124
| 102,400
|
import sys
from collections import Counter
class Sticks:
def __init__(self,sticks):
self.s = sticks
def animal(self):
dic = Counter(self.s)
if len(dic) == 2:
return self.checkAli(dic,"Elephant")
elif len(dic) == 3:
return self.checkAli(dic,"Bear")
else:
return "Alien"
def checkAli(self,dic,default):
for key in dic:
if dic[key] == 4:
return default
return "Alien"
def main():
st = [int(x) for x in sys.stdin.readline().split()]
creat = Sticks(st)
print(creat.animal())
if __name__ == ("__main__"):
main()
|
Title: MUH and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two polar bears Menshykov and Uslada from the St.Petersburg zoo and elephant Horace from the Kiev zoo got six sticks to play with and assess the animals' creativity. Menshykov, Uslada and Horace decided to make either an elephant or a bear from those sticks. They can make an animal from sticks in the following way:
- Four sticks represent the animal's legs, these sticks should have the same length. - Two remaining sticks represent the animal's head and body. The bear's head stick must be shorter than the body stick. The elephant, however, has a long trunk, so his head stick must be as long as the body stick. Note that there are no limits on the relations between the leg sticks and the head and body sticks.
Your task is to find out which animal can be made from the given stick set. The zoo keeper wants the sticks back after the game, so they must never be broken, even bears understand it.
Input Specification:
The single line contains six space-separated integers *l**i* (1<=≤<=*l**i*<=≤<=9) — the lengths of the six sticks. It is guaranteed that the input is such that you cannot make both animals from the sticks.
Output Specification:
If you can make a bear from the given set, print string "Bear" (without the quotes). If you can make an elephant, print string "Elephant" (wıthout the quotes). If you can make neither a bear nor an elephant, print string "Alien" (without the quotes).
Demo Input:
['4 2 5 4 4 4\n', '4 4 5 4 4 5\n', '1 2 3 4 5 6\n']
Demo Output:
['Bear', 'Elephant', 'Alien']
Note:
If you're out of creative ideas, see instructions below which show how to make a bear and an elephant in the first two samples. The stick of length 2 is in red, the sticks of length 4 are in green, the sticks of length 5 are in blue.
|
```python
import sys
from collections import Counter
class Sticks:
def __init__(self,sticks):
self.s = sticks
def animal(self):
dic = Counter(self.s)
if len(dic) == 2:
return self.checkAli(dic,"Elephant")
elif len(dic) == 3:
return self.checkAli(dic,"Bear")
else:
return "Alien"
def checkAli(self,dic,default):
for key in dic:
if dic[key] == 4:
return default
return "Alien"
def main():
st = [int(x) for x in sys.stdin.readline().split()]
creat = Sticks(st)
print(creat.animal())
if __name__ == ("__main__"):
main()
```
| 0
|
|
507
|
B
|
Amr and Pins
|
PROGRAMMING
| 1,400
|
[
"geometry",
"math"
] | null | null |
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
|
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
|
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
|
[
"2 0 0 0 4\n",
"1 1 1 4 4\n",
"4 5 6 5 6\n"
] |
[
"1\n",
"3\n",
"0\n"
] |
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "2 0 0 0 4",
"output": "1"
},
{
"input": "1 1 1 4 4",
"output": "3"
},
{
"input": "4 5 6 5 6",
"output": "0"
},
{
"input": "10 20 0 40 0",
"output": "1"
},
{
"input": "9 20 0 40 0",
"output": "2"
},
{
"input": "5 -1 -6 -5 1",
"output": "1"
},
{
"input": "99125 26876 -21414 14176 17443",
"output": "1"
},
{
"input": "8066 7339 19155 -90534 -60666",
"output": "8"
},
{
"input": "100000 -100000 -100000 100000 100000",
"output": "2"
},
{
"input": "10 20 0 41 0",
"output": "2"
},
{
"input": "25 -64 -6 -56 64",
"output": "2"
},
{
"input": "125 455 450 439 721",
"output": "2"
},
{
"input": "5 6 3 7 2",
"output": "1"
},
{
"input": "24 130 14786 3147 2140",
"output": "271"
},
{
"input": "125 -363 176 93 330",
"output": "2"
},
{
"input": "1 14 30 30 14",
"output": "12"
},
{
"input": "25 96 13 7 2",
"output": "2"
},
{
"input": "4 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "1 3 4 2 5",
"output": "1"
},
{
"input": "1 -3 3 2 6",
"output": "3"
},
{
"input": "2 7 20 13 -5",
"output": "7"
},
{
"input": "1 1 1 1 4",
"output": "2"
},
{
"input": "249 -54242 -30537 -45023 -89682",
"output": "121"
},
{
"input": "4 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "97741 23818 78751 97583 26933",
"output": "1"
},
{
"input": "56767 -29030 51625 79823 -56297",
"output": "2"
},
{
"input": "98260 13729 74998 23701 9253",
"output": "1"
},
{
"input": "67377 -80131 -90254 -57320 14102",
"output": "1"
},
{
"input": "1 100000 100000 100000 -100000",
"output": "100000"
},
{
"input": "19312 19470 82059 58064 62231",
"output": "2"
},
{
"input": "67398 -68747 -79056 -34193 29400",
"output": "1"
},
{
"input": "91099 37184 -71137 75650 -3655",
"output": "1"
},
{
"input": "46456 -2621 -23623 -98302 -99305",
"output": "2"
},
{
"input": "100 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "1 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "8 0 0 0 32",
"output": "2"
},
{
"input": "100000 100000 1 -100000 0",
"output": "2"
}
] | 1,622,635,025
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 37
| 155
| 102,400
|
from math import *
r,x,y,xd,yd=map(int,input().split())
d=sqrt((x-xd)**2+(y-yd)**2)
print(ceil(d/(2*r)))
|
Title: Amr and Pins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
Input Specification:
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output Specification:
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
Demo Input:
['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n']
Demo Output:
['1\n', '3\n', '0\n']
Note:
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
from math import *
r,x,y,xd,yd=map(int,input().split())
d=sqrt((x-xd)**2+(y-yd)**2)
print(ceil(d/(2*r)))
```
| 3
|
|
17
|
A
|
Noldbach problem
|
PROGRAMMING
| 1,000
|
[
"brute force",
"math",
"number theory"
] |
A. Noldbach problem
|
2
|
64
|
Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1.
Two prime numbers are called neighboring if there are no other prime numbers between them.
You are to help Nick, and find out if he is right or wrong.
|
The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000).
|
Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO.
|
[
"27 2\n",
"45 7\n"
] |
[
"YES",
"NO"
] |
In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
| 0
|
[
{
"input": "27 2",
"output": "YES"
},
{
"input": "45 7",
"output": "NO"
},
{
"input": "2 0",
"output": "YES"
},
{
"input": "15 1",
"output": "YES"
},
{
"input": "17 1",
"output": "YES"
},
{
"input": "34 5",
"output": "NO"
},
{
"input": "37 4",
"output": "YES"
},
{
"input": "43 5",
"output": "YES"
},
{
"input": "47 7",
"output": "NO"
},
{
"input": "50 5",
"output": "YES"
},
{
"input": "57 6",
"output": "YES"
},
{
"input": "60 8",
"output": "NO"
},
{
"input": "62 7",
"output": "YES"
},
{
"input": "76 9",
"output": "NO"
},
{
"input": "69 7",
"output": "YES"
},
{
"input": "113 10",
"output": "YES"
},
{
"input": "141 11",
"output": "YES"
},
{
"input": "207 16",
"output": "NO"
},
{
"input": "231 18",
"output": "NO"
},
{
"input": "296 19",
"output": "YES"
},
{
"input": "332 20",
"output": "YES"
},
{
"input": "378 24",
"output": "NO"
},
{
"input": "428 23",
"output": "YES"
},
{
"input": "497 27",
"output": "NO"
},
{
"input": "640 32",
"output": "YES"
},
{
"input": "798 35",
"output": "YES"
},
{
"input": "802 35",
"output": "YES"
},
{
"input": "864 40",
"output": "NO"
},
{
"input": "953 44",
"output": "NO"
},
{
"input": "995 44",
"output": "YES"
},
{
"input": "1000 44",
"output": "YES"
},
{
"input": "1000 0",
"output": "YES"
},
{
"input": "1000 1000",
"output": "NO"
},
{
"input": "2 1000",
"output": "NO"
},
{
"input": "2 0",
"output": "YES"
}
] | 1,595,607,615
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 186
| 6,656,000
|
# -*- coding: utf-8 -*-
def isPrime(n):
for i in range(2,int(n**0.5)+1):
if n%i==0:
return False
return True
n,k = map(int,input().split())
cont = 0
for i in range(2,n+1):
if isPrime(i) == True: cont += 1
if cont == k: print('YES'); break
if cont < k: print('NO')
|
Title: Noldbach problem
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1.
Two prime numbers are called neighboring if there are no other prime numbers between them.
You are to help Nick, and find out if he is right or wrong.
Input Specification:
The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000).
Output Specification:
Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO.
Demo Input:
['27 2\n', '45 7\n']
Demo Output:
['YES', 'NO']
Note:
In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
|
```python
# -*- coding: utf-8 -*-
def isPrime(n):
for i in range(2,int(n**0.5)+1):
if n%i==0:
return False
return True
n,k = map(int,input().split())
cont = 0
for i in range(2,n+1):
if isPrime(i) == True: cont += 1
if cont == k: print('YES'); break
if cont < k: print('NO')
```
| 0
|
18
|
D
|
Seller Bob
|
PROGRAMMING
| 2,000
|
[
"brute force",
"dp",
"greedy"
] |
D. Seller Bob
|
2
|
128
|
Last year Bob earned by selling memory sticks. During each of *n* days of his work one of the two following events took place:
- A customer came to Bob and asked to sell him a 2*x* MB memory stick. If Bob had such a stick, he sold it and got 2*x* berllars. - Bob won some programming competition and got a 2*x* MB memory stick as a prize. Bob could choose whether to present this memory stick to one of his friends, or keep it.
Bob never kept more than one memory stick, as he feared to mix up their capacities, and deceive a customer unintentionally. It is also known that for each memory stick capacity there was at most one customer, who wanted to buy that memory stick. Now, knowing all the customers' demands and all the prizes won at programming competitions during the last *n* days, Bob wants to know, how much money he could have earned, if he had acted optimally.
|
The first input line contains number *n* (1<=≤<=*n*<=≤<=5000) — amount of Bob's working days. The following *n* lines contain the description of the days. Line sell x stands for a day when a customer came to Bob to buy a 2*x* MB memory stick (0<=≤<=*x*<=≤<=2000). It's guaranteed that for each *x* there is not more than one line sell x. Line win x stands for a day when Bob won a 2*x* MB memory stick (0<=≤<=*x*<=≤<=2000).
|
Output the maximum possible earnings for Bob in berllars, that he would have had if he had known all the events beforehand. Don't forget, please, that Bob can't keep more than one memory stick at a time.
|
[
"7\nwin 10\nwin 5\nwin 3\nsell 5\nsell 3\nwin 10\nsell 10\n",
"3\nwin 5\nsell 6\nsell 4\n"
] |
[
"1056\n",
"0\n"
] |
none
| 0
|
[
{
"input": "7\nwin 10\nwin 5\nwin 3\nsell 5\nsell 3\nwin 10\nsell 10",
"output": "1056"
},
{
"input": "3\nwin 5\nsell 6\nsell 4",
"output": "0"
},
{
"input": "60\nwin 30\nsell 30\nwin 29\nsell 29\nwin 28\nsell 28\nwin 27\nsell 27\nwin 26\nsell 26\nwin 25\nsell 25\nwin 24\nsell 24\nwin 23\nsell 23\nwin 22\nsell 22\nwin 21\nsell 21\nwin 20\nsell 20\nwin 19\nsell 19\nwin 18\nsell 18\nwin 17\nsell 17\nwin 16\nsell 16\nwin 15\nsell 15\nwin 14\nsell 14\nwin 13\nsell 13\nwin 12\nsell 12\nwin 11\nsell 11\nwin 10\nsell 10\nwin 9\nsell 9\nwin 8\nsell 8\nwin 7\nsell 7\nwin 6\nsell 6\nwin 5\nsell 5\nwin 4\nsell 4\nwin 3\nsell 3\nwin 2\nsell 2\nwin 1\nsell 1",
"output": "2147483646"
},
{
"input": "10\nsell 179\nwin 1278\nsell 1278\nwin 179\nwin 788\nsell 788\nwin 1819\nwin 1278\nsell 1454\nsell 1819",
"output": "3745951177859672748085876072016755224158263650470541376602416977749506433342393741012551962469399005106980957564747771946546075632634156222832360666586993197712597743102870994304893421406288896658113922358079050393796282759740479830789771109056742931607432542704338811780614109483471170758503563410473205320757445249359340913055427891395101189449739249593088482768598397566812797391842205760535689034164783939977837838115215972505331175064745799973957898910533590618104893265678599370512439216359131269814745054..."
},
{
"input": "10\nsell 573\nwin 1304\nsell 278\nwin 1631\nsell 1225\nsell 1631\nsell 177\nwin 1631\nwin 177\nsell 1304",
"output": "95482312335125227379668481690754940528280513838693267460502082967052005332103697568042408703168913727303170456338425853153094403747135188778307041838920404959089576368946137708987138986696495077466398994298434148881715073638178666201165545650953479735059082316661443204882826188032944866093372620219104327689636641547141835841165681118172603993695103043804276669836594061369229043451067647935298287687852302215923887110435577776767805943668204998410716005202198549540411238299513630278811648"
},
{
"input": "10\nwin 1257\nwin 1934\nsell 1934\nsell 1257\nwin 1934\nwin 1257\nsell 495\nwin 495\nwin 495\nwin 1257",
"output": "1556007242642049292787218246793379348327505438878680952714050868520307364441227819009733220897932984584977593931988662671459594674963394056587723382487766303981362587048873128400436836690128983570130687310221668877557121158055843621982630476422478413285775826498536883275291967793661985813155062733063913176306327509625594121241472451054995889483447103432414676059872469910105149496451402271546454282618581884282152530090816240540173251729211604658704990425330422792556824836640431985211146197816770068601144273..."
},
{
"input": "10\nsell 1898\nsell 173\nsell 1635\nsell 29\nsell 881\nsell 434\nsell 1236\nsell 14\nwin 29\nsell 1165",
"output": "0"
},
{
"input": "50\nwin 1591\nwin 312\nwin 1591\nwin 1277\nwin 1732\nwin 1277\nwin 312\nwin 1591\nwin 210\nwin 1591\nwin 210\nsell 1732\nwin 312\nwin 1732\nwin 210\nwin 1591\nwin 312\nwin 210\nwin 1732\nwin 1732\nwin 1591\nwin 1732\nwin 312\nwin 1732\nsell 1277\nwin 1732\nwin 210\nwin 1277\nwin 1277\nwin 312\nwin 1732\nsell 312\nsell 1591\nwin 312\nsell 210\nwin 1732\nwin 312\nwin 210\nwin 1591\nwin 1591\nwin 1732\nwin 210\nwin 1591\nwin 312\nwin 1277\nwin 1591\nwin 210\nwin 1277\nwin 1732\nwin 312",
"output": "2420764210856015331214801822295882718446835865177072936070024961324113887299407742968459201784200628346247573017634417460105466317641563795817074771860850712020768123310899251645626280515264270127874292153603360689565451372953171008749749476807656127914801962353129980445541683621172887240439496869443980760905844921588668701053404581445092887732985786593080332302468009347364906506742888063949158794894756704243685813947581549214136427388148927087858952333440295415050590550479915766637705353193400817849524933..."
},
{
"input": "50\nwin 596\nwin 1799\nwin 1462\nsell 460\nwin 731\nwin 723\nwin 731\nwin 329\nwin 838\nsell 728\nwin 728\nwin 460\nwin 723\nwin 1462\nwin 1462\nwin 460\nwin 329\nwin 1462\nwin 460\nwin 460\nwin 723\nwin 731\nwin 723\nwin 596\nwin 731\nwin 596\nwin 329\nwin 728\nwin 715\nwin 329\nwin 1799\nwin 715\nwin 723\nwin 728\nwin 1462\nwin 596\nwin 728\nsell 1462\nsell 731\nsell 723\nsell 596\nsell 1799\nwin 715\nsell 329\nsell 715\nwin 731\nwin 596\nwin 596\nwin 1799\nsell 838",
"output": "3572417428836510418020130226151232933195365572424451233484665849446779664366143933308174097508811001879673917355296871134325099594720989439804421106898301313126179907518635998806895566124222305730664245219198882158809677890894851351153171006242601699481340338225456896495739360268670655803862712132671163869311331357956008411198419420320449558787147867731519734760711196755523479867536729489438488681378976579126837971468043235641314636566999618274861697304906262004280314028540891222536060126170572182168995779..."
},
{
"input": "50\nwin 879\nwin 1153\nwin 1469\nwin 157\nwin 827\nwin 679\nsell 1229\nwin 454\nsell 879\nsell 1222\nwin 924\nwin 827\nsell 1366\nwin 879\nsell 754\nwin 1153\nwin 679\nwin 1185\nsell 1469\nsell 454\nsell 679\nsell 1153\nwin 1469\nwin 827\nwin 1469\nwin 1024\nwin 1222\nsell 157\nsell 1185\nsell 827\nwin 1469\nsell 1569\nwin 754\nsell 1024\nwin 924\nwin 924\nsell 1876\nsell 479\nsell 435\nwin 754\nwin 174\nsell 174\nsell 147\nsell 924\nwin 1469\nwin 1876\nwin 1229\nwin 1469\nwin 1222\nwin 157",
"output": "16332912310228701097717316802721870128775022868221080314403305773060286348016616983179506327297989866534783694332203603069900790667846028602603898749788769867206327097934433881603593880774778104853105937620753202513845830781396468839434689035327911539335925798473899153215505268301939672678983012311225261177070282290958328569587449928340374890197297462448526671963786572758011646874155763250281850311510811863346015732742889066278088442118144"
},
{
"input": "50\nsell 1549\nwin 1168\nsell 1120\nwin 741\nsell 633\nwin 274\nsell 1936\nwin 1168\nsell 614\nwin 33\nsell 1778\nwin 127\nsell 1168\nwin 33\nwin 633\nsell 1474\nwin 518\nwin 1685\nsell 1796\nsell 741\nsell 485\nwin 747\nsell 588\nsell 1048\nwin 1580\nwin 60\nsell 1685\nsell 1580\nsell 1535\nwin 485\nsell 31\nsell 747\nsell 1473\nsell 518\nwin 633\nsell 1313\nwin 1580\nsell 1560\nsell 127\nsell 274\nwin 123\nwin 31\nsell 123\nsell 33\nwin 1778\nsell 1834\nsell 60\nsell 1751\nsell 1287\nwin 1549",
"output": "1720056425011773151265118871077591733216276990085092619030835675616738576936900493041118761959770055340668032173576279597675976622004777210845027112875371906527379337573212312341811682481516081119925150514042583039122963732518350292624889782510925425243478590699982487521431988980734651291693696303059520879874887472437061826782122289965998009474317347011699360401227487786089319043200666474560882786695043543699741809763479940250459103751744852630592882730442346682844070898735881280272505893611419620868096"
},
{
"input": "1\nsell 2000",
"output": "0"
},
{
"input": "1\nwin 2000",
"output": "0"
},
{
"input": "2\nwin 2000\nsell 2000",
"output": "1148130695274254524232833201177681984022317702088695200477642736825766261392370313856659486316506269918445964638987462773447118960863055331425931356166653185391299891453122800006887791482400448714289269900634862447816154636463883639473170260404663539709049965581623988089446296056233116495361642219703326813441689089844585056023794848079140589009347765004290027167066258305220081322362812917612678833172065989953964181270217798584040421598531832515408894339020919205549577835896720391600819572166305827553804255..."
}
] | 1,500,186,494
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 122
| 4,608,000
|
R= lambda:map(int,input().split())
n,=R()
dic,l={},[]
for i in range(n):
a,b=input().split()
b=int(b)
if a=='win':
if b in dic.keys(): dic[b].append(i)
else: dic[b]=[i]
else:
l.append([b,i])
l.sort(reverse=True)
now,ans,t=n,0,-1
for x in l:
if (x[0] in dic.keys()) and (dic[x[0]][-1]<now or dic[x[0]][-1]>t):
ans+=pow(2,x[0])
now,t=dic[x[0]][-1],x[1]
dic[x[0]].pop()
print(ans)
|
Title: Seller Bob
Time Limit: 2 seconds
Memory Limit: 128 megabytes
Problem Description:
Last year Bob earned by selling memory sticks. During each of *n* days of his work one of the two following events took place:
- A customer came to Bob and asked to sell him a 2*x* MB memory stick. If Bob had such a stick, he sold it and got 2*x* berllars. - Bob won some programming competition and got a 2*x* MB memory stick as a prize. Bob could choose whether to present this memory stick to one of his friends, or keep it.
Bob never kept more than one memory stick, as he feared to mix up their capacities, and deceive a customer unintentionally. It is also known that for each memory stick capacity there was at most one customer, who wanted to buy that memory stick. Now, knowing all the customers' demands and all the prizes won at programming competitions during the last *n* days, Bob wants to know, how much money he could have earned, if he had acted optimally.
Input Specification:
The first input line contains number *n* (1<=≤<=*n*<=≤<=5000) — amount of Bob's working days. The following *n* lines contain the description of the days. Line sell x stands for a day when a customer came to Bob to buy a 2*x* MB memory stick (0<=≤<=*x*<=≤<=2000). It's guaranteed that for each *x* there is not more than one line sell x. Line win x stands for a day when Bob won a 2*x* MB memory stick (0<=≤<=*x*<=≤<=2000).
Output Specification:
Output the maximum possible earnings for Bob in berllars, that he would have had if he had known all the events beforehand. Don't forget, please, that Bob can't keep more than one memory stick at a time.
Demo Input:
['7\nwin 10\nwin 5\nwin 3\nsell 5\nsell 3\nwin 10\nsell 10\n', '3\nwin 5\nsell 6\nsell 4\n']
Demo Output:
['1056\n', '0\n']
Note:
none
|
```python
R= lambda:map(int,input().split())
n,=R()
dic,l={},[]
for i in range(n):
a,b=input().split()
b=int(b)
if a=='win':
if b in dic.keys(): dic[b].append(i)
else: dic[b]=[i]
else:
l.append([b,i])
l.sort(reverse=True)
now,ans,t=n,0,-1
for x in l:
if (x[0] in dic.keys()) and (dic[x[0]][-1]<now or dic[x[0]][-1]>t):
ans+=pow(2,x[0])
now,t=dic[x[0]][-1],x[1]
dic[x[0]].pop()
print(ans)
```
| 0
|
877
|
A
|
Alex and broken contest
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
|
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
|
Print "YES", if problem is from this contest, and "NO" otherwise.
|
[
"Alex_and_broken_contest\n",
"NikitaAndString\n",
"Danil_and_Olya\n"
] |
[
"NO",
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "Alex_and_broken_contest",
"output": "NO"
},
{
"input": "NikitaAndString",
"output": "YES"
},
{
"input": "Danil_and_Olya",
"output": "NO"
},
{
"input": "Slava____and_the_game",
"output": "YES"
},
{
"input": "Olya_and_energy_drinks",
"output": "YES"
},
{
"input": "Danil_and_part_time_job",
"output": "YES"
},
{
"input": "Ann_and_books",
"output": "YES"
},
{
"input": "Olya",
"output": "YES"
},
{
"input": "Nikita",
"output": "YES"
},
{
"input": "Slava",
"output": "YES"
},
{
"input": "Vanya",
"output": "NO"
},
{
"input": "I_dont_know_what_to_write_here",
"output": "NO"
},
{
"input": "danil_and_work",
"output": "NO"
},
{
"input": "Ann",
"output": "YES"
},
{
"input": "Batman_Nananananananan_Batman",
"output": "NO"
},
{
"input": "Olya_Nikita_Ann_Slava_Danil",
"output": "NO"
},
{
"input": "its_me_Mario",
"output": "NO"
},
{
"input": "A",
"output": "NO"
},
{
"input": "Wake_up_Neo",
"output": "NO"
},
{
"input": "Hardest_problem_ever",
"output": "NO"
},
{
"input": "Nikita_Nikita",
"output": "NO"
},
{
"input": "____________________________________________________________________________________________________",
"output": "NO"
},
{
"input": "Nikitb",
"output": "NO"
},
{
"input": "Unn",
"output": "NO"
},
{
"input": "oLya_adn_smth",
"output": "NO"
},
{
"input": "FloorISLava",
"output": "NO"
},
{
"input": "ann",
"output": "NO"
},
{
"input": "aa",
"output": "NO"
},
{
"input": "AAnnnnn",
"output": "YES"
},
{
"input": "AnnAnn",
"output": "NO"
},
{
"input": "Annn",
"output": "YES"
},
{
"input": "Dilzhan",
"output": "NO"
},
{
"input": "Danilaaa",
"output": "YES"
},
{
"input": "AndAnn",
"output": "YES"
},
{
"input": "OlyaAnnAnn",
"output": "NO"
},
{
"input": "DanilDanilOlya",
"output": "NO"
},
{
"input": "DDanil",
"output": "YES"
},
{
"input": "AnnAnnDanil",
"output": "NO"
},
{
"input": "And_Danil",
"output": "YES"
},
{
"input": "abcddddDanil",
"output": "YES"
},
{
"input": "DanilOlyaOlya",
"output": "NO"
},
{
"input": "Nikitaaa",
"output": "YES"
},
{
"input": "aaabbba",
"output": "NO"
},
{
"input": "Ann_Ann_Danil",
"output": "NO"
},
{
"input": "Danil_Danil_Nikita",
"output": "NO"
},
{
"input": "AlexaaaaaaBBBBBOlyaDDDDD",
"output": "YES"
},
{
"input": "IloveDaniland",
"output": "YES"
},
{
"input": "AnAnn",
"output": "YES"
},
{
"input": "Danil_Danil_Olya",
"output": "NO"
},
{
"input": "DanilDanilSlava",
"output": "NO"
},
{
"input": "DanilDanil",
"output": "NO"
},
{
"input": "OlyOlya",
"output": "YES"
},
{
"input": "NikitaNikitb",
"output": "YES"
},
{
"input": "ababaca",
"output": "NO"
},
{
"input": "AnnNikitaNikitaNikitaNikita__good_luck",
"output": "NO"
}
] | 1,520,051,170
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 62
| 5,632,000
|
s = input()
flag = 0
for i in range(len(s) - 6):
if s[i:i + 5] == "Danil" or s[i:i + 4] == "Olya" or s[i:i + 5] == "Slava" or s[i:i + 6] == "Nikita":
flag += 1
if s[len(s) - 6:len(s) - 1] == "Danil" or s[len(s) - 5:len(s)] == "Danil":
flag += 1
if s[len(s) - 6:len(s) - 1] == "Slava" or s[len(s) - 5:len(s)] == "Slava":
flag += 1
if s[len(s) - 6:len(s) - 2] == "Olya" or s[len(s) - 5:len(s) - 1] == "Olya" or s[len(s) - 4:len(s)] == "Olya":
flag += 1
if flag == 1:
print("YES")
else:
print("NO")
|
Title: Alex and broken contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Alex was creating a contest about his friends, but accidentally deleted it. Fortunately, all the problems were saved, but now he needs to find them among other problems.
But there are too many problems, to do it manually. Alex asks you to write a program, which will determine if a problem is from this contest by its name.
It is known, that problem is from this contest if and only if its name contains one of Alex's friends' name exactly once. His friends' names are "Danil", "Olya", "Slava", "Ann" and "Nikita".
Names are case sensitive.
Input Specification:
The only line contains string from lowercase and uppercase letters and "_" symbols of length, not more than 100 — the name of the problem.
Output Specification:
Print "YES", if problem is from this contest, and "NO" otherwise.
Demo Input:
['Alex_and_broken_contest\n', 'NikitaAndString\n', 'Danil_and_Olya\n']
Demo Output:
['NO', 'YES', 'NO']
Note:
none
|
```python
s = input()
flag = 0
for i in range(len(s) - 6):
if s[i:i + 5] == "Danil" or s[i:i + 4] == "Olya" or s[i:i + 5] == "Slava" or s[i:i + 6] == "Nikita":
flag += 1
if s[len(s) - 6:len(s) - 1] == "Danil" or s[len(s) - 5:len(s)] == "Danil":
flag += 1
if s[len(s) - 6:len(s) - 1] == "Slava" or s[len(s) - 5:len(s)] == "Slava":
flag += 1
if s[len(s) - 6:len(s) - 2] == "Olya" or s[len(s) - 5:len(s) - 1] == "Olya" or s[len(s) - 4:len(s)] == "Olya":
flag += 1
if flag == 1:
print("YES")
else:
print("NO")
```
| 0
|
|
71
|
A
|
Way Too Long Words
|
PROGRAMMING
| 800
|
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500
|
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,696,159,154
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
d=input()
c=list(d)
count=0
for i in range (len(c)):
count+=1
x=count-2
if x<10:
print (d)
else:
print(c[0]+str(x)+c[-1])
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
d=input()
c=list(d)
count=0
for i in range (len(c)):
count+=1
x=count-2
if x<10:
print (d)
else:
print(c[0]+str(x)+c[-1])
```
| 0
|
1,005
|
B
|
Delete from the Left
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty.
For example:
- by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "".
You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings.
Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal.
|
The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive.
|
Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings.
|
[
"test\nwest\n",
"codeforces\nyes\n",
"test\nyes\n",
"b\nab\n"
] |
[
"2\n",
"9\n",
"7\n",
"1\n"
] |
In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est".
In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es".
In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty.
In the fourth example, the first character of the second string should be deleted.
| 0
|
[
{
"input": "test\nwest",
"output": "2"
},
{
"input": "codeforces\nyes",
"output": "9"
},
{
"input": "test\nyes",
"output": "7"
},
{
"input": "b\nab",
"output": "1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "abacabadabacaba\nabacabadacaba",
"output": "18"
},
{
"input": "z\na",
"output": "2"
},
{
"input": "ama\nsama",
"output": "1"
},
{
"input": "aaabc\nbc",
"output": "3"
},
{
"input": "lxuyspmieeuyxluv\ndfwxqvavzxctblaa",
"output": "32"
},
{
"input": "ahmedaly\naly",
"output": "5"
},
{
"input": "aa\na",
"output": "1"
},
{
"input": "aa\nba",
"output": "2"
},
{
"input": "cccba\nba",
"output": "3"
},
{
"input": "a\nab",
"output": "3"
},
{
"input": "dadc\ndddc",
"output": "4"
},
{
"input": "aacaaab\nb",
"output": "6"
},
{
"input": "dddc\ncdcde",
"output": "9"
},
{
"input": "bbdab\ndab",
"output": "2"
},
{
"input": "a\naa",
"output": "1"
},
{
"input": "aa\nab",
"output": "4"
},
{
"input": "codeforces\nces",
"output": "7"
}
] | 1,640,342,662
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 46
| 0
|
s = input()
t = input()
x=len(s)-1
y=len(t)-1
count=0
while x>0 and y>0:
if s[x]!=t[y]:
break
x=x-1
y=y-1
print(x+y+2)
|
Title: Delete from the Left
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two strings $s$ and $t$. In a single move, you can choose any of two strings and delete the first (that is, the leftmost) character. After a move, the length of the string decreases by $1$. You can't choose a string if it is empty.
For example:
- by applying a move to the string "where", the result is the string "here", - by applying a move to the string "a", the result is an empty string "".
You are required to make two given strings equal using the fewest number of moves. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the initial strings.
Write a program that finds the minimum number of moves to make two given strings $s$ and $t$ equal.
Input Specification:
The first line of the input contains $s$. In the second line of the input contains $t$. Both strings consist only of lowercase Latin letters. The number of letters in each string is between 1 and $2\cdot10^5$, inclusive.
Output Specification:
Output the fewest number of moves required. It is possible that, in the end, both strings will be equal to the empty string, and so, are equal to each other. In this case, the answer is obviously the sum of the lengths of the given strings.
Demo Input:
['test\nwest\n', 'codeforces\nyes\n', 'test\nyes\n', 'b\nab\n']
Demo Output:
['2\n', '9\n', '7\n', '1\n']
Note:
In the first example, you should apply the move once to the first string and apply the move once to the second string. As a result, both strings will be equal to "est".
In the second example, the move should be applied to the string "codeforces" $8$ times. As a result, the string becomes "codeforces" $\to$ "es". The move should be applied to the string "yes" once. The result is the same string "yes" $\to$ "es".
In the third example, you can make the strings equal only by completely deleting them. That is, in the end, both strings will be empty.
In the fourth example, the first character of the second string should be deleted.
|
```python
s = input()
t = input()
x=len(s)-1
y=len(t)-1
count=0
while x>0 and y>0:
if s[x]!=t[y]:
break
x=x-1
y=y-1
print(x+y+2)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Let's introduce a number system which is based on a roman digits. There are digits I, V, X, L which correspond to the numbers $1$, $5$, $10$ and $50$ respectively. The use of other roman digits is not allowed.
Numbers in this system are written as a sequence of one or more digits. We define the value of the sequence simply as the sum of digits in it.
For example, the number XXXV evaluates to $35$ and the number IXI — to $12$.
Pay attention to the difference to the traditional roman system — in our system any sequence of digits is valid, moreover the order of digits doesn't matter, for example IX means $11$, not $9$.
One can notice that this system is ambiguous, and some numbers can be written in many different ways. Your goal is to determine how many distinct integers can be represented by exactly $n$ roman digits I, V, X, L.
|
The only line of the input file contains a single integer $n$ ($1 \le n \le 10^9$) — the number of roman digits to use.
|
Output a single integer — the number of distinct integers which can be represented using $n$ roman digits exactly.
|
[
"1\n",
"2\n",
"10\n"
] |
[
"4\n",
"10\n",
"244\n"
] |
In the first sample there are exactly $4$ integers which can be represented — I, V, X and L.
In the second sample it is possible to represent integers $2$ (II), $6$ (VI), $10$ (VV), $11$ (XI), $15$ (XV), $20$ (XX), $51$ (IL), $55$ (VL), $60$ (XL) and $100$ (LL).
| 0
|
[
{
"input": "1",
"output": "4"
},
{
"input": "2",
"output": "10"
},
{
"input": "10",
"output": "244"
},
{
"input": "1000",
"output": "48753"
},
{
"input": "2000",
"output": "97753"
},
{
"input": "5000",
"output": "244753"
},
{
"input": "10000",
"output": "489753"
},
{
"input": "111199",
"output": "5448504"
},
{
"input": "101232812",
"output": "4960407541"
},
{
"input": "1000000000",
"output": "48999999753"
},
{
"input": "3",
"output": "20"
},
{
"input": "4",
"output": "35"
},
{
"input": "5",
"output": "56"
},
{
"input": "6",
"output": "83"
},
{
"input": "7",
"output": "116"
},
{
"input": "8",
"output": "155"
},
{
"input": "9",
"output": "198"
},
{
"input": "11",
"output": "292"
},
{
"input": "12",
"output": "341"
},
{
"input": "13",
"output": "390"
},
{
"input": "55",
"output": "2448"
},
{
"input": "100",
"output": "4653"
},
{
"input": "150",
"output": "7103"
},
{
"input": "1200",
"output": "58553"
},
{
"input": "9999999",
"output": "489999704"
},
{
"input": "100000000",
"output": "4899999753"
},
{
"input": "500000000",
"output": "24499999753"
},
{
"input": "600000000",
"output": "29399999753"
},
{
"input": "709000900",
"output": "34741043853"
},
{
"input": "999999999",
"output": "48999999704"
},
{
"input": "12",
"output": "341"
},
{
"input": "10",
"output": "244"
},
{
"input": "20",
"output": "733"
},
{
"input": "35",
"output": "1468"
},
{
"input": "56",
"output": "2497"
},
{
"input": "83",
"output": "3820"
},
{
"input": "116",
"output": "5437"
},
{
"input": "155",
"output": "7348"
},
{
"input": "198",
"output": "9455"
},
{
"input": "244",
"output": "11709"
},
{
"input": "292",
"output": "14061"
},
{
"input": "14",
"output": "439"
}
] | 1,602,544,827
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 42
| 109
| 0
|
non_representable = {
1: 46,
2: 89,
3: 128,
4: 162,
5: 190,
6: 212,
7: 228,
8: 238,
9: 244,
10: 247,
}
n = int(input())
print(49 * n + 1 - non_representable.get(n, 248))
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's introduce a number system which is based on a roman digits. There are digits I, V, X, L which correspond to the numbers $1$, $5$, $10$ and $50$ respectively. The use of other roman digits is not allowed.
Numbers in this system are written as a sequence of one or more digits. We define the value of the sequence simply as the sum of digits in it.
For example, the number XXXV evaluates to $35$ and the number IXI — to $12$.
Pay attention to the difference to the traditional roman system — in our system any sequence of digits is valid, moreover the order of digits doesn't matter, for example IX means $11$, not $9$.
One can notice that this system is ambiguous, and some numbers can be written in many different ways. Your goal is to determine how many distinct integers can be represented by exactly $n$ roman digits I, V, X, L.
Input Specification:
The only line of the input file contains a single integer $n$ ($1 \le n \le 10^9$) — the number of roman digits to use.
Output Specification:
Output a single integer — the number of distinct integers which can be represented using $n$ roman digits exactly.
Demo Input:
['1\n', '2\n', '10\n']
Demo Output:
['4\n', '10\n', '244\n']
Note:
In the first sample there are exactly $4$ integers which can be represented — I, V, X and L.
In the second sample it is possible to represent integers $2$ (II), $6$ (VI), $10$ (VV), $11$ (XI), $15$ (XV), $20$ (XX), $51$ (IL), $55$ (VL), $60$ (XL) and $100$ (LL).
|
```python
non_representable = {
1: 46,
2: 89,
3: 128,
4: 162,
5: 190,
6: 212,
7: 228,
8: 238,
9: 244,
10: 247,
}
n = int(input())
print(49 * n + 1 - non_representable.get(n, 248))
```
| 3
|
|
265
|
A
|
Colorful Stones (Simplified Edition)
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
|
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
|
Print the final 1-based position of Liss in a single line.
|
[
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] |
[
"2\n",
"3\n",
"15\n"
] |
none
| 500
|
[
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,604,213,151
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 19
| 216
| 0
|
s1=input()
s2=input()
i=j=0
while i<len(s1) and j<len(s2):
if s1[i]==s2[j]:
i+=1
j+=1
else:
j+=1
print(i+1)
|
Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none
|
```python
s1=input()
s2=input()
i=j=0
while i<len(s1) and j<len(s2):
if s1[i]==s2[j]:
i+=1
j+=1
else:
j+=1
print(i+1)
```
| 3
|
|
698
|
A
|
Vacations
|
PROGRAMMING
| 1,400
|
[
"dp"
] | null | null |
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
|
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
|
[
"4\n1 3 2 0\n",
"7\n1 3 3 2 1 2 3\n",
"2\n2 2\n"
] |
[
"2\n",
"0\n",
"1\n"
] |
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
| 500
|
[
{
"input": "4\n1 3 2 0",
"output": "2"
},
{
"input": "7\n1 3 3 2 1 2 3",
"output": "0"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "10\n0 0 1 1 0 0 0 0 1 0",
"output": "8"
},
{
"input": "100\n3 2 3 3 3 2 3 1 3 2 2 3 2 3 3 3 3 3 3 1 2 2 3 1 3 3 2 2 2 3 1 0 3 3 3 2 3 3 1 1 3 1 3 3 3 1 3 1 3 0 1 3 2 3 2 1 1 3 2 3 3 3 2 3 1 3 3 3 3 2 2 2 1 3 1 3 3 3 3 1 3 2 3 3 0 3 3 3 3 3 1 0 2 1 3 3 0 2 3 3",
"output": "16"
},
{
"input": "10\n2 3 0 1 3 1 2 2 1 0",
"output": "3"
},
{
"input": "45\n3 3 2 3 2 3 3 3 0 3 3 3 3 3 3 3 1 3 2 3 2 3 2 2 2 3 2 3 3 3 3 3 1 2 3 3 2 2 2 3 3 3 3 1 3",
"output": "6"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "1\n3",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1 3",
"output": "0"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n3 3",
"output": "0"
},
{
"input": "3\n3 3 3",
"output": "0"
},
{
"input": "2\n3 2",
"output": "0"
},
{
"input": "2\n0 2",
"output": "1"
},
{
"input": "10\n2 2 3 3 3 3 2 1 3 2",
"output": "2"
},
{
"input": "15\n0 1 0 0 0 2 0 1 0 0 0 2 0 0 0",
"output": "11"
},
{
"input": "15\n1 3 2 2 2 3 3 3 3 2 3 2 2 1 1",
"output": "4"
},
{
"input": "15\n3 1 3 2 3 2 2 2 3 3 3 3 2 3 2",
"output": "3"
},
{
"input": "20\n0 2 0 1 0 0 0 1 2 0 1 1 1 0 1 1 0 1 1 0",
"output": "12"
},
{
"input": "20\n2 3 2 3 3 3 3 2 0 3 1 1 2 3 0 3 2 3 0 3",
"output": "5"
},
{
"input": "20\n3 3 3 3 2 3 3 2 1 3 3 2 2 2 3 2 2 2 2 2",
"output": "4"
},
{
"input": "25\n0 0 1 0 0 1 0 0 1 0 0 1 0 2 0 0 2 0 0 1 0 2 0 1 1",
"output": "16"
},
{
"input": "25\n1 3 3 2 2 3 3 3 3 3 1 2 2 3 2 0 2 1 0 1 3 2 2 3 3",
"output": "5"
},
{
"input": "25\n2 3 1 3 3 2 1 3 3 3 1 3 3 1 3 2 3 3 1 3 3 3 2 3 3",
"output": "3"
},
{
"input": "30\n0 0 1 0 1 0 1 1 0 0 0 0 0 0 1 0 0 1 1 0 0 2 0 0 1 1 2 0 0 0",
"output": "22"
},
{
"input": "30\n1 1 3 2 2 0 3 2 3 3 1 2 0 1 1 2 3 3 2 3 1 3 2 3 0 2 0 3 3 2",
"output": "9"
},
{
"input": "30\n1 2 3 2 2 3 3 3 3 3 3 3 3 3 3 1 2 2 3 2 3 3 3 2 1 3 3 3 1 3",
"output": "2"
},
{
"input": "35\n0 1 1 0 0 2 0 0 1 0 0 0 1 0 1 0 1 0 0 0 1 2 1 0 2 2 1 0 1 0 1 1 1 0 0",
"output": "21"
},
{
"input": "35\n2 2 0 3 2 2 0 3 3 1 1 3 3 1 2 2 0 2 2 2 2 3 1 0 2 1 3 2 2 3 2 3 3 1 2",
"output": "11"
},
{
"input": "35\n1 2 2 3 3 3 3 3 2 2 3 3 2 3 3 2 3 2 3 3 2 2 2 3 3 2 3 3 3 1 3 3 2 2 2",
"output": "7"
},
{
"input": "40\n2 0 1 1 0 0 0 0 2 0 1 1 1 0 0 1 0 0 0 0 0 2 0 0 0 2 1 1 1 3 0 0 0 0 0 0 0 1 1 0",
"output": "28"
},
{
"input": "40\n2 2 3 2 0 2 3 2 1 2 3 0 2 3 2 1 1 3 1 1 0 2 3 1 3 3 1 1 3 3 2 2 1 3 3 3 2 3 3 1",
"output": "10"
},
{
"input": "40\n1 3 2 3 3 2 3 3 2 2 3 1 2 1 2 2 3 1 2 2 1 2 2 2 1 2 2 3 2 3 2 3 2 3 3 3 1 3 2 3",
"output": "8"
},
{
"input": "45\n2 1 0 0 0 2 1 0 1 0 0 2 2 1 1 0 0 2 0 0 0 0 0 0 1 0 0 2 0 0 1 1 0 0 1 0 0 1 1 2 0 0 2 0 2",
"output": "29"
},
{
"input": "45\n3 3 2 3 3 3 2 2 3 2 3 1 3 2 3 2 2 1 1 3 2 3 2 1 3 1 2 3 2 2 0 3 3 2 3 2 3 2 3 2 0 3 1 1 3",
"output": "8"
},
{
"input": "50\n3 0 0 0 2 0 0 0 0 0 0 0 2 1 0 2 0 1 0 1 3 0 2 1 1 0 0 1 1 0 0 1 2 1 1 2 1 1 0 0 0 0 0 0 0 1 2 2 0 0",
"output": "32"
},
{
"input": "50\n3 3 3 3 1 0 3 3 0 2 3 1 1 1 3 2 3 3 3 3 3 1 0 1 2 2 3 3 2 3 0 0 0 2 1 0 1 2 2 2 2 0 2 2 2 1 2 3 3 2",
"output": "16"
},
{
"input": "50\n3 2 3 1 2 1 2 3 3 2 3 3 2 1 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 2 3 3 3 3 2 3 1 2 3 3 2 3 3 1 2 2 1 1 3 3",
"output": "7"
},
{
"input": "55\n0 0 1 1 0 1 0 0 1 0 1 0 0 0 2 0 0 1 0 0 0 1 0 0 0 0 3 1 0 0 0 1 0 0 0 0 2 0 0 0 2 0 2 1 0 0 0 0 0 0 0 0 2 0 0",
"output": "40"
},
{
"input": "55\n3 0 3 3 3 2 0 2 3 0 3 2 3 3 0 3 3 1 3 3 1 2 3 2 0 3 3 2 1 2 3 2 3 0 3 2 2 1 2 3 2 2 1 3 2 2 3 1 3 2 2 3 3 2 2",
"output": "13"
},
{
"input": "55\n3 3 1 3 2 3 2 3 2 2 3 3 3 3 3 1 1 3 3 2 3 2 3 2 0 1 3 3 3 3 2 3 2 3 1 1 2 2 2 3 3 3 3 3 2 2 2 3 2 3 3 3 3 1 3",
"output": "7"
},
{
"input": "60\n0 1 0 0 0 0 0 0 0 2 1 1 3 0 0 0 0 0 1 0 1 1 0 0 0 3 0 1 0 1 0 2 0 0 0 0 0 1 0 0 0 0 1 1 0 1 0 0 0 0 0 1 0 0 1 0 1 0 0 0",
"output": "44"
},
{
"input": "60\n3 2 1 3 2 2 3 3 3 1 1 3 2 2 3 3 1 3 2 2 3 3 2 2 2 2 0 2 2 3 2 3 0 3 3 3 2 3 3 0 1 3 2 1 3 1 1 2 1 3 1 1 2 2 1 3 3 3 2 2",
"output": "15"
},
{
"input": "60\n3 2 2 3 2 3 2 3 3 2 3 2 3 3 2 3 3 3 3 3 3 2 3 3 1 2 3 3 3 2 1 3 3 1 3 1 3 0 3 3 3 2 3 2 3 2 3 3 1 1 2 3 3 3 3 2 1 3 2 3",
"output": "8"
},
{
"input": "65\n1 0 2 1 1 0 1 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 0 1 2 0 2 1 0 2 1 0 1 0 1 1 0 1 1 1 2 1 0 1 0 0 0 0 1 2 2 1 0 0 1 2 1 2 0 2 0 0 0 1 1",
"output": "35"
},
{
"input": "65\n2 2 2 3 0 2 1 2 3 3 1 3 1 2 1 3 2 3 2 2 2 1 2 0 3 1 3 1 1 3 1 3 3 3 3 3 1 3 0 3 1 3 1 2 2 3 2 0 3 1 3 2 1 2 2 2 3 3 2 3 3 3 2 2 3",
"output": "13"
},
{
"input": "65\n3 2 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 2 3 2 2 3 3 3 3 3 2 2 2 3 3 2 3 3 2 3 3 3 3 2 3 3 3 2 2 3 3 3 3 3 3 2 2 3 3 2 3 3 1 3 3 3 3",
"output": "6"
},
{
"input": "70\n1 0 0 0 1 0 1 0 0 0 1 1 0 1 0 0 1 1 1 0 1 1 0 0 1 1 1 3 1 1 0 1 2 0 2 1 0 0 0 1 1 1 1 1 0 0 1 0 0 0 1 1 1 3 0 0 1 0 0 0 1 0 0 0 0 0 1 0 1 1",
"output": "43"
},
{
"input": "70\n2 3 3 3 1 3 3 1 2 1 1 2 2 3 0 2 3 3 1 3 3 2 2 3 3 3 2 2 2 2 1 3 3 0 2 1 1 3 2 3 3 2 2 3 1 3 1 2 3 2 3 3 2 2 2 3 1 1 2 1 3 3 2 2 3 3 3 1 1 1",
"output": "16"
},
{
"input": "70\n3 3 2 2 1 2 1 2 2 2 2 2 3 3 2 3 3 3 3 2 2 2 2 3 3 3 1 3 3 3 2 3 3 3 3 2 3 3 1 3 1 3 2 3 3 2 3 3 3 2 3 2 3 3 1 2 3 3 2 2 2 3 2 3 3 3 3 3 3 1",
"output": "10"
},
{
"input": "75\n1 0 0 1 1 0 0 1 0 1 2 0 0 2 1 1 0 0 0 0 0 0 2 1 1 0 0 0 0 1 0 1 0 1 1 1 0 1 0 0 1 0 0 0 0 0 0 1 1 0 0 1 2 1 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 1 1 1 0 1 0",
"output": "51"
},
{
"input": "75\n1 3 3 3 1 1 3 2 3 3 1 3 3 3 2 1 3 2 2 3 1 1 1 1 1 1 2 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 2 2 2 1 2 3 3 2 2 3 0 1 1 3 3 0 0 1 1 3 2 3 3 3 3 1 2 2 3 3 3 3 1",
"output": "16"
},
{
"input": "75\n3 3 3 3 2 2 3 2 2 3 2 2 1 2 3 3 2 2 3 3 1 2 2 2 1 3 3 3 1 2 2 3 3 3 2 3 2 2 2 3 3 1 3 2 2 3 3 3 0 3 2 1 3 3 2 3 3 3 3 1 2 3 3 3 2 2 3 3 3 3 2 2 3 3 1",
"output": "11"
},
{
"input": "80\n0 0 0 0 2 0 1 1 1 1 1 0 0 0 0 2 0 0 1 0 0 0 0 1 1 0 2 2 1 1 0 1 0 1 0 1 1 1 0 1 2 1 1 0 0 0 1 1 0 1 1 0 1 0 0 1 0 0 1 0 0 0 0 0 0 0 2 2 0 1 1 0 0 0 0 0 0 0 0 1",
"output": "56"
},
{
"input": "80\n2 2 3 3 2 1 0 1 0 3 2 2 3 2 1 3 1 3 3 2 3 3 3 2 3 3 3 2 1 3 3 1 3 3 3 3 3 3 2 2 2 1 3 2 1 3 2 1 1 0 1 1 2 1 3 0 1 2 3 2 2 3 2 3 1 3 3 2 1 1 0 3 3 3 3 1 2 1 2 0",
"output": "17"
},
{
"input": "80\n2 3 3 2 2 2 3 3 2 3 3 3 3 3 2 3 2 3 2 3 3 3 3 3 3 3 3 3 2 3 1 3 2 3 3 0 3 1 2 3 3 1 2 3 2 3 3 2 3 3 3 3 3 2 2 3 0 3 3 3 3 3 2 2 3 2 3 3 3 3 3 2 3 2 3 3 3 3 2 3",
"output": "9"
},
{
"input": "85\n0 1 1 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 2 0 1 0 0 2 0 1 1 0 0 0 0 2 2 0 0 0 1 0 0 0 1 2 0 1 0 0 0 2 1 1 2 0 3 1 0 2 2 1 0 0 1 1 0 0 0 0 1 0 2 1 1 2 1 0 0 1 2 1 2 0 0 1 0 1 0",
"output": "54"
},
{
"input": "85\n2 3 1 3 2 3 1 3 3 2 1 2 1 2 2 3 2 2 3 2 0 3 3 2 1 2 2 2 3 3 2 3 3 3 2 1 1 3 1 3 2 2 2 3 3 2 3 2 3 1 1 3 2 3 1 3 3 2 3 3 2 2 3 0 1 1 2 2 2 2 1 2 3 1 3 3 1 3 2 2 3 2 3 3 3",
"output": "19"
},
{
"input": "85\n1 2 1 2 3 2 3 3 3 3 3 3 3 2 1 3 2 3 3 3 3 2 3 3 3 1 3 3 3 3 2 3 3 3 3 3 3 2 2 1 3 3 3 3 2 2 3 1 1 2 3 3 3 2 3 3 3 3 3 2 3 3 3 2 2 3 3 1 1 1 3 3 3 3 1 3 3 3 1 3 3 1 3 2 3",
"output": "9"
},
{
"input": "90\n2 0 1 0 0 0 0 0 0 1 1 2 0 0 0 0 0 0 0 2 2 0 2 0 0 2 1 0 2 0 1 0 1 0 0 1 2 2 0 0 1 0 0 1 0 1 0 2 0 1 1 1 0 1 1 0 1 0 2 0 1 0 1 0 0 0 1 0 0 1 2 0 0 0 1 0 0 2 2 0 0 0 0 0 1 3 1 1 0 1",
"output": "57"
},
{
"input": "90\n2 3 3 3 2 3 2 1 3 0 3 2 3 3 2 1 3 3 2 3 2 3 3 2 1 3 1 3 3 1 2 2 3 3 2 1 2 3 2 3 0 3 3 2 2 3 1 0 3 3 1 3 3 3 3 2 1 2 2 1 3 2 1 3 3 1 2 0 2 2 3 2 2 3 3 3 1 3 2 1 2 3 3 2 3 2 3 3 2 1",
"output": "17"
},
{
"input": "90\n2 3 2 3 2 2 3 3 2 3 2 1 2 3 3 3 2 3 2 3 3 2 3 3 3 1 3 3 1 3 2 3 2 2 1 3 3 3 3 3 3 3 3 3 3 2 3 2 3 2 1 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 1 3 2 3 3 3 2 2 3 2 3 2 1 3 2",
"output": "9"
},
{
"input": "95\n0 0 3 0 2 0 1 0 0 2 0 0 0 0 0 0 0 1 0 0 0 2 0 0 0 0 0 1 0 0 2 1 0 0 1 0 0 0 1 0 0 0 0 1 0 1 0 0 1 0 1 2 0 1 2 2 0 0 1 0 2 0 0 0 1 0 2 1 2 1 0 1 0 0 0 1 0 0 1 1 2 1 1 1 1 2 0 0 0 0 0 1 1 0 1",
"output": "61"
},
{
"input": "95\n2 3 3 2 1 1 3 3 3 2 3 3 3 2 3 2 3 3 3 2 3 2 2 3 3 2 1 2 3 3 3 1 3 0 3 3 1 3 3 1 0 1 3 3 3 0 2 1 3 3 3 3 0 1 3 2 3 3 2 1 3 1 2 1 1 2 3 0 3 3 2 1 3 2 1 3 3 3 2 2 3 2 3 3 3 2 1 3 3 3 2 3 3 1 2",
"output": "15"
},
{
"input": "95\n2 3 3 2 3 2 2 1 3 1 2 1 2 3 1 2 3 3 1 3 3 3 1 2 3 2 2 2 2 3 3 3 2 2 3 3 3 3 3 1 2 2 3 3 3 3 2 3 2 2 2 3 3 2 3 3 3 3 3 3 3 0 3 2 0 3 3 1 3 3 3 2 3 2 3 2 3 3 3 3 2 2 1 1 3 3 3 3 3 1 3 3 3 3 2",
"output": "14"
},
{
"input": "100\n1 0 2 0 0 0 0 2 0 0 0 1 0 1 0 0 1 0 1 2 0 1 1 0 0 1 0 1 1 0 0 0 2 0 1 0 0 2 0 0 0 0 0 1 1 1 0 0 1 0 2 0 0 0 0 1 0 1 0 1 0 1 0 1 2 2 0 0 2 0 1 0 1 0 1 0 0 0 1 0 0 2 1 1 1 0 0 1 0 0 0 2 0 0 2 1 1 0 0 2",
"output": "63"
},
{
"input": "100\n3 2 1 3 2 3 2 3 2 2 3 1 3 3 3 3 3 2 2 3 2 2 3 2 3 3 3 2 3 1 2 1 3 3 3 3 1 3 3 3 3 3 2 3 2 1 3 3 1 2 2 3 1 3 3 1 2 2 1 3 1 3 2 2 3 3 1 3 2 3 1 2 1 2 3 3 2 2 1 2 3 3 3 3 3 1 3 3 3 3 2 1 3 0 3 3 3 2 3 3",
"output": "15"
},
{
"input": "100\n1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2",
"output": "0"
},
{
"input": "100\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3",
"output": "0"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "50"
},
{
"input": "100\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "49"
},
{
"input": "100\n2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 2 1",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "2\n0 3",
"output": "1"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "1"
},
{
"input": "2\n2 1",
"output": "0"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "2\n3 0",
"output": "1"
},
{
"input": "2\n3 1",
"output": "0"
},
{
"input": "100\n3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0 3 0",
"output": "50"
}
] | 1,607,436,993
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 140
| 0
|
n=int(input())
l=list(map(int,input().split()))
dp=[0 for _ in range(n+1)]
for i in range(1,n+1):
if l[i-1]==0:
dp[i]=0
elif l[i-1]==1:
if dp[i-1]!=1:
dp[i]=1
else:
dp[i]=0
elif l[i-1]==2:
if dp[i-1]!=2:
dp[i]=2
else:
dp[i]=0
else:
if dp[i-1]==1:
dp[i]=2
elif dp[i-1]==2:
dp[i]=1
else:
if i!=n:
if l[i]==2:
dp[i]=1
elif l[i]==1:
dp[i]=2
else:
dp[i]=1
else:
dp[i]=1
#print(dp)
c=0
for i in range(len(dp)):
if dp[i]==0:
c+=1
print(c-1)
|
Title: Vacations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* days of vacations! So he decided to improve his IT skills and do sport. Vasya knows the following information about each of this *n* days: whether that gym opened and whether a contest was carried out in the Internet on that day. For the *i*-th day there are four options:
1. on this day the gym is closed and the contest is not carried out; 1. on this day the gym is closed and the contest is carried out; 1. on this day the gym is open and the contest is not carried out; 1. on this day the gym is open and the contest is carried out.
On each of days Vasya can either have a rest or write the contest (if it is carried out on this day), or do sport (if the gym is open on this day).
Find the minimum number of days on which Vasya will have a rest (it means, he will not do sport and write the contest at the same time). The only limitation that Vasya has — he does not want to do the same activity on two consecutive days: it means, he will not do sport on two consecutive days, and write the contest on two consecutive days.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100) — the number of days of Vasya's vacations.
The second line contains the sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=3) separated by space, where:
- *a**i* equals 0, if on the *i*-th day of vacations the gym is closed and the contest is not carried out; - *a**i* equals 1, if on the *i*-th day of vacations the gym is closed, but the contest is carried out; - *a**i* equals 2, if on the *i*-th day of vacations the gym is open and the contest is not carried out; - *a**i* equals 3, if on the *i*-th day of vacations the gym is open and the contest is carried out.
Output Specification:
Print the minimum possible number of days on which Vasya will have a rest. Remember that Vasya refuses:
- to do sport on any two consecutive days, - to write the contest on any two consecutive days.
Demo Input:
['4\n1 3 2 0\n', '7\n1 3 3 2 1 2 3\n', '2\n2 2\n']
Demo Output:
['2\n', '0\n', '1\n']
Note:
In the first test Vasya can write the contest on the day number 1 and do sport on the day number 3. Thus, he will have a rest for only 2 days.
In the second test Vasya should write contests on days number 1, 3, 5 and 7, in other days do sport. Thus, he will not have a rest for a single day.
In the third test Vasya can do sport either on a day number 1 or number 2. He can not do sport in two days, because it will be contrary to the his limitation. Thus, he will have a rest for only one day.
|
```python
n=int(input())
l=list(map(int,input().split()))
dp=[0 for _ in range(n+1)]
for i in range(1,n+1):
if l[i-1]==0:
dp[i]=0
elif l[i-1]==1:
if dp[i-1]!=1:
dp[i]=1
else:
dp[i]=0
elif l[i-1]==2:
if dp[i-1]!=2:
dp[i]=2
else:
dp[i]=0
else:
if dp[i-1]==1:
dp[i]=2
elif dp[i-1]==2:
dp[i]=1
else:
if i!=n:
if l[i]==2:
dp[i]=1
elif l[i]==1:
dp[i]=2
else:
dp[i]=1
else:
dp[i]=1
#print(dp)
c=0
for i in range(len(dp)):
if dp[i]==0:
c+=1
print(c-1)
```
| 0
|
|
545
|
C
|
Woodcutters
|
PROGRAMMING
| 1,500
|
[
"dp",
"greedy"
] | null | null |
Little Susie listens to fairy tales before bed every day. Today's fairy tale was about wood cutters and the little girl immediately started imagining the choppers cutting wood. She imagined the situation that is described below.
There are *n* trees located along the road at points with coordinates *x*1,<=*x*2,<=...,<=*x**n*. Each tree has its height *h**i*. Woodcutters can cut down a tree and fell it to the left or to the right. After that it occupies one of the segments [*x**i*<=-<=*h**i*,<=*x**i*] or [*x**i*;*x**i*<=+<=*h**i*]. The tree that is not cut down occupies a single point with coordinate *x**i*. Woodcutters can fell a tree if the segment to be occupied by the fallen tree doesn't contain any occupied point. The woodcutters want to process as many trees as possible, so Susie wonders, what is the maximum number of trees to fell.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of trees.
Next *n* lines contain pairs of integers *x**i*,<=*h**i* (1<=≤<=*x**i*,<=*h**i*<=≤<=109) — the coordinate and the height of the *і*-th tree.
The pairs are given in the order of ascending *x**i*. No two trees are located at the point with the same coordinate.
|
Print a single number — the maximum number of trees that you can cut down by the given rules.
|
[
"5\n1 2\n2 1\n5 10\n10 9\n19 1\n",
"5\n1 2\n2 1\n5 10\n10 9\n20 1\n"
] |
[
"3\n",
"4\n"
] |
In the first sample you can fell the trees like that:
- fell the 1-st tree to the left — now it occupies segment [ - 1;1] - fell the 2-nd tree to the right — now it occupies segment [2;3] - leave the 3-rd tree — it occupies point 5 - leave the 4-th tree — it occupies point 10 - fell the 5-th tree to the right — now it occupies segment [19;20]
In the second sample you can also fell 4-th tree to the right, after that it will occupy segment [10;19].
| 1,750
|
[
{
"input": "5\n1 2\n2 1\n5 10\n10 9\n19 1",
"output": "3"
},
{
"input": "5\n1 2\n2 1\n5 10\n10 9\n20 1",
"output": "4"
},
{
"input": "4\n10 4\n15 1\n19 3\n20 1",
"output": "4"
},
{
"input": "35\n1 7\n3 11\n6 12\n7 6\n8 5\n9 11\n15 3\n16 10\n22 2\n23 3\n25 7\n27 3\n34 5\n35 10\n37 3\n39 4\n40 5\n41 1\n44 1\n47 7\n48 11\n50 6\n52 5\n57 2\n58 7\n60 4\n62 1\n67 3\n68 12\n69 8\n70 1\n71 5\n72 5\n73 6\n74 4",
"output": "10"
},
{
"input": "40\n1 1\n2 1\n3 1\n4 1\n5 1\n6 1\n7 1\n8 1\n9 1\n10 1\n11 1\n12 1\n13 1\n14 1\n15 1\n16 1\n17 1\n18 1\n19 1\n20 1\n21 1\n22 1\n23 1\n24 1\n25 1\n26 1\n27 1\n28 1\n29 1\n30 1\n31 1\n32 1\n33 1\n34 1\n35 1\n36 1\n37 1\n38 1\n39 1\n40 1",
"output": "2"
},
{
"input": "67\n1 1\n3 8\n4 10\n7 8\n9 2\n10 1\n11 5\n12 8\n13 4\n16 6\n18 3\n19 3\n22 5\n24 6\n27 5\n28 3\n29 3\n30 5\n32 5\n33 10\n34 7\n35 8\n36 5\n41 3\n42 2\n43 5\n46 4\n48 4\n49 9\n52 4\n53 9\n55 1\n56 4\n59 7\n68 7\n69 4\n71 9\n72 10\n74 5\n76 4\n77 9\n80 7\n81 9\n82 5\n83 5\n84 9\n85 7\n86 9\n87 4\n88 7\n89 10\n90 3\n91 5\n92 10\n93 5\n94 8\n95 4\n96 2\n97 10\n98 1\n99 3\n100 1\n101 5\n102 4\n103 8\n104 8\n105 8",
"output": "5"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "10\n7 12\n10 2\n12 2\n15 1\n19 2\n20 1\n53 25\n63 10\n75 12\n87 1",
"output": "9"
},
{
"input": "3\n1 1\n1000 1000\n1000000000 1000000000",
"output": "3"
},
{
"input": "2\n1 999999999\n1000000000 1000000000",
"output": "2"
},
{
"input": "10\n999999900 1000000000\n999999901 1000000000\n999999902 1000000000\n999999903 1000000000\n999999904 1000000000\n999999905 1000000000\n999999906 1000000000\n999999907 1000000000\n999999908 1000000000\n999999909 1000000000",
"output": "2"
},
{
"input": "2\n100000000 1000000000\n1000000000 1000000000",
"output": "2"
}
] | 1,667,004,686
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 327
| 8,806,400
|
n = int(input())
s = [[int(x) for x in input().split()] for i in range(n)]
count = 2
if n == 1:
print(1)
else:
for i in range(1, n-1):
if s[i][0] - s[i-1][0] > s[i][1]:
count += 1
elif s[i+1][0] - s[i][0] > s[i][1]:
count += 1
print(count)
|
Title: Woodcutters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Susie listens to fairy tales before bed every day. Today's fairy tale was about wood cutters and the little girl immediately started imagining the choppers cutting wood. She imagined the situation that is described below.
There are *n* trees located along the road at points with coordinates *x*1,<=*x*2,<=...,<=*x**n*. Each tree has its height *h**i*. Woodcutters can cut down a tree and fell it to the left or to the right. After that it occupies one of the segments [*x**i*<=-<=*h**i*,<=*x**i*] or [*x**i*;*x**i*<=+<=*h**i*]. The tree that is not cut down occupies a single point with coordinate *x**i*. Woodcutters can fell a tree if the segment to be occupied by the fallen tree doesn't contain any occupied point. The woodcutters want to process as many trees as possible, so Susie wonders, what is the maximum number of trees to fell.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of trees.
Next *n* lines contain pairs of integers *x**i*,<=*h**i* (1<=≤<=*x**i*,<=*h**i*<=≤<=109) — the coordinate and the height of the *і*-th tree.
The pairs are given in the order of ascending *x**i*. No two trees are located at the point with the same coordinate.
Output Specification:
Print a single number — the maximum number of trees that you can cut down by the given rules.
Demo Input:
['5\n1 2\n2 1\n5 10\n10 9\n19 1\n', '5\n1 2\n2 1\n5 10\n10 9\n20 1\n']
Demo Output:
['3\n', '4\n']
Note:
In the first sample you can fell the trees like that:
- fell the 1-st tree to the left — now it occupies segment [ - 1;1] - fell the 2-nd tree to the right — now it occupies segment [2;3] - leave the 3-rd tree — it occupies point 5 - leave the 4-th tree — it occupies point 10 - fell the 5-th tree to the right — now it occupies segment [19;20]
In the second sample you can also fell 4-th tree to the right, after that it will occupy segment [10;19].
|
```python
n = int(input())
s = [[int(x) for x in input().split()] for i in range(n)]
count = 2
if n == 1:
print(1)
else:
for i in range(1, n-1):
if s[i][0] - s[i-1][0] > s[i][1]:
count += 1
elif s[i+1][0] - s[i][0] > s[i][1]:
count += 1
print(count)
```
| 0
|
|
679
|
A
|
Bear and Prime 100
|
PROGRAMMING
| 1,400
|
[
"constructive algorithms",
"interactive",
"math"
] | null | null |
This is an interactive problem. In the output section below you will see the information about flushing the output.
Bear Limak thinks of some hidden number — an integer from interval [2,<=100]. Your task is to say if the hidden number is prime or composite.
Integer *x*<=><=1 is called prime if it has exactly two distinct divisors, 1 and *x*. If integer *x*<=><=1 is not prime, it's called composite.
You can ask up to 20 queries about divisors of the hidden number. In each query you should print an integer from interval [2,<=100]. The system will answer "yes" if your integer is a divisor of the hidden number. Otherwise, the answer will be "no".
For example, if the hidden number is 14 then the system will answer "yes" only if you print 2, 7 or 14.
When you are done asking queries, print "prime" or "composite" and terminate your program.
You will get the Wrong Answer verdict if you ask more than 20 queries, or if you print an integer not from the range [2,<=100]. Also, you will get the Wrong Answer verdict if the printed answer isn't correct.
You will get the Idleness Limit Exceeded verdict if you don't print anything (but you should) or if you forget about flushing the output (more info below).
|
After each query you should read one string from the input. It will be "yes" if the printed integer is a divisor of the hidden number, and "no" otherwise.
|
Up to 20 times you can ask a query — print an integer from interval [2,<=100] in one line. You have to both print the end-of-line character and flush the output. After flushing you should read a response from the input.
In any moment you can print the answer "prime" or "composite" (without the quotes). After that, flush the output and terminate your program.
To flush you can use (just after printing an integer and end-of-line):
- fflush(stdout) in C++; - System.out.flush() in Java; - stdout.flush() in Python; - flush(output) in Pascal; - See the documentation for other languages.
Hacking. To hack someone, as the input you should print the hidden number — one integer from the interval [2,<=100]. Of course, his/her solution won't be able to read the hidden number from the input.
|
[
"yes\nno\nyes\n",
"no\nyes\nno\nno\nno\n"
] |
[
"2\n80\n5\ncomposite\n",
"58\n59\n78\n78\n2\nprime\n"
] |
The hidden number in the first query is 30. In a table below you can see a better form of the provided example of the communication process.
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ea790051c34ea7d2761cd9b096412ca7c647a173.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The hidden number is divisible by both 2 and 5. Thus, it must be composite. Note that it isn't necessary to know the exact value of the hidden number. In this test, the hidden number is 30.
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/35c6952617fa94ec3e0ea8e63aa1c3c49b3ba420.png" style="max-width: 100.0%;max-height: 100.0%;"/>
59 is a divisor of the hidden number. In the interval [2, 100] there is only one number with this divisor. The hidden number must be 59, which is prime. Note that the answer is known even after the second query and you could print it then and terminate. Though, it isn't forbidden to ask unnecessary queries (unless you exceed the limit of 20 queries).
| 750
|
[
{
"input": "30",
"output": "composite 4"
},
{
"input": "59",
"output": "prime 15"
},
{
"input": "2",
"output": "prime 16"
},
{
"input": "7",
"output": "prime 16"
},
{
"input": "9",
"output": "composite 3"
},
{
"input": "13",
"output": "prime 15"
},
{
"input": "55",
"output": "composite 6"
},
{
"input": "89",
"output": "prime 15"
},
{
"input": "3",
"output": "prime 16"
},
{
"input": "4",
"output": "composite 2"
},
{
"input": "6",
"output": "composite 4"
},
{
"input": "8",
"output": "composite 2"
},
{
"input": "11",
"output": "prime 15"
},
{
"input": "12",
"output": "composite 2"
},
{
"input": "25",
"output": "composite 4"
},
{
"input": "36",
"output": "composite 2"
},
{
"input": "46",
"output": "composite 10"
},
{
"input": "47",
"output": "prime 15"
},
{
"input": "49",
"output": "composite 5"
},
{
"input": "51",
"output": "composite 8"
},
{
"input": "53",
"output": "prime 15"
},
{
"input": "59",
"output": "prime 15"
},
{
"input": "64",
"output": "composite 2"
},
{
"input": "81",
"output": "composite 3"
},
{
"input": "91",
"output": "composite 7"
},
{
"input": "93",
"output": "composite 12"
},
{
"input": "94",
"output": "composite 16"
},
{
"input": "95",
"output": "composite 9"
},
{
"input": "96",
"output": "composite 2"
},
{
"input": "97",
"output": "prime 15"
},
{
"input": "99",
"output": "composite 3"
},
{
"input": "100",
"output": "composite 2"
},
{
"input": "26",
"output": "composite 7"
},
{
"input": "94",
"output": "composite 16"
},
{
"input": "25",
"output": "composite 4"
},
{
"input": "46",
"output": "composite 10"
},
{
"input": "49",
"output": "composite 5"
},
{
"input": "82",
"output": "composite 14"
},
{
"input": "87",
"output": "composite 11"
},
{
"input": "85",
"output": "composite 8"
},
{
"input": "74",
"output": "composite 13"
},
{
"input": "86",
"output": "composite 15"
},
{
"input": "93",
"output": "composite 12"
},
{
"input": "58",
"output": "composite 11"
},
{
"input": "47",
"output": "prime 15"
},
{
"input": "22",
"output": "composite 6"
},
{
"input": "23",
"output": "prime 15"
},
{
"input": "62",
"output": "composite 12"
},
{
"input": "38",
"output": "composite 9"
},
{
"input": "91",
"output": "composite 7"
},
{
"input": "34",
"output": "composite 8"
},
{
"input": "95",
"output": "composite 9"
},
{
"input": "4",
"output": "composite 2"
},
{
"input": "16",
"output": "composite 2"
},
{
"input": "96",
"output": "composite 2"
},
{
"input": "69",
"output": "composite 10"
},
{
"input": "65",
"output": "composite 7"
},
{
"input": "6",
"output": "composite 4"
},
{
"input": "18",
"output": "composite 4"
}
] | 1,658,833,330
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 31
| 0
|
p = [2, 2, 3, 3, 5, 5, 7, 7, 11, 11, 13, 13, 17, 17, 19, 19, 23, 23, 29, 29, 31, 31, 37, 37, 41, 41, 43, 43, 47, 47, 53, 53, 59, 59, 61, 61, 67, 67, 71, 71, 73, 73, 79, 79, 83, 83, 89, 89, 97, 97]
nofyes = 0
nofmoves = 20
i = 0
while nofmoves:
if i == 0:
print(p[0])
else:
print(p[i+1] if nofyes > 0 else p[i+2])
i += 1
nofmoves -= 1
res = input()
if res == "yes":
nofyes += 1
if nofyes >= 2:
print("composite")
break
else:
continue
else:
print('prime')
|
Title: Bear and Prime 100
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This is an interactive problem. In the output section below you will see the information about flushing the output.
Bear Limak thinks of some hidden number — an integer from interval [2,<=100]. Your task is to say if the hidden number is prime or composite.
Integer *x*<=><=1 is called prime if it has exactly two distinct divisors, 1 and *x*. If integer *x*<=><=1 is not prime, it's called composite.
You can ask up to 20 queries about divisors of the hidden number. In each query you should print an integer from interval [2,<=100]. The system will answer "yes" if your integer is a divisor of the hidden number. Otherwise, the answer will be "no".
For example, if the hidden number is 14 then the system will answer "yes" only if you print 2, 7 or 14.
When you are done asking queries, print "prime" or "composite" and terminate your program.
You will get the Wrong Answer verdict if you ask more than 20 queries, or if you print an integer not from the range [2,<=100]. Also, you will get the Wrong Answer verdict if the printed answer isn't correct.
You will get the Idleness Limit Exceeded verdict if you don't print anything (but you should) or if you forget about flushing the output (more info below).
Input Specification:
After each query you should read one string from the input. It will be "yes" if the printed integer is a divisor of the hidden number, and "no" otherwise.
Output Specification:
Up to 20 times you can ask a query — print an integer from interval [2,<=100] in one line. You have to both print the end-of-line character and flush the output. After flushing you should read a response from the input.
In any moment you can print the answer "prime" or "composite" (without the quotes). After that, flush the output and terminate your program.
To flush you can use (just after printing an integer and end-of-line):
- fflush(stdout) in C++; - System.out.flush() in Java; - stdout.flush() in Python; - flush(output) in Pascal; - See the documentation for other languages.
Hacking. To hack someone, as the input you should print the hidden number — one integer from the interval [2,<=100]. Of course, his/her solution won't be able to read the hidden number from the input.
Demo Input:
['yes\nno\nyes\n', 'no\nyes\nno\nno\nno\n']
Demo Output:
['2\n80\n5\ncomposite\n', '58\n59\n78\n78\n2\nprime\n']
Note:
The hidden number in the first query is 30. In a table below you can see a better form of the provided example of the communication process.
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ea790051c34ea7d2761cd9b096412ca7c647a173.png" style="max-width: 100.0%;max-height: 100.0%;"/>
The hidden number is divisible by both 2 and 5. Thus, it must be composite. Note that it isn't necessary to know the exact value of the hidden number. In this test, the hidden number is 30.
<img align="middle" class="tex-formula" src="https://espresso.codeforces.com/35c6952617fa94ec3e0ea8e63aa1c3c49b3ba420.png" style="max-width: 100.0%;max-height: 100.0%;"/>
59 is a divisor of the hidden number. In the interval [2, 100] there is only one number with this divisor. The hidden number must be 59, which is prime. Note that the answer is known even after the second query and you could print it then and terminate. Though, it isn't forbidden to ask unnecessary queries (unless you exceed the limit of 20 queries).
|
```python
p = [2, 2, 3, 3, 5, 5, 7, 7, 11, 11, 13, 13, 17, 17, 19, 19, 23, 23, 29, 29, 31, 31, 37, 37, 41, 41, 43, 43, 47, 47, 53, 53, 59, 59, 61, 61, 67, 67, 71, 71, 73, 73, 79, 79, 83, 83, 89, 89, 97, 97]
nofyes = 0
nofmoves = 20
i = 0
while nofmoves:
if i == 0:
print(p[0])
else:
print(p[i+1] if nofyes > 0 else p[i+2])
i += 1
nofmoves -= 1
res = input()
if res == "yes":
nofyes += 1
if nofyes >= 2:
print("composite")
break
else:
continue
else:
print('prime')
```
| 0
|
|
364
|
D
|
Ghd
|
PROGRAMMING
| 2,900
|
[
"brute force",
"math",
"probabilities"
] | null | null |
John Doe offered his sister Jane Doe find the gcd of some set of numbers *a*.
Gcd is a positive integer *g*, such that all number from the set are evenly divisible by *g* and there isn't such *g*' (*g*'<=><=*g*), that all numbers of the set are evenly divisible by *g*'.
Unfortunately Jane couldn't cope with the task and John offered her to find the ghd of the same subset of numbers.
Ghd is a positive integer *g*, such that at least half of numbers from the set are evenly divisible by *g* and there isn't such *g*' (*g*'<=><=*g*) that at least half of the numbers from the set are evenly divisible by *g*'.
Jane coped with the task for two hours. Please try it, too.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) showing how many numbers are in set *a*. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1012). Please note, that given set can contain equal numbers.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the %I64d specifier.
|
Print a single integer *g* — the Ghd of set *a*.
|
[
"6\n6 2 3 4 5 6\n",
"5\n5 5 6 10 15\n"
] |
[
"3\n",
"5\n"
] |
none
| 2,000
|
[
{
"input": "6\n6 2 3 4 5 6",
"output": "3"
},
{
"input": "5\n5 5 6 10 15",
"output": "5"
},
{
"input": "100\n32 40 7 3 7560 21 7560 7560 10 12 3 7560 7560 7560 7560 5 7560 7560 6 7560 7560 7560 35 7560 18 7560 7560 7560 7560 7560 48 2 7 25 7560 2 2 49 7560 7560 15 16 7560 7560 2 7560 27 7560 7560 7560 7560 3 5 7560 8 7560 42 45 5 7560 5 7560 4 7 3 7560 7 3 7560 7 2 7560 7560 5 3 7560 7560 28 7560 7560 14 7560 5 7560 20 7560 24 7560 2 9 36 7 7560 7560 7560 7560 7560 30 7560 50",
"output": "7560"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "2\n1 7",
"output": "7"
},
{
"input": "1\n1",
"output": "1"
}
] | 1,581,821,275
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 2,776
| 124,108,800
|
from random import randrange
from sys import stdin
def read_integers():
return list(map(int, stdin.readline().strip().split()))
def decompose(num, visited):
if num in visited:
return []
factors = []
i = 2
while i * i <= num:
quo, rem = divmod(num, i)
if i not in visited and rem == 0:
factors.append(i)
visited.add(i)
if quo not in visited and quo != i:
factors.append(quo)
visited.add(quo)
i += 1
factors.append(num)
visited.add(num)
factors.sort(reverse=True)
return factors
def ghd(arr):
n_trials = 10
max_f = 1
visited = set()
cache = {}
sample_arr = [arr[randrange(0, len(arr))] for _ in range(100)] if len(arr) >= 10 ** 5 else arr
for i in range(n_trials):
for f in decompose(arr[randrange(0, len(arr))], visited):
if any(f < x and x % f == 0 for x in cache):
cache[f] = -1
visited.add(f)
continue
cnt = sum(x % f == 0 for x in sample_arr)
if cnt * 2 >= len(sample_arr):
max_f = max(max_f, f)
cache[f] = cnt
return max_f
if True:
_, = read_integers()
arr = read_integers()
print(ghd(arr))
|
Title: Ghd
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
John Doe offered his sister Jane Doe find the gcd of some set of numbers *a*.
Gcd is a positive integer *g*, such that all number from the set are evenly divisible by *g* and there isn't such *g*' (*g*'<=><=*g*), that all numbers of the set are evenly divisible by *g*'.
Unfortunately Jane couldn't cope with the task and John offered her to find the ghd of the same subset of numbers.
Ghd is a positive integer *g*, such that at least half of numbers from the set are evenly divisible by *g* and there isn't such *g*' (*g*'<=><=*g*) that at least half of the numbers from the set are evenly divisible by *g*'.
Jane coped with the task for two hours. Please try it, too.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=106) showing how many numbers are in set *a*. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1012). Please note, that given set can contain equal numbers.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the %I64d specifier.
Output Specification:
Print a single integer *g* — the Ghd of set *a*.
Demo Input:
['6\n6 2 3 4 5 6\n', '5\n5 5 6 10 15\n']
Demo Output:
['3\n', '5\n']
Note:
none
|
```python
from random import randrange
from sys import stdin
def read_integers():
return list(map(int, stdin.readline().strip().split()))
def decompose(num, visited):
if num in visited:
return []
factors = []
i = 2
while i * i <= num:
quo, rem = divmod(num, i)
if i not in visited and rem == 0:
factors.append(i)
visited.add(i)
if quo not in visited and quo != i:
factors.append(quo)
visited.add(quo)
i += 1
factors.append(num)
visited.add(num)
factors.sort(reverse=True)
return factors
def ghd(arr):
n_trials = 10
max_f = 1
visited = set()
cache = {}
sample_arr = [arr[randrange(0, len(arr))] for _ in range(100)] if len(arr) >= 10 ** 5 else arr
for i in range(n_trials):
for f in decompose(arr[randrange(0, len(arr))], visited):
if any(f < x and x % f == 0 for x in cache):
cache[f] = -1
visited.add(f)
continue
cnt = sum(x % f == 0 for x in sample_arr)
if cnt * 2 >= len(sample_arr):
max_f = max(max_f, f)
cache[f] = cnt
return max_f
if True:
_, = read_integers()
arr = read_integers()
print(ghd(arr))
```
| 0
|
|
368
|
B
|
Sereja and Suffixes
|
PROGRAMMING
| 1,100
|
[
"data structures",
"dp"
] | null | null |
Sereja has an array *a*, consisting of *n* integers *a*1, *a*2, ..., *a**n*. The boy cannot sit and do nothing, he decided to study an array. Sereja took a piece of paper and wrote out *m* integers *l*1,<=*l*2,<=...,<=*l**m* (1<=≤<=*l**i*<=≤<=*n*). For each number *l**i* he wants to know how many distinct numbers are staying on the positions *l**i*, *l**i*<=+<=1, ..., *n*. Formally, he want to find the number of distinct numbers among *a**l**i*,<=*a**l**i*<=+<=1,<=...,<=*a**n*.?
Sereja wrote out the necessary array elements but the array was so large and the boy was so pressed for time. Help him, find the answer for the described question for each *l**i*.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105) — the array elements.
Next *m* lines contain integers *l*1,<=*l*2,<=...,<=*l**m*. The *i*-th line contains integer *l**i* (1<=≤<=*l**i*<=≤<=*n*).
|
Print *m* lines — on the *i*-th line print the answer to the number *l**i*.
|
[
"10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n"
] |
[
"6\n6\n6\n6\n6\n5\n4\n3\n2\n1\n"
] |
none
| 1,000
|
[
{
"input": "10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10",
"output": "6\n6\n6\n6\n6\n5\n4\n3\n2\n1"
},
{
"input": "8 3\n8 6 4 3 4 2 4 8\n6\n4\n2",
"output": "3\n4\n5"
},
{
"input": "7 10\n1 3 8 6 2 2 7\n4\n2\n6\n3\n4\n4\n6\n2\n7\n4",
"output": "3\n5\n2\n4\n3\n3\n2\n5\n1\n3"
},
{
"input": "10 2\n2 6 5 7 2 2 3 2 4 8\n1\n2",
"output": "7\n7"
},
{
"input": "7 1\n68346 10956 76708 23018 84063 34833 80407\n1",
"output": "7"
},
{
"input": "2 2\n8 4\n1\n1",
"output": "2\n2"
},
{
"input": "1 5\n5\n1\n1\n1\n1\n1",
"output": "1\n1\n1\n1\n1"
},
{
"input": "4 7\n3 1 4 2\n4\n1\n2\n3\n2\n4\n4",
"output": "1\n4\n3\n2\n3\n1\n1"
},
{
"input": "4 3\n9 1 7 1\n1\n4\n2",
"output": "3\n1\n2"
},
{
"input": "8 3\n9280 6676 2720 6172 8329 10413 3975 1394\n5\n6\n7",
"output": "4\n3\n2"
},
{
"input": "1 1\n1\n1",
"output": "1"
}
] | 1,675,019,257
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 1,000
| 4,915,200
|
n,m=list(map(int,input().split()))
a = list(map(int,input().split()))
for i in range(0,m):
s=[]
ctr=0
l = int(input())
for j in range(l,n+1):
if (a[j-1] not in s):
ctr+=1
s.append(a[j-1])
print(ctr)
|
Title: Sereja and Suffixes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja has an array *a*, consisting of *n* integers *a*1, *a*2, ..., *a**n*. The boy cannot sit and do nothing, he decided to study an array. Sereja took a piece of paper and wrote out *m* integers *l*1,<=*l*2,<=...,<=*l**m* (1<=≤<=*l**i*<=≤<=*n*). For each number *l**i* he wants to know how many distinct numbers are staying on the positions *l**i*, *l**i*<=+<=1, ..., *n*. Formally, he want to find the number of distinct numbers among *a**l**i*,<=*a**l**i*<=+<=1,<=...,<=*a**n*.?
Sereja wrote out the necessary array elements but the array was so large and the boy was so pressed for time. Help him, find the answer for the described question for each *l**i*.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105) — the array elements.
Next *m* lines contain integers *l*1,<=*l*2,<=...,<=*l**m*. The *i*-th line contains integer *l**i* (1<=≤<=*l**i*<=≤<=*n*).
Output Specification:
Print *m* lines — on the *i*-th line print the answer to the number *l**i*.
Demo Input:
['10 10\n1 2 3 4 1 2 3 4 100000 99999\n1\n2\n3\n4\n5\n6\n7\n8\n9\n10\n']
Demo Output:
['6\n6\n6\n6\n6\n5\n4\n3\n2\n1\n']
Note:
none
|
```python
n,m=list(map(int,input().split()))
a = list(map(int,input().split()))
for i in range(0,m):
s=[]
ctr=0
l = int(input())
for j in range(l,n+1):
if (a[j-1] not in s):
ctr+=1
s.append(a[j-1])
print(ctr)
```
| 0
|
|
478
|
C
|
Table Decorations
|
PROGRAMMING
| 1,800
|
[
"greedy"
] | null | null |
You have *r* red, *g* green and *b* blue balloons. To decorate a single table for the banquet you need exactly three balloons. Three balloons attached to some table shouldn't have the same color. What maximum number *t* of tables can be decorated if we know number of balloons of each color?
Your task is to write a program that for given values *r*, *g* and *b* will find the maximum number *t* of tables, that can be decorated in the required manner.
|
The single line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=2·109) — the number of red, green and blue baloons respectively. The numbers are separated by exactly one space.
|
Print a single integer *t* — the maximum number of tables that can be decorated in the required manner.
|
[
"5 4 3\n",
"1 1 1\n",
"2 3 3\n"
] |
[
"4\n",
"1\n",
"2\n"
] |
In the first sample you can decorate the tables with the following balloon sets: "rgg", "gbb", "brr", "rrg", where "r", "g" and "b" represent the red, green and blue balls, respectively.
| 1,500
|
[
{
"input": "5 4 3",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 3 3",
"output": "2"
},
{
"input": "0 1 0",
"output": "0"
},
{
"input": "0 3 3",
"output": "2"
},
{
"input": "4 0 4",
"output": "2"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "100 99 56",
"output": "85"
},
{
"input": "1000 1000 1002",
"output": "1000"
},
{
"input": "0 1 1000000000",
"output": "1"
},
{
"input": "500000000 1000000000 500000000",
"output": "666666666"
},
{
"input": "1000000000 2000000000 1000000000",
"output": "1333333333"
},
{
"input": "2000000000 2000000000 2000000000",
"output": "2000000000"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "1 2000000000 1000000000",
"output": "1000000000"
},
{
"input": "1585222789 1889821127 2000000000",
"output": "1825014638"
},
{
"input": "10000 7500 7500",
"output": "8333"
},
{
"input": "150000 75000 75000",
"output": "100000"
},
{
"input": "999288131 55884921 109298382",
"output": "165183303"
},
{
"input": "100500 100500 3",
"output": "67001"
},
{
"input": "1463615122 1988383731 837331500",
"output": "1429776784"
},
{
"input": "1938 8999 1882",
"output": "3820"
},
{
"input": "45 33 76",
"output": "51"
},
{
"input": "100000 1 2",
"output": "3"
},
{
"input": "198488 50 18",
"output": "68"
},
{
"input": "82728372 939848 100139442",
"output": "61269220"
},
{
"input": "99 5747 5298",
"output": "3714"
},
{
"input": "3 5 2",
"output": "3"
},
{
"input": "7511 7512 7513",
"output": "7512"
},
{
"input": "1234567890 123456789 987654321",
"output": "781893000"
},
{
"input": "500000000 2000000000 500000000",
"output": "1000000000"
},
{
"input": "500000002 2000000000 500000001",
"output": "1000000001"
},
{
"input": "520000000 1000000033 501000000",
"output": "673666677"
},
{
"input": "10000 1000 100000",
"output": "11000"
},
{
"input": "2000000000 500000000 499999999",
"output": "999999999"
},
{
"input": "1999999999 500000000 500000000",
"output": "999999999"
},
{
"input": "1 1 9",
"output": "2"
},
{
"input": "3 0 0",
"output": "0"
},
{
"input": "6 1 1",
"output": "2"
},
{
"input": "2000000000 1999999999 1999999999",
"output": "1999999999"
},
{
"input": "3 4 9",
"output": "5"
},
{
"input": "3 3 6",
"output": "4"
}
] | 1,699,811,630
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 10
| 62
| 0
|
a = list(map(int, input().split()))
a.sort()
cnt = a[0]
a[1] -= a[0]
a[2] -= a[0]
while a[1] >= 3 and a[2] >= 3:
a[1] -= 3
a[2] -= 3
cnt += 2
while a[1] >= 1 and a[2] >= 2:
a[1] -= 1
a[2] -= 2
cnt += 1
if a[1] >= 1 and a[2] >= 2:
print(cnt + (a[1] + a[2]) // 3)
else:
print(cnt)
|
Title: Table Decorations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have *r* red, *g* green and *b* blue balloons. To decorate a single table for the banquet you need exactly three balloons. Three balloons attached to some table shouldn't have the same color. What maximum number *t* of tables can be decorated if we know number of balloons of each color?
Your task is to write a program that for given values *r*, *g* and *b* will find the maximum number *t* of tables, that can be decorated in the required manner.
Input Specification:
The single line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=2·109) — the number of red, green and blue baloons respectively. The numbers are separated by exactly one space.
Output Specification:
Print a single integer *t* — the maximum number of tables that can be decorated in the required manner.
Demo Input:
['5 4 3\n', '1 1 1\n', '2 3 3\n']
Demo Output:
['4\n', '1\n', '2\n']
Note:
In the first sample you can decorate the tables with the following balloon sets: "rgg", "gbb", "brr", "rrg", where "r", "g" and "b" represent the red, green and blue balls, respectively.
|
```python
a = list(map(int, input().split()))
a.sort()
cnt = a[0]
a[1] -= a[0]
a[2] -= a[0]
while a[1] >= 3 and a[2] >= 3:
a[1] -= 3
a[2] -= 3
cnt += 2
while a[1] >= 1 and a[2] >= 2:
a[1] -= 1
a[2] -= 2
cnt += 1
if a[1] >= 1 and a[2] >= 2:
print(cnt + (a[1] + a[2]) // 3)
else:
print(cnt)
```
| 0
|
|
841
|
A
|
Generous Kefa
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends.
Next line contains string *s* — colors of baloons.
|
Answer to the task — «YES» or «NO» in a single line.
You can choose the case (lower or upper) for each letter arbitrary.
|
[
"4 2\naabb\n",
"6 3\naacaab\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second.
In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
| 500
|
[
{
"input": "4 2\naabb",
"output": "YES"
},
{
"input": "6 3\naacaab",
"output": "NO"
},
{
"input": "2 2\nlu",
"output": "YES"
},
{
"input": "5 3\novvoo",
"output": "YES"
},
{
"input": "36 13\nbzbzcffczzcbcbzzfzbbfzfzzbfbbcbfccbf",
"output": "YES"
},
{
"input": "81 3\nooycgmvvrophvcvpoupepqllqttwcocuilvyxbyumdmmfapvpnxhjhxfuagpnntonibicaqjvwfhwxhbv",
"output": "NO"
},
{
"input": "100 100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "YES"
},
{
"input": "100 1\nnubcvvjvbjgnjsdkajimdcxvewbcytvfkihunycdrlconddlwgzjasjlsrttlrzsumzpyumpveglfqzmaofbshbojmwuwoxxvrod",
"output": "NO"
},
{
"input": "100 13\nvyldolgryldqrvoldvzvrdrgorlorszddtgqvrlisxxrxdxlqtvtgsrqlzixoyrozxzogqxlsgzdddzqrgitxxritoolzolgrtvl",
"output": "YES"
},
{
"input": "18 6\njzwtnkvmscqhmdlsxy",
"output": "YES"
},
{
"input": "21 2\nfscegcqgzesefghhwcexs",
"output": "NO"
},
{
"input": "32 22\ncduamsptaklqtxlyoutlzepxgyfkvngc",
"output": "YES"
},
{
"input": "49 27\noxyorfnkzwsfllnyvdhdanppuzrnbxehugvmlkgeymqjlmfxd",
"output": "YES"
},
{
"input": "50 24\nxxutzjwbggcwvxztttkmzovtmuwttzcbwoztttohzzxghuuthv",
"output": "YES"
},
{
"input": "57 35\nglxshztrqqfyxthqamagvtmrdparhelnzrqvcwqxjytkbuitovkdxueul",
"output": "YES"
},
{
"input": "75 23\nittttiiuitutuiiuuututiuttiuiuutuuuiuiuuuuttuuttuutuiiuiuiiuiitttuututuiuuii",
"output": "NO"
},
{
"input": "81 66\nfeqevfqfebhvubhuuvfuqheuqhbeeuebehuvhffvbqvqvfbqqvvhevqffbqqhvvqhfeehuhqeqhueuqqq",
"output": "YES"
},
{
"input": "93 42\npqeiafraiavfcteumflpcbpozcomlvpovlzdbldvoopnhdoeqaopzthiuzbzmeieiatthdeqovaqfipqlddllmfcrrnhb",
"output": "YES"
},
{
"input": "100 53\nizszyqyndzwzyzgsdagdwdazadiawizinagqqgczaqqnawgijziziawzszdjdcqjdjqiwgadydcnqisaayjiqqsscwwzjzaycwwc",
"output": "YES"
},
{
"input": "100 14\nvkrdcqbvkwuckpmnbydmczdxoagdsgtqxvhaxntdcxhjcrjyvukhugoglbmyoaqexgtcfdgemmizoniwtmisqqwcwfusmygollab",
"output": "YES"
},
{
"input": "100 42\naaaaaiiiiaiiiaaiaiiaaiiiiiaaaaaiaiiiaiiiiaiiiaaaaaiiiaaaiiaaiiiaiiiaiaaaiaiiiiaaiiiaiiaiaiiaiiiaaaia",
"output": "NO"
},
{
"input": "100 89\ntjbkmydejporbqhcbztkcumxjjgsrvxpuulbhzeeckkbchpbxwhedrlhjsabcexcohgdzouvsgphjdthpuqrlkgzxvqbuhqxdsmf",
"output": "YES"
},
{
"input": "100 100\njhpyiuuzizhubhhpxbbhpyxzhbpjphzppuhiahihiappbhuypyauhizpbibzixjbzxzpbphuiaypyujappuxiyuyaajaxjupbahb",
"output": "YES"
},
{
"input": "100 3\nsszoovvzysavsvzsozzvoozvysozsaszayaszasaysszzzysosyayyvzozovavzoyavsooaoyvoozvvozsaosvayyovazzszzssa",
"output": "NO"
},
{
"input": "100 44\ndluthkxwnorabqsukgnxnvhmsmzilyulpursnxkdsavgemiuizbyzebhyjejgqrvuckhaqtuvdmpziesmpmewpvozdanjyvwcdgo",
"output": "YES"
},
{
"input": "100 90\ntljonbnwnqounictqqctgonktiqoqlocgoblngijqokuquoolciqwnctgoggcbojtwjlculoikbggquqncittwnjbkgkgubnioib",
"output": "YES"
},
{
"input": "100 79\nykxptzgvbqxlregvkvucewtydvnhqhuggdsyqlvcfiuaiddnrrnstityyehiamrggftsqyduwxpuldztyzgmfkehprrneyvtknmf",
"output": "YES"
},
{
"input": "100 79\naagwekyovbviiqeuakbqbqifwavkfkutoriovgfmittulhwojaptacekdirgqoovlleeoqkkdukpadygfwavppohgdrmymmulgci",
"output": "YES"
},
{
"input": "100 93\nearrehrehenaddhdnrdddhdahnadndheeennrearrhraharddreaeraddhehhhrdnredanndneheddrraaneerreedhnadnerhdn",
"output": "YES"
},
{
"input": "100 48\nbmmaebaebmmmbbmxvmammbvvebvaemvbbaxvbvmaxvvmveaxmbbxaaemxmxvxxxvxbmmxaaaevvaxmvamvvmaxaxavexbmmbmmev",
"output": "YES"
},
{
"input": "100 55\nhsavbkehaaesffaeeffakhkhfehbbvbeasahbbbvkesbfvkefeesesevbsvfkbffakvshsbkahfkfakebsvafkbvsskfhfvaasss",
"output": "YES"
},
{
"input": "100 2\ncscffcffsccffsfsfffccssfsscfsfsssffcffsscfccssfffcfscfsscsccccfsssffffcfcfsfffcsfsccffscffcfccccfffs",
"output": "NO"
},
{
"input": "100 3\nzrgznxgdpgfoiifrrrsjfuhvtqxjlgochhyemismjnanfvvpzzvsgajcbsulxyeoepjfwvhkqogiiwqxjkrpsyaqdlwffoockxnc",
"output": "NO"
},
{
"input": "100 5\njbltyyfjakrjeodqepxpkjideulofbhqzxjwlarufwzwsoxhaexpydpqjvhybmvjvntuvhvflokhshpicbnfgsqsmrkrfzcrswwi",
"output": "NO"
},
{
"input": "100 1\nfnslnqktlbmxqpvcvnemxcutebdwepoxikifkzaaixzzydffpdxodmsxjribmxuqhueifdlwzytxkklwhljswqvlejedyrgguvah",
"output": "NO"
},
{
"input": "100 21\nddjenetwgwmdtjbpzssyoqrtirvoygkjlqhhdcjgeurqpunxpupwaepcqkbjjfhnvgpyqnozhhrmhfwararmlcvpgtnopvjqsrka",
"output": "YES"
},
{
"input": "100 100\nnjrhiauqlgkkpkuvciwzivjbbplipvhslqgdkfnmqrxuxnycmpheenmnrglotzuyxycosfediqcuadklsnzjqzfxnbjwvfljnlvq",
"output": "YES"
},
{
"input": "100 100\nbbbbbbbtbbttbtbbbttbttbtbbttttbbbtbttbbbtbttbtbbttttbbbbbtbbttbtbbtbttbbbtbtbtbtbtbtbbbttbbtbtbtbbtb",
"output": "YES"
},
{
"input": "14 5\nfssmmsfffmfmmm",
"output": "NO"
},
{
"input": "2 1\nff",
"output": "NO"
},
{
"input": "2 1\nhw",
"output": "YES"
},
{
"input": "2 2\nss",
"output": "YES"
},
{
"input": "1 1\nl",
"output": "YES"
},
{
"input": "100 50\nfffffttttttjjjuuuvvvvvdddxxxxwwwwgggbsssncccczzyyyyyhhhhhkrreeeeeeaaaaaiiillllllllooooqqqqqqmmpppppp",
"output": "YES"
},
{
"input": "100 50\nbbbbbbbbgggggggggggaaaaaaaahhhhhhhhhhpppppppppsssssssrrrrrrrrllzzzzzzzeeeeeeekkkkkkkwwwwwwwwjjjjjjjj",
"output": "YES"
},
{
"input": "100 50\nwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxzzzzzzzzzzzzzzzzzzbbbbbbbbbbbbbbbbbbbbjjjjjjjjjjjjjjjjjjjjjjjj",
"output": "YES"
},
{
"input": "100 80\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm",
"output": "YES"
},
{
"input": "100 10\nbbttthhhhiiiiiiijjjjjvvvvpppssssseeeeeeewwwwgggkkkkkkkkmmmddddduuuzzzzllllnnnnnxxyyyffffccraaaaooooq",
"output": "YES"
},
{
"input": "100 20\nssssssssssbbbbbbbhhhhhhhyyyyyyyzzzzzzzzzzzzcccccxxxxxxxxxxddddmmmmmmmeeeeeeejjjjjjjjjwwwwwwwtttttttt",
"output": "YES"
},
{
"input": "1 2\na",
"output": "YES"
},
{
"input": "3 1\nabb",
"output": "NO"
},
{
"input": "2 1\naa",
"output": "NO"
},
{
"input": "2 1\nab",
"output": "YES"
},
{
"input": "6 2\naaaaaa",
"output": "NO"
},
{
"input": "8 4\naaaaaaaa",
"output": "NO"
},
{
"input": "4 2\naaaa",
"output": "NO"
},
{
"input": "4 3\naaaa",
"output": "NO"
},
{
"input": "1 3\na",
"output": "YES"
},
{
"input": "4 3\nzzzz",
"output": "NO"
},
{
"input": "4 1\naaaa",
"output": "NO"
},
{
"input": "3 4\nabc",
"output": "YES"
},
{
"input": "2 5\nab",
"output": "YES"
},
{
"input": "2 4\nab",
"output": "YES"
},
{
"input": "1 10\na",
"output": "YES"
},
{
"input": "5 2\nzzzzz",
"output": "NO"
},
{
"input": "53 26\naaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO"
},
{
"input": "4 1\nabab",
"output": "NO"
},
{
"input": "4 1\nabcb",
"output": "NO"
},
{
"input": "4 2\nabbb",
"output": "NO"
},
{
"input": "5 2\nabccc",
"output": "NO"
},
{
"input": "2 3\nab",
"output": "YES"
},
{
"input": "4 3\nbbbs",
"output": "YES"
},
{
"input": "10 2\nazzzzzzzzz",
"output": "NO"
},
{
"input": "1 2\nb",
"output": "YES"
},
{
"input": "1 3\nb",
"output": "YES"
},
{
"input": "4 5\nabcd",
"output": "YES"
},
{
"input": "4 6\naabb",
"output": "YES"
},
{
"input": "5 2\naaaab",
"output": "NO"
},
{
"input": "3 5\naaa",
"output": "YES"
},
{
"input": "5 3\nazzzz",
"output": "NO"
},
{
"input": "4 100\naabb",
"output": "YES"
},
{
"input": "3 10\naaa",
"output": "YES"
},
{
"input": "3 4\naaa",
"output": "YES"
},
{
"input": "12 5\naaaaabbbbbbb",
"output": "NO"
},
{
"input": "5 2\naabbb",
"output": "NO"
},
{
"input": "10 5\nzzzzzzzzzz",
"output": "NO"
},
{
"input": "2 4\naa",
"output": "YES"
},
{
"input": "1 5\na",
"output": "YES"
},
{
"input": "10 5\naaaaaaaaaa",
"output": "NO"
},
{
"input": "6 3\naaaaaa",
"output": "NO"
},
{
"input": "7 1\nabcdeee",
"output": "NO"
},
{
"input": "18 3\naaaaaabbbbbbcccccc",
"output": "NO"
},
{
"input": "8 2\naabbccdd",
"output": "YES"
},
{
"input": "4 2\nzzzz",
"output": "NO"
},
{
"input": "4 2\nabaa",
"output": "NO"
},
{
"input": "3 2\naaa",
"output": "NO"
},
{
"input": "3 1\nzzz",
"output": "NO"
},
{
"input": "5 4\nzzzzz",
"output": "NO"
},
{
"input": "6 2\naabbbc",
"output": "NO"
},
{
"input": "3 6\naaa",
"output": "YES"
},
{
"input": "2 1\nzz",
"output": "NO"
},
{
"input": "10 3\naaaeeeeeee",
"output": "NO"
},
{
"input": "4 5\naabb",
"output": "YES"
},
{
"input": "3 1\naaa",
"output": "NO"
},
{
"input": "5 2\naazzz",
"output": "NO"
},
{
"input": "6 2\nabbbbc",
"output": "NO"
},
{
"input": "4 2\nxxxx",
"output": "NO"
},
{
"input": "6 3\nzzzzzz",
"output": "NO"
},
{
"input": "3 2\nabb",
"output": "YES"
},
{
"input": "3 2\nzzz",
"output": "NO"
},
{
"input": "6 5\nzzzzzz",
"output": "NO"
},
{
"input": "6 3\nbcaaaa",
"output": "NO"
},
{
"input": "100 100\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "YES"
},
{
"input": "3 6\nabc",
"output": "YES"
}
] | 1,620,141,587
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 2
| 77
| 307,200
|
from collections import defaultdict
def failed():
print('NO')
exit()
def passed():
print('YES')
exit()
ballons, friends = map(int, input().split())
types = defaultdict(int)
for x in list(input()):
types[x] += 1
# print(len(types))
if(len(types) == 0 or ballons<(2*friends)):
failed()
if(min(types.values()) > 1 ):
passed()
else:
failed()
# print(types.values())
|
Title: Generous Kefa
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends.
Next line contains string *s* — colors of baloons.
Output Specification:
Answer to the task — «YES» or «NO» in a single line.
You can choose the case (lower or upper) for each letter arbitrary.
Demo Input:
['4 2\naabb\n', '6 3\naacaab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second.
In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO».
|
```python
from collections import defaultdict
def failed():
print('NO')
exit()
def passed():
print('YES')
exit()
ballons, friends = map(int, input().split())
types = defaultdict(int)
for x in list(input()):
types[x] += 1
# print(len(types))
if(len(types) == 0 or ballons<(2*friends)):
failed()
if(min(types.values()) > 1 ):
passed()
else:
failed()
# print(types.values())
```
| 0
|
|
849
|
A
|
Odds and Ends
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Where do odds begin, and where do they end? Where does hope emerge, and will they ever break?
Given an integer sequence *a*1,<=*a*2,<=...,<=*a**n* of length *n*. Decide whether it is possible to divide it into an odd number of non-empty subsegments, the each of which has an odd length and begins and ends with odd numbers.
A subsegment is a contiguous slice of the whole sequence. For example, {3,<=4,<=5} and {1} are subsegments of sequence {1,<=2,<=3,<=4,<=5,<=6}, while {1,<=2,<=4} and {7} are not.
|
The first line of input contains a non-negative integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence.
The second line contains *n* space-separated non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100) — the elements of the sequence.
|
Output "Yes" if it's possible to fulfill the requirements, and "No" otherwise.
You can output each letter in any case (upper or lower).
|
[
"3\n1 3 5\n",
"5\n1 0 1 5 1\n",
"3\n4 3 1\n",
"4\n3 9 9 3\n"
] |
[
"Yes\n",
"Yes\n",
"No\n",
"No\n"
] |
In the first example, divide the sequence into 1 subsegment: {1, 3, 5} and the requirements will be met.
In the second example, divide the sequence into 3 subsegments: {1, 0, 1}, {5}, {1}.
In the third example, one of the subsegments must start with 4 which is an even number, thus the requirements cannot be met.
In the fourth example, the sequence can be divided into 2 subsegments: {3, 9, 9}, {3}, but this is not a valid solution because 2 is an even number.
| 500
|
[
{
"input": "3\n1 3 5",
"output": "Yes"
},
{
"input": "5\n1 0 1 5 1",
"output": "Yes"
},
{
"input": "3\n4 3 1",
"output": "No"
},
{
"input": "4\n3 9 9 3",
"output": "No"
},
{
"input": "1\n1",
"output": "Yes"
},
{
"input": "5\n100 99 100 99 99",
"output": "No"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "No"
},
{
"input": "1\n0",
"output": "No"
},
{
"input": "2\n1 1",
"output": "No"
},
{
"input": "2\n10 10",
"output": "No"
},
{
"input": "2\n54 21",
"output": "No"
},
{
"input": "5\n0 0 0 0 0",
"output": "No"
},
{
"input": "5\n67 92 0 26 43",
"output": "Yes"
},
{
"input": "15\n45 52 35 80 68 80 93 57 47 32 69 23 63 90 43",
"output": "Yes"
},
{
"input": "15\n81 28 0 82 71 64 63 89 87 92 38 30 76 72 36",
"output": "No"
},
{
"input": "50\n49 32 17 59 77 98 65 50 85 10 40 84 65 34 52 25 1 31 61 45 48 24 41 14 76 12 33 76 44 86 53 33 92 58 63 93 50 24 31 79 67 50 72 93 2 38 32 14 87 99",
"output": "No"
},
{
"input": "55\n65 69 53 66 11 100 68 44 43 17 6 66 24 2 6 6 61 72 91 53 93 61 52 96 56 42 6 8 79 49 76 36 83 58 8 43 2 90 71 49 80 21 75 13 76 54 95 61 58 82 40 33 73 61 46",
"output": "No"
},
{
"input": "99\n73 89 51 85 42 67 22 80 75 3 90 0 52 100 90 48 7 15 41 1 54 2 23 62 86 68 2 87 57 12 45 34 68 54 36 49 27 46 22 70 95 90 57 91 90 79 48 89 67 92 28 27 25 37 73 66 13 89 7 99 62 53 48 24 73 82 62 88 26 39 21 86 50 95 26 27 60 6 56 14 27 90 55 80 97 18 37 36 70 2 28 53 36 77 39 79 82 42 69",
"output": "Yes"
},
{
"input": "99\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99",
"output": "Yes"
},
{
"input": "100\n61 63 34 45 20 91 31 28 40 27 94 1 73 5 69 10 56 94 80 23 79 99 59 58 13 56 91 59 77 78 88 72 80 72 70 71 63 60 41 41 41 27 83 10 43 14 35 48 0 78 69 29 63 33 42 67 1 74 51 46 79 41 37 61 16 29 82 28 22 14 64 49 86 92 82 55 54 24 75 58 95 31 3 34 26 23 78 91 49 6 30 57 27 69 29 54 42 0 61 83",
"output": "No"
},
{
"input": "6\n1 2 2 2 2 1",
"output": "No"
},
{
"input": "3\n1 2 1",
"output": "Yes"
},
{
"input": "4\n1 3 2 3",
"output": "No"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "No"
},
{
"input": "6\n1 1 0 0 1 1",
"output": "No"
},
{
"input": "4\n1 4 9 3",
"output": "No"
},
{
"input": "4\n1 0 1 1",
"output": "No"
},
{
"input": "10\n1 0 0 1 1 1 1 1 1 1",
"output": "No"
},
{
"input": "10\n9 2 5 7 8 3 1 9 4 9",
"output": "No"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2",
"output": "No"
},
{
"input": "6\n1 2 1 2 2 1",
"output": "No"
},
{
"input": "6\n1 0 1 0 0 1",
"output": "No"
},
{
"input": "4\n1 3 4 7",
"output": "No"
},
{
"input": "8\n1 1 1 2 1 1 1 1",
"output": "No"
},
{
"input": "3\n1 1 2",
"output": "No"
},
{
"input": "5\n1 2 1 2 1",
"output": "Yes"
},
{
"input": "5\n5 4 4 2 1",
"output": "Yes"
},
{
"input": "6\n1 3 3 3 3 1",
"output": "No"
},
{
"input": "7\n1 2 1 2 2 2 1",
"output": "Yes"
},
{
"input": "4\n1 2 2 1",
"output": "No"
},
{
"input": "6\n1 2 3 4 6 5",
"output": "No"
},
{
"input": "5\n1 1 2 2 2",
"output": "No"
},
{
"input": "5\n1 0 0 1 1",
"output": "Yes"
},
{
"input": "3\n1 2 4",
"output": "No"
},
{
"input": "3\n1 0 2",
"output": "No"
},
{
"input": "5\n1 1 1 0 1",
"output": "Yes"
},
{
"input": "4\n3 9 2 3",
"output": "No"
},
{
"input": "6\n1 1 1 4 4 1",
"output": "No"
},
{
"input": "6\n1 2 3 5 6 7",
"output": "No"
},
{
"input": "6\n1 1 1 2 2 1",
"output": "No"
},
{
"input": "6\n1 1 1 0 0 1",
"output": "No"
},
{
"input": "5\n1 2 2 5 5",
"output": "Yes"
},
{
"input": "5\n1 3 2 4 5",
"output": "Yes"
},
{
"input": "8\n1 2 3 5 7 8 8 5",
"output": "No"
},
{
"input": "10\n1 1 1 2 1 1 1 1 1 1",
"output": "No"
},
{
"input": "4\n1 0 0 1",
"output": "No"
},
{
"input": "7\n1 0 1 1 0 0 1",
"output": "Yes"
},
{
"input": "7\n1 4 5 7 6 6 3",
"output": "Yes"
},
{
"input": "4\n2 2 2 2",
"output": "No"
},
{
"input": "5\n2 3 4 5 6",
"output": "No"
},
{
"input": "4\n1 1 2 1",
"output": "No"
},
{
"input": "3\n1 2 3",
"output": "Yes"
},
{
"input": "6\n1 3 3 2 2 3",
"output": "No"
},
{
"input": "4\n1 1 2 3",
"output": "No"
},
{
"input": "4\n1 2 3 5",
"output": "No"
},
{
"input": "5\n3 4 4 3 3",
"output": "Yes"
},
{
"input": "4\n3 2 2 3",
"output": "No"
},
{
"input": "6\n1 1 1 1 2 1",
"output": "No"
},
{
"input": "6\n1 1 2 2 1 1",
"output": "No"
},
{
"input": "10\n3 4 2 4 3 2 2 4 4 3",
"output": "No"
},
{
"input": "7\n1 2 4 3 2 4 5",
"output": "Yes"
},
{
"input": "28\n75 51 25 52 13 7 34 29 5 59 68 56 13 2 9 37 59 83 18 32 36 30 20 43 92 76 78 67",
"output": "No"
},
{
"input": "79\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 18",
"output": "No"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "No"
}
] | 1,622,661,869
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 5
| 124
| 0
|
from sys import stdin
n = int(stdin.readline())
a = list(map(int, stdin.readline().split()))
k = []
for i in a:
if i == 0 or i % 2 != 0:
k.append(i)
m = len(k)
z = k.count(0)
if m%2 != 0 or z >= 1:
print('YES')
else:
print('NO')
|
Title: Odds and Ends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Where do odds begin, and where do they end? Where does hope emerge, and will they ever break?
Given an integer sequence *a*1,<=*a*2,<=...,<=*a**n* of length *n*. Decide whether it is possible to divide it into an odd number of non-empty subsegments, the each of which has an odd length and begins and ends with odd numbers.
A subsegment is a contiguous slice of the whole sequence. For example, {3,<=4,<=5} and {1} are subsegments of sequence {1,<=2,<=3,<=4,<=5,<=6}, while {1,<=2,<=4} and {7} are not.
Input Specification:
The first line of input contains a non-negative integer *n* (1<=≤<=*n*<=≤<=100) — the length of the sequence.
The second line contains *n* space-separated non-negative integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100) — the elements of the sequence.
Output Specification:
Output "Yes" if it's possible to fulfill the requirements, and "No" otherwise.
You can output each letter in any case (upper or lower).
Demo Input:
['3\n1 3 5\n', '5\n1 0 1 5 1\n', '3\n4 3 1\n', '4\n3 9 9 3\n']
Demo Output:
['Yes\n', 'Yes\n', 'No\n', 'No\n']
Note:
In the first example, divide the sequence into 1 subsegment: {1, 3, 5} and the requirements will be met.
In the second example, divide the sequence into 3 subsegments: {1, 0, 1}, {5}, {1}.
In the third example, one of the subsegments must start with 4 which is an even number, thus the requirements cannot be met.
In the fourth example, the sequence can be divided into 2 subsegments: {3, 9, 9}, {3}, but this is not a valid solution because 2 is an even number.
|
```python
from sys import stdin
n = int(stdin.readline())
a = list(map(int, stdin.readline().split()))
k = []
for i in a:
if i == 0 or i % 2 != 0:
k.append(i)
m = len(k)
z = k.count(0)
if m%2 != 0 or z >= 1:
print('YES')
else:
print('NO')
```
| 0
|
|
667
|
A
|
Pouring Rain
|
PROGRAMMING
| 1,100
|
[
"geometry",
"math"
] | null | null |
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter.
|
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup.
|
If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
|
[
"1 2 3 100\n",
"1 1 1 1\n"
] |
[
"NO\n",
"YES\n3.659792366325\n"
] |
In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
| 500
|
[
{
"input": "1 2 3 100",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "YES\n3.659792366325"
},
{
"input": "48 7946 7992 72",
"output": "NO"
},
{
"input": "72 6791 8546 46",
"output": "NO"
},
{
"input": "100 5635 9099 23",
"output": "NO"
},
{
"input": "20 287 3845 5",
"output": "YES\n39.646277165210"
},
{
"input": "48 6428 9807 83",
"output": "NO"
},
{
"input": "72 5272 4552 64",
"output": "NO"
},
{
"input": "100 4117 5106 34",
"output": "NO"
},
{
"input": "20 2961 9852 15",
"output": "YES\n180.991437129723"
},
{
"input": "48 1805 3109 93",
"output": "NO"
},
{
"input": "72 8534 7042 65",
"output": "NO"
},
{
"input": "1 47 80 68",
"output": "YES\n1.388102806810"
},
{
"input": "4 495 8813 1",
"output": "YES\n0.706823517575"
},
{
"input": "5 2797 5925 9",
"output": "YES\n9.553973511669"
},
{
"input": "1 8324 4362 23",
"output": "YES\n1.505007106354"
},
{
"input": "6 1976 8455 3",
"output": "YES\n6.674898722265"
},
{
"input": "7 2644 8080 5",
"output": "YES\n12.900417790197"
},
{
"input": "3 4183 5491 98",
"output": "YES\n6.162185601824"
},
{
"input": "2 8591 320 101",
"output": "YES\n9999.259991757254"
},
{
"input": "10000 10000 10000 10000",
"output": "NO"
},
{
"input": "2 5000 12 3",
"output": "YES\n6099.653943875812"
},
{
"input": "10 1000 100 1",
"output": "YES\n3659.792366325487"
}
] | 1,626,020,272
| 2,147,483,647
|
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 124
| 22,323,200
|
a,b = map(int,input().split())
x = [int(i) for i in input().split()]
count = 0
for i in x:
if i <= b:
count+=1
else:
count+=2
print(count)
|
Title: Pouring Rain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A lot of people in Berland hates rain, but you do not. Rain pacifies, puts your thoughts in order. By these years you have developed a good tradition — when it rains, you go on the street and stay silent for a moment, contemplate all around you, enjoy freshness, think about big deeds you have to do.
Today everything had changed quietly. You went on the street with a cup contained water, your favorite drink. In a moment when you were drinking a water you noticed that the process became quite long: the cup still contained water because of rain. You decided to make a formal model of what was happening and to find if it was possible to drink all water in that situation.
Thus, your cup is a cylinder with diameter equals *d* centimeters. Initial level of water in cup equals *h* centimeters from the bottom.
You drink a water with a speed equals *v* milliliters per second. But rain goes with such speed that if you do not drink a water from the cup, the level of water increases on *e* centimeters per second. The process of drinking water from the cup and the addition of rain to the cup goes evenly and continuously.
Find the time needed to make the cup empty or find that it will never happen. It is guaranteed that if it is possible to drink all water, it will happen not later than after 104 seconds.
Note one milliliter equals to one cubic centimeter.
Input Specification:
The only line of the input contains four integer numbers *d*,<=*h*,<=*v*,<=*e* (1<=≤<=*d*,<=*h*,<=*v*,<=*e*<=≤<=104), where:
- *d* — the diameter of your cylindrical cup, - *h* — the initial level of water in the cup, - *v* — the speed of drinking process from the cup in milliliters per second, - *e* — the growth of water because of rain if you do not drink from the cup.
Output Specification:
If it is impossible to make the cup empty, print "NO" (without quotes).
Otherwise print "YES" (without quotes) in the first line. In the second line print a real number — time in seconds needed the cup will be empty. The answer will be considered correct if its relative or absolute error doesn't exceed 10<=-<=4. It is guaranteed that if the answer exists, it doesn't exceed 104.
Demo Input:
['1 2 3 100\n', '1 1 1 1\n']
Demo Output:
['NO\n', 'YES\n3.659792366325\n']
Note:
In the first example the water fills the cup faster than you can drink from it.
In the second example area of the cup's bottom equals to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/419dc74dcd7bc392019c9fe748fe1fdb08ab521a.png" style="max-width: 100.0%;max-height: 100.0%;"/>, thus we can conclude that you decrease the level of water by <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/e8edb237e1f805fe83c2f47e48d3a9d03f2ee304.png" style="max-width: 100.0%;max-height: 100.0%;"/> centimeters per second. At the same time water level increases by 1 centimeter per second due to rain. Thus, cup will be empty in <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9dae615d7e2c5c7c03cb478848fb06aba1a8942e.png" style="max-width: 100.0%;max-height: 100.0%;"/> seconds.
|
```python
a,b = map(int,input().split())
x = [int(i) for i in input().split()]
count = 0
for i in x:
if i <= b:
count+=1
else:
count+=2
print(count)
```
| -1
|
|
66
|
B
|
Petya and Countryside
|
PROGRAMMING
| 1,100
|
[
"brute force",
"implementation"
] |
B. Petya and Countryside
|
2
|
256
|
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
|
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
|
[
"1\n2\n",
"5\n1 2 1 2 1\n",
"8\n1 2 1 1 1 3 3 4\n"
] |
[
"1\n",
"3\n",
"6\n"
] |
none
| 1,000
|
[
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 2 1 2 1",
"output": "3"
},
{
"input": "8\n1 2 1 1 1 3 3 4",
"output": "6"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "10"
},
{
"input": "2\n100 100",
"output": "2"
},
{
"input": "3\n100 100 100",
"output": "3"
},
{
"input": "11\n1 2 3 4 5 6 5 4 3 2 1",
"output": "11"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 100 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 1 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 1 82 83 84 85 86 87 88 89 90 91 92 93 94 100 5 4 3 2 1",
"output": "81"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 1 86 87 88 89 90 91 92 93 100 6 5 4 3 2 1",
"output": "85"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 1 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 100 7 6 5 4 3 2 1",
"output": "61"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 100 8 7 6 1 4 3 2 1",
"output": "96"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 100 10 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 1 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 100 11 10 9 8 7 6 5 4 3 2 1",
"output": "55"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 1 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 100 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "59"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 1 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 100 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "86"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 1 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 100 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "83"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 100 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 1 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "74"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 100 9 8 7 6 5 4 3 2 1",
"output": "100"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 100 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 1 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "52"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 100 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 1 2 1",
"output": "98"
},
{
"input": "10\n1 4 4 4 4 4 1 2 4 3",
"output": "7"
}
] | 1,609,676,460
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 80
| 342
| 1,536,000
|
def main():
n = int(input())
a = [int(i) for i in input().split()]
cnt = 0
for i in range(n):
temp = 1
k = i
j = i - 1
while j >= 0 and a[j] <= a[k]:
temp += 1
j -= 1
k -= 1
if i == n - 1:
cnt = max(cnt, temp)
break
k = i
j = i + 1
while j <= n - 1 and a[j] <= a[k]:
temp += 1
j += 1
k += 1
cnt = max(cnt, temp)
print(cnt)
if __name__ == '__main__':
main()
# 1 2 1 1 1 3 3 4
# 0
|
Title: Petya and Countryside
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya often travels to his grandmother in the countryside. The grandmother has a large garden, which can be represented as a rectangle 1<=×<=*n* in size, when viewed from above. This rectangle is divided into *n* equal square sections. The garden is very unusual as each of the square sections possesses its own fixed height and due to the newest irrigation system we can create artificial rain above each section.
Creating artificial rain is an expensive operation. That's why we limit ourselves to creating the artificial rain only above one section. At that, the water from each watered section will flow into its neighbouring sections if their height does not exceed the height of the section. That is, for example, the garden can be represented by a 1<=×<=5 rectangle, where the section heights are equal to 4, 2, 3, 3, 2. Then if we create an artificial rain over any of the sections with the height of 3, the water will flow over all the sections, except the ones with the height of 4. See the illustration of this example at the picture:
As Petya is keen on programming, he decided to find such a section that if we create artificial rain above it, the number of watered sections will be maximal. Help him.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=1000). The second line contains *n* positive integers which are the height of the sections. All the numbers are no less than 1 and not more than 1000.
Output Specification:
Print a single number, the maximal number of watered sections if we create artificial rain above exactly one section.
Demo Input:
['1\n2\n', '5\n1 2 1 2 1\n', '8\n1 2 1 1 1 3 3 4\n']
Demo Output:
['1\n', '3\n', '6\n']
Note:
none
|
```python
def main():
n = int(input())
a = [int(i) for i in input().split()]
cnt = 0
for i in range(n):
temp = 1
k = i
j = i - 1
while j >= 0 and a[j] <= a[k]:
temp += 1
j -= 1
k -= 1
if i == n - 1:
cnt = max(cnt, temp)
break
k = i
j = i + 1
while j <= n - 1 and a[j] <= a[k]:
temp += 1
j += 1
k += 1
cnt = max(cnt, temp)
print(cnt)
if __name__ == '__main__':
main()
# 1 2 1 1 1 3 3 4
# 0
```
| 3.911639
|
513
|
A
|
Game
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"math"
] | null | null |
Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally.
|
The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50.
This problem doesn't have subproblems. You will get 3 points for the correct submission.
|
Output "First" if the first player wins and "Second" otherwise.
|
[
"2 2 1 2\n",
"2 1 1 1\n"
] |
[
"Second\n",
"First\n"
] |
Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
| 3
|
[
{
"input": "2 2 1 2",
"output": "Second"
},
{
"input": "2 1 1 1",
"output": "First"
},
{
"input": "5 7 4 1",
"output": "Second"
},
{
"input": "5 7 1 4",
"output": "Second"
},
{
"input": "5 7 10 10",
"output": "Second"
},
{
"input": "5 7 1 10",
"output": "Second"
},
{
"input": "1 1 1 1",
"output": "Second"
},
{
"input": "50 50 50 50",
"output": "Second"
},
{
"input": "50 49 1 2",
"output": "First"
},
{
"input": "50 48 3 1",
"output": "First"
},
{
"input": "48 50 12 11",
"output": "Second"
},
{
"input": "49 50 11 12",
"output": "Second"
},
{
"input": "49 49 4 1",
"output": "Second"
},
{
"input": "49 49 3 3",
"output": "Second"
},
{
"input": "1 50 1 50",
"output": "Second"
},
{
"input": "1 50 50 50",
"output": "Second"
},
{
"input": "50 1 1 1",
"output": "First"
},
{
"input": "50 1 1 50",
"output": "First"
},
{
"input": "32 31 10 9",
"output": "First"
},
{
"input": "32 4 17 3",
"output": "First"
}
] | 1,556,087,099
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 77
| 0
|
n1,n2,k1,k2=map(int,input().split())
if n1>n2:
print('FIRST')
else:
print('SECOND')
|
Title: Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two players play a simple game. Each player is provided with a box with balls. First player's box contains exactly *n*1 balls and second player's box contains exactly *n*2 balls. In one move first player can take from 1 to *k*1 balls from his box and throw them away. Similarly, the second player can take from 1 to *k*2 balls from his box in his move. Players alternate turns and the first player starts the game. The one who can't make a move loses. Your task is to determine who wins if both players play optimally.
Input Specification:
The first line contains four integers *n*1,<=*n*2,<=*k*1,<=*k*2. All numbers in the input are from 1 to 50.
This problem doesn't have subproblems. You will get 3 points for the correct submission.
Output Specification:
Output "First" if the first player wins and "Second" otherwise.
Demo Input:
['2 2 1 2\n', '2 1 1 1\n']
Demo Output:
['Second\n', 'First\n']
Note:
Consider the first sample test. Each player has a box with 2 balls. The first player draws a single ball from his box in one move and the second player can either take 1 or 2 balls from his box in one move. No matter how the first player acts, the second player can always win if he plays wisely.
|
```python
n1,n2,k1,k2=map(int,input().split())
if n1>n2:
print('FIRST')
else:
print('SECOND')
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Dima is a beginner programmer. During his working process, he regularly has to repeat the following operation again and again: to remove every second element from the array. One day he has been bored with easy solutions of this problem, and he has come up with the following extravagant algorithm.
Let's consider that initially array contains *n* numbers from 1 to *n* and the number *i* is located in the cell with the index 2*i*<=-<=1 (Indices are numbered starting from one) and other cells of the array are empty. Each step Dima selects a non-empty array cell with the maximum index and moves the number written in it to the nearest empty cell to the left of the selected one. The process continues until all *n* numbers will appear in the first *n* cells of the array. For example if *n*<==<=4, the array is changing as follows:
You have to write a program that allows you to determine what number will be in the cell with index *x* (1<=≤<=*x*<=≤<=*n*) after Dima's algorithm finishes.
|
The first line contains two integers *n* and *q* (1<=≤<=*n*<=≤<=1018, 1<=≤<=*q*<=≤<=200<=000), the number of elements in the array and the number of queries for which it is needed to find the answer.
Next *q* lines contain integers *x**i* (1<=≤<=*x**i*<=≤<=*n*), the indices of cells for which it is necessary to output their content after Dima's algorithm finishes.
|
For each of *q* queries output one integer number, the value that will appear in the corresponding array cell after Dima's algorithm finishes.
|
[
"4 3\n2\n3\n4\n",
"13 4\n10\n5\n4\n8\n"
] |
[
"3\n2\n4\n",
"13\n3\n8\n9\n"
] |
The first example is shown in the picture.
In the second example the final array is [1, 12, 2, 8, 3, 11, 4, 9, 5, 13, 6, 10, 7].
| 0
|
[
{
"input": "4 3\n2\n3\n4",
"output": "3\n2\n4"
},
{
"input": "13 4\n10\n5\n4\n8",
"output": "13\n3\n8\n9"
},
{
"input": "2 2\n1\n2",
"output": "1\n2"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "3 3\n3\n2\n1",
"output": "2\n3\n1"
},
{
"input": "12 12\n9\n11\n5\n3\n7\n2\n8\n6\n4\n10\n12\n1",
"output": "5\n6\n3\n2\n4\n7\n12\n8\n10\n9\n11\n1"
}
] | 1,691,634,863
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 2,000
| 9,523,200
|
n, q = map(int, input().split())
for _ in range(q):
p = int(input())
x = 2 * n - p
while (1):
if (x & 1): break
x >>= 1
p += x
print(p + 1 >> 1)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima is a beginner programmer. During his working process, he regularly has to repeat the following operation again and again: to remove every second element from the array. One day he has been bored with easy solutions of this problem, and he has come up with the following extravagant algorithm.
Let's consider that initially array contains *n* numbers from 1 to *n* and the number *i* is located in the cell with the index 2*i*<=-<=1 (Indices are numbered starting from one) and other cells of the array are empty. Each step Dima selects a non-empty array cell with the maximum index and moves the number written in it to the nearest empty cell to the left of the selected one. The process continues until all *n* numbers will appear in the first *n* cells of the array. For example if *n*<==<=4, the array is changing as follows:
You have to write a program that allows you to determine what number will be in the cell with index *x* (1<=≤<=*x*<=≤<=*n*) after Dima's algorithm finishes.
Input Specification:
The first line contains two integers *n* and *q* (1<=≤<=*n*<=≤<=1018, 1<=≤<=*q*<=≤<=200<=000), the number of elements in the array and the number of queries for which it is needed to find the answer.
Next *q* lines contain integers *x**i* (1<=≤<=*x**i*<=≤<=*n*), the indices of cells for which it is necessary to output their content after Dima's algorithm finishes.
Output Specification:
For each of *q* queries output one integer number, the value that will appear in the corresponding array cell after Dima's algorithm finishes.
Demo Input:
['4 3\n2\n3\n4\n', '13 4\n10\n5\n4\n8\n']
Demo Output:
['3\n2\n4\n', '13\n3\n8\n9\n']
Note:
The first example is shown in the picture.
In the second example the final array is [1, 12, 2, 8, 3, 11, 4, 9, 5, 13, 6, 10, 7].
|
```python
n, q = map(int, input().split())
for _ in range(q):
p = int(input())
x = 2 * n - p
while (1):
if (x & 1): break
x >>= 1
p += x
print(p + 1 >> 1)
```
| 0
|
|
628
|
D
|
Magic Numbers
|
PROGRAMMING
| 2,200
|
[
"dp"
] | null | null |
Consider the decimal presentation of an integer. Let's call a number d-magic if digit *d* appears in decimal presentation of the number on even positions and nowhere else.
For example, the numbers 1727374, 17, 1 are 7-magic but 77, 7, 123, 34, 71 are not 7-magic. On the other hand the number 7 is 0-magic, 123 is 2-magic, 34 is 4-magic and 71 is 1-magic.
Find the number of d-magic numbers in the segment [*a*,<=*b*] that are multiple of *m*. Because the answer can be very huge you should only find its value modulo 109<=+<=7 (so you should find the remainder after dividing by 109<=+<=7).
|
The first line contains two integers *m*,<=*d* (1<=≤<=*m*<=≤<=2000, 0<=≤<=*d*<=≤<=9) — the parameters from the problem statement.
The second line contains positive integer *a* in decimal presentation (without leading zeroes).
The third line contains positive integer *b* in decimal presentation (without leading zeroes).
It is guaranteed that *a*<=≤<=*b*, the number of digits in *a* and *b* are the same and don't exceed 2000.
|
Print the only integer *a* — the remainder after dividing by 109<=+<=7 of the number of d-magic numbers in segment [*a*,<=*b*] that are multiple of *m*.
|
[
"2 6\n10\n99\n",
"2 0\n1\n9\n",
"19 7\n1000\n9999\n"
] |
[
"8\n",
"4\n",
"6\n"
] |
The numbers from the answer of the first example are 16, 26, 36, 46, 56, 76, 86 and 96.
The numbers from the answer of the second example are 2, 4, 6 and 8.
The numbers from the answer of the third example are 1767, 2717, 5757, 6707, 8797 and 9747.
| 0
|
[
{
"input": "2 6\n10\n99",
"output": "8"
},
{
"input": "2 0\n1\n9",
"output": "4"
},
{
"input": "19 7\n1000\n9999",
"output": "6"
},
{
"input": "9 4\n33\n52",
"output": "0"
},
{
"input": "10 8\n18\n59",
"output": "0"
},
{
"input": "43 3\n587\n850",
"output": "1"
},
{
"input": "65 3\n3436\n3632",
"output": "0"
},
{
"input": "850 8\n55735\n94089",
"output": "0"
},
{
"input": "590 6\n428671\n715453",
"output": "0"
},
{
"input": "1053 8\n1539368\n3362621",
"output": "0"
},
{
"input": "477 9\n3062053\n6465858",
"output": "6"
},
{
"input": "1901 9\n1941695\n3314270",
"output": "0"
},
{
"input": "29 0\n1649127\n6241670",
"output": "126"
},
{
"input": "566 3\n6372451659957700362854162843720623142601337360014410221724168092176479911659703538545016668832338549\n7969973326176891147525183958122002014921396842270051000646823226374743898663307171214245111949604186",
"output": "0"
},
{
"input": "1286 5\n1886373541983002858974907276497223649072414883083336663541044958378875954171855070620868427474284001\n4050983123791059817478363830631049287126338893626273758612677264947268375965600848751800494833017145",
"output": "0"
},
{
"input": "2 5\n1762712\n8121765",
"output": "2025"
},
{
"input": "2 2\n12\n12",
"output": "1"
},
{
"input": "2 0\n10\n10",
"output": "1"
},
{
"input": "2 6\n46\n46",
"output": "1"
},
{
"input": "2 0\n10\n20",
"output": "2"
},
{
"input": "2 9\n10000000000\n99999999999",
"output": "262440"
},
{
"input": "10 2\n12300\n99900",
"output": "70"
},
{
"input": "5 5\n5\n5",
"output": "0"
},
{
"input": "1 2\n113548484131315415454546546467913135484841313154154\n895458414564646646487131313118761454584145646466464",
"output": "970729981"
},
{
"input": "2 2\n12\n14",
"output": "1"
},
{
"input": "2 2\n2934\n4323",
"output": "18"
},
{
"input": "2 4\n1\n9",
"output": "3"
},
{
"input": "1 0\n10\n20",
"output": "2"
},
{
"input": "7 7\n7\n7",
"output": "0"
},
{
"input": "2 1\n143\n413",
"output": "12"
},
{
"input": "1 4\n1\n9",
"output": "8"
},
{
"input": "2 6\n36\n36",
"output": "1"
},
{
"input": "4 4\n24344\n48880",
"output": "29"
},
{
"input": "2 0\n1000\n9999",
"output": "81"
},
{
"input": "3 9\n39\n39",
"output": "1"
},
{
"input": "3 9\n10\n99",
"output": "2"
},
{
"input": "1 0\n10000\n99999",
"output": "729"
},
{
"input": "3 2\n681563\n828242",
"output": "48"
},
{
"input": "1 5\n454\n667",
"output": "14"
},
{
"input": "2 0\n2\n9",
"output": "4"
},
{
"input": "2 6\n7\n9",
"output": "1"
},
{
"input": "10 7\n1\n1",
"output": "0"
},
{
"input": "6 0\n1\n6",
"output": "1"
},
{
"input": "6 2\n22\n95",
"output": "2"
},
{
"input": "28 1\n102\n898",
"output": "2"
},
{
"input": "1 0\n1\n9",
"output": "9"
},
{
"input": "1 1\n1\n9",
"output": "8"
},
{
"input": "3 9\n10\n69",
"output": "2"
},
{
"input": "1 0\n1\n1",
"output": "1"
}
] | 1,598,803,651
| 2,147,483,647
|
Python 3
|
MEMORY_LIMIT_EXCEEDED
|
TESTS
| 0
| 2,043
| 268,390,400
|
def solve(pos,r,f):
if pos==nd:
if r==0:
return 1
return 0
if dp[pos][r][f]!=-1:
return dp[pos][r][f]
if f==0:
j=n[pos]
else:
j=9
res=0
for i in range(j+1):
if i==d and pos%2==0:
res+=0
elif i!=d and pos%2==1:
res+=0
else:
if f==1 or i<j:
f1=1
else:
f1=0
r1=(r*10+i)%m
res+=solve(pos+1,r1,f1)%1000000007
dp[pos][r][f]=res
return res
m,d=map(int,input().split())
a=input()
b=input()
nd=len(a)
dp=[ [ [-1,-1] for j in range(2001)] for i in range(2001)]
n=[]
for i in range(len(b)):
n.append(ord(b[i])-ord('0'))
res=solve(0,0,0)
dp=[ [ [-1,-1] for j in range(2001)] for i in range(2001)]
n=[]
for i in range(len(a)):
n.append(ord(a[i])-ord('0'))
nd=len(n)
res-=solve(0,0,0)
rm=0
flag=0
for i in range(len(a)):
if a[i]==str(d) and i%2==1:
flag=1
break
rm=(rm*10+(ord(a[i])-ord('0')))%1000000007
if flag==0 and rm==0:
res+=1
print(res%1000000007)
|
Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Consider the decimal presentation of an integer. Let's call a number d-magic if digit *d* appears in decimal presentation of the number on even positions and nowhere else.
For example, the numbers 1727374, 17, 1 are 7-magic but 77, 7, 123, 34, 71 are not 7-magic. On the other hand the number 7 is 0-magic, 123 is 2-magic, 34 is 4-magic and 71 is 1-magic.
Find the number of d-magic numbers in the segment [*a*,<=*b*] that are multiple of *m*. Because the answer can be very huge you should only find its value modulo 109<=+<=7 (so you should find the remainder after dividing by 109<=+<=7).
Input Specification:
The first line contains two integers *m*,<=*d* (1<=≤<=*m*<=≤<=2000, 0<=≤<=*d*<=≤<=9) — the parameters from the problem statement.
The second line contains positive integer *a* in decimal presentation (without leading zeroes).
The third line contains positive integer *b* in decimal presentation (without leading zeroes).
It is guaranteed that *a*<=≤<=*b*, the number of digits in *a* and *b* are the same and don't exceed 2000.
Output Specification:
Print the only integer *a* — the remainder after dividing by 109<=+<=7 of the number of d-magic numbers in segment [*a*,<=*b*] that are multiple of *m*.
Demo Input:
['2 6\n10\n99\n', '2 0\n1\n9\n', '19 7\n1000\n9999\n']
Demo Output:
['8\n', '4\n', '6\n']
Note:
The numbers from the answer of the first example are 16, 26, 36, 46, 56, 76, 86 and 96.
The numbers from the answer of the second example are 2, 4, 6 and 8.
The numbers from the answer of the third example are 1767, 2717, 5757, 6707, 8797 and 9747.
|
```python
def solve(pos,r,f):
if pos==nd:
if r==0:
return 1
return 0
if dp[pos][r][f]!=-1:
return dp[pos][r][f]
if f==0:
j=n[pos]
else:
j=9
res=0
for i in range(j+1):
if i==d and pos%2==0:
res+=0
elif i!=d and pos%2==1:
res+=0
else:
if f==1 or i<j:
f1=1
else:
f1=0
r1=(r*10+i)%m
res+=solve(pos+1,r1,f1)%1000000007
dp[pos][r][f]=res
return res
m,d=map(int,input().split())
a=input()
b=input()
nd=len(a)
dp=[ [ [-1,-1] for j in range(2001)] for i in range(2001)]
n=[]
for i in range(len(b)):
n.append(ord(b[i])-ord('0'))
res=solve(0,0,0)
dp=[ [ [-1,-1] for j in range(2001)] for i in range(2001)]
n=[]
for i in range(len(a)):
n.append(ord(a[i])-ord('0'))
nd=len(n)
res-=solve(0,0,0)
rm=0
flag=0
for i in range(len(a)):
if a[i]==str(d) and i%2==1:
flag=1
break
rm=(rm*10+(ord(a[i])-ord('0')))%1000000007
if flag==0 and rm==0:
res+=1
print(res%1000000007)
```
| 0
|
|
330
|
B
|
Road Construction
|
PROGRAMMING
| 1,300
|
[
"constructive algorithms",
"graphs"
] | null | null |
A country has *n* cities. Initially, there is no road in the country. One day, the king decides to construct some roads connecting pairs of cities. Roads can be traversed either way. He wants those roads to be constructed in such a way that it is possible to go from each city to any other city by traversing at most two roads. You are also given *m* pairs of cities — roads cannot be constructed between these pairs of cities.
Your task is to construct the minimum number of roads that still satisfy the above conditions. The constraints will guarantee that this is always possible.
|
The first line consists of two integers *n* and *m* .
Then *m* lines follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which means that it is not possible to construct a road connecting cities *a**i* and *b**i*. Consider the cities are numbered from 1 to *n*.
It is guaranteed that every pair of cities will appear at most once in the input.
|
You should print an integer *s*: the minimum number of roads that should be constructed, in the first line. Then *s* lines should follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*), which means that a road should be constructed between cities *a**i* and *b**i*.
If there are several solutions, you may print any of them.
|
[
"4 1\n1 3\n"
] |
[
"3\n1 2\n4 2\n2 3\n"
] |
This is one possible solution of the example:
These are examples of wrong solutions:
| 1,000
|
[
{
"input": "4 1\n1 3",
"output": "3\n1 2\n4 2\n2 3"
},
{
"input": "1000 0",
"output": "999\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "484 11\n414 97\n414 224\n444 414\n414 483\n414 399\n414 484\n414 189\n414 246\n414 115\n89 414\n14 414",
"output": "483\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "150 3\n112 30\n61 45\n37 135",
"output": "149\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "34 7\n10 28\n10 19\n10 13\n24 10\n10 29\n20 10\n10 26",
"output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34"
},
{
"input": "1000 48\n816 885\n576 357\n878 659\n610 647\n37 670\n192 184\n393 407\n598 160\n547 995\n177 276\n788 44\n14 184\n604 281\n176 97\n176 293\n10 57\n852 579\n223 669\n313 260\n476 691\n667 22\n851 792\n411 489\n526 66\n233 566\n35 396\n964 815\n672 123\n148 210\n163 339\n379 598\n382 675\n132 955\n221 441\n253 490\n856 532\n135 119\n276 319\n525 835\n996 270\n92 778\n434 369\n351 927\n758 983\n798 267\n272 830\n539 728\n166 26",
"output": "999\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "534 0",
"output": "533\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "226 54\n80 165\n2 53\n191 141\n107 207\n95 196\n61 82\n42 168\n118 94\n205 182\n172 160\n84 224\n113 143\n122 93\n37 209\n176 32\n56 83\n151 81\n70 190\n99 171\n68 204\n212 48\n4 67\n116 7\n206 199\n105 62\n158 51\n178 147\n17 129\n22 47\n72 162\n188 77\n24 111\n184 26\n175 128\n110 89\n139 120\n127 92\n121 39\n217 75\n145 69\n20 161\n30 220\n222 154\n54 46\n21 87\n144 185\n164 115\n73 202\n173 35\n9 132\n74 180\n137 5\n157 117\n31 177",
"output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "84 3\n39 19\n55 73\n42 43",
"output": "83\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84"
},
{
"input": "207 35\n34 116\n184 5\n90 203\n12 195\n138 101\n40 150\n189 109\n115 91\n93 201\n106 18\n51 187\n139 197\n168 130\n182 64\n31 42\n86 107\n158 111\n159 132\n119 191\n53 127\n81 13\n153 112\n38 2\n87 84\n121 82\n120 22\n21 177\n151 202\n23 58\n68 192\n29 46\n105 70\n8 167\n56 54\n149 15",
"output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "91 37\n50 90\n26 82\n61 1\n50 17\n51 73\n45 9\n39 53\n78 35\n12 45\n43 47\n83 20\n9 59\n18 48\n68 31\n47 33\n10 25\n15 78\n5 3\n73 65\n77 4\n62 31\n73 3\n53 7\n29 58\n52 14\n56 20\n6 87\n71 16\n17 19\n77 86\n1 50\n74 79\n15 54\n55 80\n13 77\n4 69\n24 69",
"output": "90\n2 1\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26\n2 27\n2 28\n2 29\n2 30\n2 31\n2 32\n2 33\n2 34\n2 35\n2 36\n2 37\n2 38\n2 39\n2 40\n2 41\n2 42\n2 43\n2 44\n2 45\n2 46\n2 47\n2 48\n2 49\n2 50\n2 51\n2 52\n2 53\n2 54\n2 55\n2 56\n2 57\n2 58\n2 59\n2 60\n2 61\n2 62\n2 63\n2 64\n2 65\n2 66\n2 67\n2 68\n2 69\n2 70\n2 71\n2 72\n2 73\n2 74\n2 75\n2 76\n2 77\n2 78\n2 79\n2 80\n2 81\n2 82\n2 83\n2 84\n2 85\n2 86\n2 87\n..."
},
{
"input": "226 54\n197 107\n181 146\n218 115\n36 169\n199 196\n116 93\n152 75\n213 164\n156 95\n165 58\n90 42\n141 58\n203 221\n179 204\n186 69\n27 127\n76 189\n40 195\n111 29\n85 189\n45 88\n84 135\n82 186\n185 17\n156 217\n8 123\n179 112\n92 137\n114 89\n10 152\n132 24\n135 36\n61 218\n10 120\n155 102\n222 79\n150 92\n184 34\n102 180\n154 196\n171 9\n217 105\n84 207\n56 189\n152 179\n43 165\n115 209\n208 167\n52 14\n92 47\n197 95\n13 78\n222 138\n75 36",
"output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "207 35\n154 79\n174 101\n189 86\n137 56\n66 23\n199 69\n18 28\n32 53\n13 179\n182 170\n199 12\n24 158\n105 133\n25 10\n40 162\n64 72\n108 9\n172 125\n43 190\n15 39\n128 150\n102 129\n90 97\n64 196\n70 123\n163 41\n12 126\n127 186\n107 23\n182 51\n29 46\n46 123\n89 35\n59 80\n206 171",
"output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "84 0",
"output": "83\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84"
},
{
"input": "226 54\n5 29\n130 29\n55 29\n19 29\n29 92\n29 38\n185 29\n29 150\n29 202\n29 25\n29 66\n184 29\n29 189\n177 29\n50 29\n87 29\n138 29\n29 48\n151 29\n125 29\n16 29\n42 29\n29 157\n90 29\n21 29\n29 45\n29 80\n29 67\n29 26\n29 173\n74 29\n29 193\n29 40\n172 29\n29 85\n29 102\n88 29\n29 182\n116 29\n180 29\n161 29\n10 29\n171 29\n144 29\n29 218\n190 29\n213 29\n29 71\n29 191\n29 160\n29 137\n29 58\n29 135\n127 29",
"output": "225\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "207 35\n25 61\n188 61\n170 61\n113 61\n35 61\n61 177\n77 61\n61 39\n61 141\n116 61\n61 163\n30 61\n192 61\n19 61\n61 162\n61 133\n185 61\n8 61\n118 61\n61 115\n7 61\n61 105\n107 61\n61 11\n161 61\n61 149\n136 61\n82 61\n20 61\n151 61\n156 61\n12 61\n87 61\n61 205\n61 108",
"output": "206\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "34 7\n11 32\n33 29\n17 16\n15 5\n13 25\n8 19\n20 4",
"output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34"
},
{
"input": "43 21\n38 19\n43 8\n40 31\n3 14\n24 21\n12 17\n1 9\n5 27\n25 37\n11 6\n13 26\n16 22\n10 32\n36 7\n30 29\n42 35\n20 33\n4 23\n18 15\n41 34\n2 28",
"output": "42\n39 1\n39 2\n39 3\n39 4\n39 5\n39 6\n39 7\n39 8\n39 9\n39 10\n39 11\n39 12\n39 13\n39 14\n39 15\n39 16\n39 17\n39 18\n39 19\n39 20\n39 21\n39 22\n39 23\n39 24\n39 25\n39 26\n39 27\n39 28\n39 29\n39 30\n39 31\n39 32\n39 33\n39 34\n39 35\n39 36\n39 37\n39 38\n39 40\n39 41\n39 42\n39 43"
},
{
"input": "34 7\n22 4\n5 25\n15 7\n5 9\n27 7\n34 21\n3 13",
"output": "33\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34"
},
{
"input": "50 7\n19 37\n30 32\n43 20\n48 14\n30 29\n18 36\n9 46",
"output": "49\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50"
},
{
"input": "41 12\n41 12\n29 13\n3 37\n2 20\n4 24\n27 6\n39 20\n28 41\n30 1\n35 9\n5 39\n12 31",
"output": "40\n7 1\n7 2\n7 3\n7 4\n7 5\n7 6\n7 8\n7 9\n7 10\n7 11\n7 12\n7 13\n7 14\n7 15\n7 16\n7 17\n7 18\n7 19\n7 20\n7 21\n7 22\n7 23\n7 24\n7 25\n7 26\n7 27\n7 28\n7 29\n7 30\n7 31\n7 32\n7 33\n7 34\n7 35\n7 36\n7 37\n7 38\n7 39\n7 40\n7 41"
},
{
"input": "26 2\n22 1\n14 10",
"output": "25\n2 1\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n2 11\n2 12\n2 13\n2 14\n2 15\n2 16\n2 17\n2 18\n2 19\n2 20\n2 21\n2 22\n2 23\n2 24\n2 25\n2 26"
},
{
"input": "7 3\n4 7\n4 6\n6 5",
"output": "6\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7"
},
{
"input": "484 11\n459 166\n12 217\n14 231\n477 111\n365 225\n62 412\n221 223\n258 184\n266 404\n425 236\n83 269",
"output": "483\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50\n1 51\n1 52\n1 53\n1 54\n1 55\n1 56\n1 57\n1 58\n1 59\n1 60\n1 61\n1 62\n1 63\n1 64\n1 65\n1 66\n1 67\n1 68\n1 69\n1 70\n1 71\n1 72\n1 73\n1 74\n1 75\n1 76\n1 77\n1 78\n1 79\n1 80\n1 81\n1 82\n1 83\n1 84\n1 85\n1 86\n1 87..."
},
{
"input": "50 24\n18 36\n11 18\n22 18\n18 47\n18 10\n45 18\n18 29\n13 18\n8 18\n18 30\n26 18\n18 6\n5 18\n18 7\n46 18\n50 18\n18 3\n18 32\n4 18\n18 24\n18 19\n23 18\n35 18\n31 18",
"output": "49\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n1 11\n1 12\n1 13\n1 14\n1 15\n1 16\n1 17\n1 18\n1 19\n1 20\n1 21\n1 22\n1 23\n1 24\n1 25\n1 26\n1 27\n1 28\n1 29\n1 30\n1 31\n1 32\n1 33\n1 34\n1 35\n1 36\n1 37\n1 38\n1 39\n1 40\n1 41\n1 42\n1 43\n1 44\n1 45\n1 46\n1 47\n1 48\n1 49\n1 50"
},
{
"input": "7 3\n3 4\n7 3\n3 2",
"output": "6\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "2 0",
"output": "1\n1 2"
},
{
"input": "4 1\n1 2",
"output": "3\n3 1\n3 2\n3 4"
},
{
"input": "3 1\n1 2",
"output": "2\n3 1\n3 2"
},
{
"input": "5 1\n1 5",
"output": "4\n2 1\n2 3\n2 4\n2 5"
}
] | 1,620,829,160
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 124
| 6,963,200
|
termo1, termo2 = (int(_) for _ in input().split())
lista = [True]*termo1
for i in range(termo2):
x, y = (int(_) for _ in input().split())
lista[x - 1] = lista[y - 1] = False
aux = -1
for i in range(termo1):
if lista[i]:
aux = i
break
print(termo1 - 1)
for i in range(termo1):
if aux != i:
print(i+1, aux+1)
|
Title: Road Construction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A country has *n* cities. Initially, there is no road in the country. One day, the king decides to construct some roads connecting pairs of cities. Roads can be traversed either way. He wants those roads to be constructed in such a way that it is possible to go from each city to any other city by traversing at most two roads. You are also given *m* pairs of cities — roads cannot be constructed between these pairs of cities.
Your task is to construct the minimum number of roads that still satisfy the above conditions. The constraints will guarantee that this is always possible.
Input Specification:
The first line consists of two integers *n* and *m* .
Then *m* lines follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which means that it is not possible to construct a road connecting cities *a**i* and *b**i*. Consider the cities are numbered from 1 to *n*.
It is guaranteed that every pair of cities will appear at most once in the input.
Output Specification:
You should print an integer *s*: the minimum number of roads that should be constructed, in the first line. Then *s* lines should follow, each consisting of two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*), which means that a road should be constructed between cities *a**i* and *b**i*.
If there are several solutions, you may print any of them.
Demo Input:
['4 1\n1 3\n']
Demo Output:
['3\n1 2\n4 2\n2 3\n']
Note:
This is one possible solution of the example:
These are examples of wrong solutions:
|
```python
termo1, termo2 = (int(_) for _ in input().split())
lista = [True]*termo1
for i in range(termo2):
x, y = (int(_) for _ in input().split())
lista[x - 1] = lista[y - 1] = False
aux = -1
for i in range(termo1):
if lista[i]:
aux = i
break
print(termo1 - 1)
for i in range(termo1):
if aux != i:
print(i+1, aux+1)
```
| 3
|
|
712
|
B
|
Memory and Trident
|
PROGRAMMING
| 1,100
|
[
"implementation",
"strings"
] | null | null |
Memory is performing a walk on the two-dimensional plane, starting at the origin. He is given a string *s* with his directions for motion:
- An 'L' indicates he should move one unit left. - An 'R' indicates he should move one unit right. - A 'U' indicates he should move one unit up. - A 'D' indicates he should move one unit down.
But now Memory wants to end at the origin. To do this, he has a special trident. This trident can replace any character in *s* with any of 'L', 'R', 'U', or 'D'. However, because he doesn't want to wear out the trident, he wants to make the minimum number of edits possible. Please tell Memory what is the minimum number of changes he needs to make to produce a string that, when walked, will end at the origin, or if there is no such string.
|
The first and only line contains the string *s* (1<=≤<=|*s*|<=≤<=100<=000) — the instructions Memory is given.
|
If there is a string satisfying the conditions, output a single integer — the minimum number of edits required. In case it's not possible to change the sequence in such a way that it will bring Memory to to the origin, output -1.
|
[
"RRU\n",
"UDUR\n",
"RUUR\n"
] |
[
"-1\n",
"1\n",
"2\n"
] |
In the first sample test, Memory is told to walk right, then right, then up. It is easy to see that it is impossible to edit these instructions to form a valid walk.
In the second sample test, Memory is told to walk up, then down, then up, then right. One possible solution is to change *s* to "LDUR". This string uses 1 edit, which is the minimum possible. It also ends at the origin.
| 1,000
|
[
{
"input": "RRU",
"output": "-1"
},
{
"input": "UDUR",
"output": "1"
},
{
"input": "RUUR",
"output": "2"
},
{
"input": "DDDD",
"output": "2"
},
{
"input": "RRRR",
"output": "2"
},
{
"input": "RRRUUD",
"output": "2"
},
{
"input": "UDURLRDURLRD",
"output": "1"
},
{
"input": "RLRU",
"output": "1"
},
{
"input": "RDDLLDLUUUDDRDRURLUUURLLDDLRLUURRLLRRLDRLLUDRLRULLDLRRLRLRLRUDUUDLULURLLDUURULURLLRRRURRRDRUUDLDRLRDRLRRDDLDLDLLUDRUDRLLLLDRDUULRUURRDLULLULDUDULRURRDDDLLUDRLUDDLDDDRRDDDULLLLDLDRLRRLRRDDRLULURRUDRDUUUULDURUDRDLDDUDUDRRURDULRRUDRLRRDLUURURDLDRLRDUDDDLDDDURURLUULRDUUULRURUDUDRRUDULLLUUUDRLLDRRDDLRUDRDRDLLRURURRRULURURRRLUUULRRRUURUUDURUDDLLDLDRLRDLDRLLDLDRDRRLRRRURUUUDRDLRLRUDRLULUUULUDDLULDLRLLRDUULLRLRURLRURULLLUDUDDLRULRDUURURLDLUURRRDURRLLDRUUDRDLLDUUDLURUDDUUUULRLLURLUDDRLRRDRURLRUDRLDDRLLL",
"output": "-1"
},
{
"input": "LDLDLDLDLDRULD",
"output": "5"
},
{
"input": "LULULURULLLU",
"output": "5"
},
{
"input": "DRDRDDRR",
"output": "4"
},
{
"input": "LR",
"output": "0"
},
{
"input": "UL",
"output": "1"
},
{
"input": "UD",
"output": "0"
},
{
"input": "R",
"output": "-1"
},
{
"input": "LU",
"output": "1"
},
{
"input": "RR",
"output": "1"
},
{
"input": "UDLR",
"output": "0"
},
{
"input": "RRRRRLLUUUUDD",
"output": "-1"
},
{
"input": "UUUUDLLLLR",
"output": "3"
},
{
"input": "LLRUD",
"output": "-1"
},
{
"input": "LLRDDU",
"output": "1"
}
] | 1,473,527,939
| 2,039
|
Python 3
|
WRONG_ANSWER
|
PRETESTS
| 5
| 77
| 0
|
s = str(input())
n = len(s)
temp = {
"L": "R",
"R": "L",
"U": "D",
"D": "U"
}
answer = 0
if n % 2 == 0:
left = s[:n // 2]
right = s[n // 2:]
for i in range(len(left)):
if left[i] != temp[right[len(right) - i - 1]]:
answer += 1
print(answer)
else:
print(-1)
|
Title: Memory and Trident
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Memory is performing a walk on the two-dimensional plane, starting at the origin. He is given a string *s* with his directions for motion:
- An 'L' indicates he should move one unit left. - An 'R' indicates he should move one unit right. - A 'U' indicates he should move one unit up. - A 'D' indicates he should move one unit down.
But now Memory wants to end at the origin. To do this, he has a special trident. This trident can replace any character in *s* with any of 'L', 'R', 'U', or 'D'. However, because he doesn't want to wear out the trident, he wants to make the minimum number of edits possible. Please tell Memory what is the minimum number of changes he needs to make to produce a string that, when walked, will end at the origin, or if there is no such string.
Input Specification:
The first and only line contains the string *s* (1<=≤<=|*s*|<=≤<=100<=000) — the instructions Memory is given.
Output Specification:
If there is a string satisfying the conditions, output a single integer — the minimum number of edits required. In case it's not possible to change the sequence in such a way that it will bring Memory to to the origin, output -1.
Demo Input:
['RRU\n', 'UDUR\n', 'RUUR\n']
Demo Output:
['-1\n', '1\n', '2\n']
Note:
In the first sample test, Memory is told to walk right, then right, then up. It is easy to see that it is impossible to edit these instructions to form a valid walk.
In the second sample test, Memory is told to walk up, then down, then up, then right. One possible solution is to change *s* to "LDUR". This string uses 1 edit, which is the minimum possible. It also ends at the origin.
|
```python
s = str(input())
n = len(s)
temp = {
"L": "R",
"R": "L",
"U": "D",
"D": "U"
}
answer = 0
if n % 2 == 0:
left = s[:n // 2]
right = s[n // 2:]
for i in range(len(left)):
if left[i] != temp[right[len(right) - i - 1]]:
answer += 1
print(answer)
else:
print(-1)
```
| 0
|
|
12
|
A
|
Super Agent
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Super Agent
|
2
|
256
|
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
|
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
|
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
|
[
"XX.\n...\n.XX\n",
"X.X\nX..\n...\n"
] |
[
"YES\n",
"NO\n"
] |
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
| 0
|
[
{
"input": "XX.\n...\n.XX",
"output": "YES"
},
{
"input": ".X.\n.X.\n.X.",
"output": "YES"
},
{
"input": "XXX\nXXX\nXXX",
"output": "YES"
},
{
"input": "XXX\nX.X\nXXX",
"output": "YES"
},
{
"input": "X..\n.X.\n..X",
"output": "YES"
},
{
"input": "...\nX.X\nX..",
"output": "NO"
},
{
"input": ".X.\nX.X\n.X.",
"output": "YES"
},
{
"input": "X.X\n.X.\nX.X",
"output": "YES"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "XXX\n...\nXXX",
"output": "YES"
},
{
"input": "..X\nX..\n..X",
"output": "NO"
},
{
"input": ".X.\n...\nX.X",
"output": "NO"
},
{
"input": "X.X\nX.X\nX.X",
"output": "YES"
},
{
"input": ".X.\nX.X\nXX.",
"output": "NO"
},
{
"input": "...\nXXX\nXXX",
"output": "NO"
},
{
"input": "XXX\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX.X\n.X.",
"output": "NO"
},
{
"input": "...\n..X\nXXX",
"output": "NO"
},
{
"input": "..X\nX.X\nX..",
"output": "YES"
},
{
"input": "..X\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX..\nX..",
"output": "NO"
},
{
"input": "XXX\n.X.\nXXX",
"output": "YES"
},
{
"input": "..X\n...\nX..",
"output": "YES"
},
{
"input": "...\n...\nX..",
"output": "NO"
},
{
"input": "...\n...\n.X.",
"output": "NO"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "...\n.X.\nX..",
"output": "NO"
}
] | 1,627,288,321
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 124
| 6,963,200
|
code = []
pos = []
pos2 = []
for i in range(3):
code.append(list(str(input())))
for k in range(len(code)):
for j in range(len(code[k])):
if code[k][j]== 'X':
pos.append(k*3+j+1)
for p in range(len(pos)):
if pos[p] == 1:
pos2.append(9)
if pos[p] == 2:
pos2.append(8)
if pos[p] == 3:
pos2.append(7)
if pos[p] == 4:
pos2.append(6)
if pos[p] == 6:
pos2.append(4)
if pos[p] == 7:
pos2.append(3)
if pos[p] == 8:
pos2.append(2)
if pos[p] == 9:
pos2.append(1)
pos2.sort()
if pos2 == pos:
print("YES")
else:
print("NO")
|
Title: Super Agent
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
Input Specification:
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
Output Specification:
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
Demo Input:
['XX.\n...\n.XX\n', 'X.X\nX..\n...\n']
Demo Output:
['YES\n', 'NO\n']
Note:
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
|
```python
code = []
pos = []
pos2 = []
for i in range(3):
code.append(list(str(input())))
for k in range(len(code)):
for j in range(len(code[k])):
if code[k][j]== 'X':
pos.append(k*3+j+1)
for p in range(len(pos)):
if pos[p] == 1:
pos2.append(9)
if pos[p] == 2:
pos2.append(8)
if pos[p] == 3:
pos2.append(7)
if pos[p] == 4:
pos2.append(6)
if pos[p] == 6:
pos2.append(4)
if pos[p] == 7:
pos2.append(3)
if pos[p] == 8:
pos2.append(2)
if pos[p] == 9:
pos2.append(1)
pos2.sort()
if pos2 == pos:
print("YES")
else:
print("NO")
```
| 0
|
996
|
A
|
Hit the Lottery
|
PROGRAMMING
| 800
|
[
"dp",
"greedy"
] | null | null |
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
|
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
|
Output the minimum number of bills that Allen could receive.
|
[
"125\n",
"43\n",
"1000000000\n"
] |
[
"3\n",
"5\n",
"10000000\n"
] |
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
| 500
|
[
{
"input": "125",
"output": "3"
},
{
"input": "43",
"output": "5"
},
{
"input": "1000000000",
"output": "10000000"
},
{
"input": "4",
"output": "4"
},
{
"input": "5",
"output": "1"
},
{
"input": "1",
"output": "1"
},
{
"input": "74",
"output": "8"
},
{
"input": "31",
"output": "3"
},
{
"input": "59",
"output": "8"
},
{
"input": "79",
"output": "9"
},
{
"input": "7",
"output": "3"
},
{
"input": "55",
"output": "4"
},
{
"input": "40",
"output": "2"
},
{
"input": "719",
"output": "13"
},
{
"input": "847",
"output": "13"
},
{
"input": "225",
"output": "4"
},
{
"input": "4704",
"output": "51"
},
{
"input": "1132",
"output": "15"
},
{
"input": "7811",
"output": "80"
},
{
"input": "7981",
"output": "84"
},
{
"input": "82655",
"output": "830"
},
{
"input": "6364",
"output": "70"
},
{
"input": "74611",
"output": "748"
},
{
"input": "45391",
"output": "459"
},
{
"input": "620448",
"output": "6210"
},
{
"input": "265145",
"output": "2654"
},
{
"input": "671704",
"output": "6721"
},
{
"input": "365173",
"output": "3658"
},
{
"input": "7130872",
"output": "71314"
},
{
"input": "9628747",
"output": "96292"
},
{
"input": "8898399",
"output": "88993"
},
{
"input": "9497953",
"output": "94985"
},
{
"input": "19070947",
"output": "190714"
},
{
"input": "20185520",
"output": "201856"
},
{
"input": "91402248",
"output": "914028"
},
{
"input": "27035533",
"output": "270360"
},
{
"input": "22717528",
"output": "227180"
},
{
"input": "24403439",
"output": "244041"
},
{
"input": "163565555",
"output": "1635659"
},
{
"input": "152541908",
"output": "1525423"
},
{
"input": "668439837",
"output": "6684403"
},
{
"input": "20",
"output": "1"
},
{
"input": "999999999",
"output": "10000009"
},
{
"input": "10",
"output": "1"
},
{
"input": "7",
"output": "3"
},
{
"input": "6",
"output": "2"
},
{
"input": "99999999",
"output": "1000009"
},
{
"input": "1000001",
"output": "10001"
},
{
"input": "2521",
"output": "27"
}
] | 1,690,758,241
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 49
| 46
| 0
|
n = int(input())
ans = 0
money = [1, 5, 10, 20, 100]
for x in money[::-1]:
ans += n // x
n = n % x
# print(ans, n)
print(ans)
|
Title: Hit the Lottery
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
Input Specification:
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output Specification:
Output the minimum number of bills that Allen could receive.
Demo Input:
['125\n', '43\n', '1000000000\n']
Demo Output:
['3\n', '5\n', '10000000\n']
Note:
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
|
```python
n = int(input())
ans = 0
money = [1, 5, 10, 20, 100]
for x in money[::-1]:
ans += n // x
n = n % x
# print(ans, n)
print(ans)
```
| 3
|
|
862
|
A
|
Mahmoud and Ehab and the MEX
|
PROGRAMMING
| 1,000
|
[
"greedy",
"implementation"
] | null | null |
Dr. Evil kidnapped Mahmoud and Ehab in the evil land because of their performance in the Evil Olympiad in Informatics (EOI). He decided to give them some problems to let them go.
Dr. Evil is interested in sets, He has a set of *n* integers. Dr. Evil calls a set of integers evil if the MEX of it is exactly *x*. the MEX of a set of integers is the minimum non-negative integer that doesn't exist in it. For example, the MEX of the set {0,<=2,<=4} is 1 and the MEX of the set {1,<=2,<=3} is 0 .
Dr. Evil is going to make his set evil. To do this he can perform some operations. During each operation he can add some non-negative integer to his set or erase some element from it. What is the minimal number of operations Dr. Evil has to perform to make his set evil?
|
The first line contains two integers *n* and *x* (1<=≤<=*n*<=≤<=100, 0<=≤<=*x*<=≤<=100) — the size of the set Dr. Evil owns, and the desired MEX.
The second line contains *n* distinct non-negative integers not exceeding 100 that represent the set.
|
The only line should contain one integer — the minimal number of operations Dr. Evil should perform.
|
[
"5 3\n0 4 5 6 7\n",
"1 0\n0\n",
"5 0\n1 2 3 4 5\n"
] |
[
"2\n",
"1\n",
"0\n"
] |
For the first test case Dr. Evil should add 1 and 2 to the set performing 2 operations.
For the second test case Dr. Evil should erase 0 from the set. After that, the set becomes empty, so the MEX of it is 0.
In the third test case the set is already evil.
| 500
|
[
{
"input": "5 3\n0 4 5 6 7",
"output": "2"
},
{
"input": "1 0\n0",
"output": "1"
},
{
"input": "5 0\n1 2 3 4 5",
"output": "0"
},
{
"input": "10 5\n57 1 47 9 93 37 76 70 78 15",
"output": "4"
},
{
"input": "10 5\n99 98 93 97 95 100 92 94 91 96",
"output": "5"
},
{
"input": "10 5\n1 2 3 4 59 45 0 58 51 91",
"output": "0"
},
{
"input": "100 100\n79 13 21 11 3 87 28 40 29 4 96 34 8 78 61 46 33 45 99 30 92 67 22 97 39 86 73 31 74 44 62 55 57 2 54 63 80 69 25 48 77 98 17 93 15 16 89 12 43 23 37 95 14 38 83 90 49 56 72 10 20 0 50 71 70 88 19 1 76 81 52 41 82 68 85 47 6 7 35 60 18 64 75 84 27 9 65 91 94 42 53 24 66 26 59 36 51 32 5 58",
"output": "0"
},
{
"input": "100 50\n95 78 46 92 80 18 79 58 30 72 19 89 39 29 44 65 15 100 59 8 96 9 62 67 41 42 82 14 57 32 71 77 40 5 7 51 28 53 85 23 16 35 3 91 6 11 75 61 17 66 13 47 36 56 10 22 83 60 48 24 26 97 4 33 76 86 70 0 34 64 52 43 21 49 55 74 1 73 81 25 54 63 94 84 20 68 87 12 31 88 38 93 37 90 98 69 99 45 27 2",
"output": "0"
},
{
"input": "100 33\n28 11 79 92 88 62 77 72 7 41 96 97 67 84 44 8 81 35 38 1 64 68 46 17 98 83 31 12 74 21 2 22 47 6 36 75 65 61 37 26 25 45 59 48 100 51 93 76 78 49 3 57 16 4 87 29 55 82 70 39 53 0 60 15 24 71 58 20 66 89 95 42 13 43 63 90 85 52 50 30 54 40 56 23 27 34 32 18 10 19 69 9 99 73 91 14 5 80 94 86",
"output": "0"
},
{
"input": "99 33\n25 76 41 95 55 20 47 59 58 84 87 92 16 27 35 65 72 63 93 54 36 96 15 86 5 69 24 46 67 73 48 60 40 6 61 74 97 10 100 8 52 26 77 18 7 62 37 2 14 66 11 56 68 91 0 64 75 99 30 21 53 1 89 81 3 98 12 88 39 38 29 83 22 90 9 28 45 43 78 44 32 57 4 50 70 17 13 51 80 85 71 94 82 19 34 42 23 79 49",
"output": "1"
},
{
"input": "100 100\n65 56 84 46 44 33 99 74 62 72 93 67 43 92 75 88 38 34 66 12 55 76 58 90 78 8 14 45 97 59 48 32 64 18 39 89 31 51 54 81 29 36 70 77 40 22 49 27 3 1 73 13 98 42 87 37 2 57 4 6 50 25 23 79 28 86 68 61 80 17 19 10 15 63 52 11 35 60 21 16 24 85 30 91 7 5 69 20 71 82 53 94 41 95 96 9 26 83 0 47",
"output": "0"
},
{
"input": "100 100\n58 88 12 71 22 1 40 19 73 20 67 48 57 17 69 36 100 35 33 37 72 55 52 8 89 85 47 42 78 70 81 86 11 9 68 99 6 16 21 61 53 98 23 62 32 59 51 0 87 24 50 30 65 10 80 95 7 92 25 74 60 79 91 5 13 31 75 38 90 94 46 66 93 34 14 41 28 2 76 84 43 96 3 56 49 82 27 77 64 63 4 45 18 29 54 39 15 26 83 44",
"output": "2"
},
{
"input": "89 100\n58 96 17 41 86 34 28 84 18 40 8 77 87 89 68 79 33 35 53 49 0 6 22 12 72 90 48 55 21 50 56 62 75 2 37 95 69 74 14 20 44 46 27 32 31 59 63 60 10 85 71 70 38 52 94 30 61 51 80 26 36 23 39 47 76 45 100 57 15 78 97 66 54 13 99 16 93 73 24 4 83 5 98 81 92 25 29 88 65",
"output": "13"
},
{
"input": "100 50\n7 95 24 76 81 78 60 69 83 84 100 1 65 31 48 92 73 39 18 89 38 97 10 42 8 55 98 51 21 90 62 77 16 91 0 94 4 37 19 17 67 35 45 41 56 20 15 85 75 28 59 27 12 54 61 68 36 5 79 93 66 11 70 49 50 34 30 25 96 46 64 14 32 22 47 40 58 23 43 9 87 82 26 53 80 52 3 86 13 99 33 71 6 88 57 74 2 44 72 63",
"output": "2"
},
{
"input": "77 0\n27 8 20 92 21 41 53 98 17 65 67 35 81 11 55 49 61 44 2 66 51 89 40 28 52 62 86 91 64 24 18 5 94 82 96 99 71 6 39 83 26 29 16 30 45 97 80 90 69 12 13 33 76 73 46 19 78 56 88 38 42 34 57 77 47 4 59 58 7 100 95 72 9 74 15 43 54",
"output": "0"
},
{
"input": "100 50\n55 36 0 32 81 6 17 43 24 13 30 19 8 59 71 45 15 74 3 41 99 42 86 47 2 94 35 1 66 95 38 49 4 27 96 89 34 44 92 25 51 39 54 28 80 77 20 14 48 40 68 56 31 63 33 78 69 37 18 26 83 70 23 82 91 65 67 52 61 53 7 22 60 21 12 73 72 87 75 100 90 29 64 79 98 85 5 62 93 84 50 46 97 58 57 16 9 10 76 11",
"output": "1"
},
{
"input": "77 0\n12 8 19 87 9 54 55 86 97 7 27 85 25 48 94 73 26 1 13 57 72 69 76 39 38 91 75 40 42 28 93 21 70 84 65 11 60 90 20 95 66 89 59 47 34 99 6 61 52 100 50 3 77 81 82 53 15 24 0 45 44 14 68 96 58 5 18 35 10 98 29 74 92 49 83 71 17",
"output": "1"
},
{
"input": "100 70\n25 94 66 65 10 99 89 6 70 31 7 40 20 92 64 27 21 72 77 98 17 43 47 44 48 81 38 56 100 39 90 22 88 76 3 83 86 29 33 55 82 79 49 11 2 16 12 78 85 69 32 97 26 15 53 24 23 91 51 67 34 35 52 5 62 50 95 18 71 13 75 8 30 42 93 36 45 60 63 46 57 41 87 0 84 54 74 37 4 58 28 19 96 61 80 9 1 14 73 68",
"output": "2"
},
{
"input": "89 19\n14 77 85 81 79 38 91 45 55 51 50 11 62 67 73 76 2 27 16 23 3 29 65 98 78 17 4 58 22 20 34 66 64 31 72 5 32 44 12 75 80 47 18 25 99 0 61 56 71 84 48 88 10 7 86 8 49 24 43 21 37 28 33 54 46 57 40 89 36 97 6 96 39 95 26 74 1 69 9 100 52 30 83 87 68 60 92 90 35",
"output": "2"
},
{
"input": "89 100\n69 61 56 45 11 41 42 32 28 29 0 76 7 65 13 35 36 82 10 39 26 34 38 40 92 12 17 54 24 46 88 70 66 27 100 52 85 62 22 48 86 68 21 49 53 94 67 20 1 90 77 84 31 87 58 47 95 33 4 72 93 83 8 51 91 80 99 43 71 19 44 59 98 97 64 9 81 16 79 63 25 37 3 75 2 55 50 6 18",
"output": "13"
},
{
"input": "77 0\n38 76 24 74 42 88 29 75 96 46 90 32 59 97 98 60 41 57 80 37 100 49 25 63 95 31 61 68 53 78 27 66 84 48 94 83 30 26 36 99 71 62 45 47 70 28 35 54 34 85 79 43 91 72 86 33 67 92 77 65 69 52 82 55 87 64 56 40 50 44 51 73 89 81 58 93 39",
"output": "0"
},
{
"input": "89 100\n38 90 80 64 35 44 56 11 15 89 23 12 49 70 72 60 63 85 92 10 45 83 8 88 41 33 16 6 61 76 62 71 87 13 25 77 74 0 1 37 96 93 7 94 21 82 34 78 4 73 65 20 81 95 50 32 48 17 69 55 68 5 51 27 53 43 91 67 59 46 86 84 99 24 22 3 97 98 40 36 26 58 57 9 42 30 52 2 47",
"output": "11"
},
{
"input": "77 0\n55 71 78 86 68 35 53 10 59 32 81 19 74 97 62 61 93 87 96 44 25 18 43 82 84 16 34 48 92 39 64 36 49 91 45 76 95 31 57 29 75 79 13 2 14 24 52 23 33 20 47 99 63 15 5 80 58 67 12 3 85 6 1 27 73 90 4 42 37 70 8 11 89 77 9 22 94",
"output": "0"
},
{
"input": "77 0\n12 75 31 71 44 8 3 82 21 77 50 29 57 74 40 10 15 42 84 2 100 9 28 72 92 0 49 11 90 55 17 36 19 54 68 52 4 69 97 91 5 39 59 45 89 62 53 83 16 94 76 60 95 47 30 51 7 48 20 70 67 32 58 78 63 34 56 93 99 88 24 1 66 22 25 14 13",
"output": "1"
},
{
"input": "100 70\n91 82 8 85 26 25 95 97 40 87 81 93 7 73 38 94 64 96 74 18 90 19 65 68 72 61 23 43 36 41 60 88 30 33 71 24 52 39 15 3 16 89 86 79 55 4 9 58 67 44 46 29 6 48 84 69 27 21 78 54 51 57 80 53 76 50 47 77 45 12 34 10 100 0 17 31 56 99 98 11 92 5 2 42 32 59 66 62 37 63 28 75 35 1 22 13 83 49 20 14",
"output": "0"
},
{
"input": "77 0\n51 5 81 62 30 22 11 0 83 16 79 85 52 70 69 10 8 47 58 3 24 34 44 14 82 66 99 17 28 31 64 67 23 49 94 45 4 12 27 15 21 6 43 72 87 2 63 92 35 39 59 9 90 78 93 20 65 36 60 89 50 41 61 84 77 86 76 100 38 68 53 97 96 95 7 19 88",
"output": "1"
},
{
"input": "1 100\n0",
"output": "99"
},
{
"input": "1 0\n100",
"output": "0"
},
{
"input": "1 100\n100",
"output": "101"
},
{
"input": "2 100\n0 100",
"output": "100"
},
{
"input": "5 5\n1 2 3 4 5",
"output": "2"
},
{
"input": "5 3\n0 3 4 5 6",
"output": "3"
},
{
"input": "7 10\n0 1 2 3 4 5 10",
"output": "5"
},
{
"input": "2 2\n0 2",
"output": "2"
},
{
"input": "2 1\n1 2",
"output": "2"
},
{
"input": "5 1\n1 2 3 4 5",
"output": "2"
},
{
"input": "5 2\n1 2 3 4 5",
"output": "2"
},
{
"input": "5 6\n0 1 2 3 4",
"output": "1"
},
{
"input": "3 2\n3 4 5",
"output": "2"
}
] | 1,598,188,574
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 11
| 108
| 6,656,000
|
if __name__ == '__main__':
n, x = input().split()
n = int(n)
x = int(x)
arr = set(map(int, input().split()))
ans = 0
if x in arr:
ans += 1
else:
for i in range(101):
if i < x and i not in arr:
ans += 1
print(ans)
|
Title: Mahmoud and Ehab and the MEX
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dr. Evil kidnapped Mahmoud and Ehab in the evil land because of their performance in the Evil Olympiad in Informatics (EOI). He decided to give them some problems to let them go.
Dr. Evil is interested in sets, He has a set of *n* integers. Dr. Evil calls a set of integers evil if the MEX of it is exactly *x*. the MEX of a set of integers is the minimum non-negative integer that doesn't exist in it. For example, the MEX of the set {0,<=2,<=4} is 1 and the MEX of the set {1,<=2,<=3} is 0 .
Dr. Evil is going to make his set evil. To do this he can perform some operations. During each operation he can add some non-negative integer to his set or erase some element from it. What is the minimal number of operations Dr. Evil has to perform to make his set evil?
Input Specification:
The first line contains two integers *n* and *x* (1<=≤<=*n*<=≤<=100, 0<=≤<=*x*<=≤<=100) — the size of the set Dr. Evil owns, and the desired MEX.
The second line contains *n* distinct non-negative integers not exceeding 100 that represent the set.
Output Specification:
The only line should contain one integer — the minimal number of operations Dr. Evil should perform.
Demo Input:
['5 3\n0 4 5 6 7\n', '1 0\n0\n', '5 0\n1 2 3 4 5\n']
Demo Output:
['2\n', '1\n', '0\n']
Note:
For the first test case Dr. Evil should add 1 and 2 to the set performing 2 operations.
For the second test case Dr. Evil should erase 0 from the set. After that, the set becomes empty, so the MEX of it is 0.
In the third test case the set is already evil.
|
```python
if __name__ == '__main__':
n, x = input().split()
n = int(n)
x = int(x)
arr = set(map(int, input().split()))
ans = 0
if x in arr:
ans += 1
else:
for i in range(101):
if i < x and i not in arr:
ans += 1
print(ans)
```
| 0
|
|
584
|
A
|
Olesya and Rodion
|
PROGRAMMING
| 1,000
|
[
"math"
] | null | null |
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them.
Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
|
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
|
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
|
[
"3 2\n"
] |
[
"712"
] |
none
| 500
|
[
{
"input": "3 2",
"output": "222"
},
{
"input": "2 2",
"output": "22"
},
{
"input": "4 3",
"output": "3333"
},
{
"input": "5 3",
"output": "33333"
},
{
"input": "10 7",
"output": "7777777777"
},
{
"input": "2 9",
"output": "99"
},
{
"input": "18 8",
"output": "888888888888888888"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 10",
"output": "-1"
},
{
"input": "100 5",
"output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555"
},
{
"input": "10 2",
"output": "2222222222"
},
{
"input": "18 10",
"output": "111111111111111110"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "7 6",
"output": "6666666"
},
{
"input": "4 4",
"output": "4444"
},
{
"input": "14 7",
"output": "77777777777777"
},
{
"input": "3 8",
"output": "888"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "2 8",
"output": "88"
},
{
"input": "3 8",
"output": "888"
},
{
"input": "4 3",
"output": "3333"
},
{
"input": "5 9",
"output": "99999"
},
{
"input": "4 8",
"output": "8888"
},
{
"input": "3 4",
"output": "444"
},
{
"input": "9 4",
"output": "444444444"
},
{
"input": "8 10",
"output": "11111110"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "20 3",
"output": "33333333333333333333"
},
{
"input": "15 10",
"output": "111111111111110"
},
{
"input": "31 4",
"output": "4444444444444444444444444444444"
},
{
"input": "18 9",
"output": "999999999999999999"
},
{
"input": "72 4",
"output": "444444444444444444444444444444444444444444444444444444444444444444444444"
},
{
"input": "76 8",
"output": "8888888888888888888888888888888888888888888888888888888888888888888888888888"
},
{
"input": "12 5",
"output": "555555555555"
},
{
"input": "54 5",
"output": "555555555555555555555555555555555555555555555555555555"
},
{
"input": "96 10",
"output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "15 9",
"output": "999999999999999"
},
{
"input": "100 2",
"output": "2222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222"
},
{
"input": "99 3",
"output": "333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333333"
},
{
"input": "98 4",
"output": "44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444"
},
{
"input": "97 5",
"output": "5555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555"
},
{
"input": "100 6",
"output": "6666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666666"
},
{
"input": "99 7",
"output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "98 8",
"output": "88888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888"
},
{
"input": "97 9",
"output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999"
},
{
"input": "100 10",
"output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "3 10",
"output": "110"
},
{
"input": "2 4",
"output": "44"
},
{
"input": "2 10",
"output": "10"
},
{
"input": "10 10",
"output": "1111111110"
},
{
"input": "4 10",
"output": "1110"
},
{
"input": "25 10",
"output": "1111111111111111111111110"
},
{
"input": "50 10",
"output": "11111111111111111111111111111111111111111111111110"
},
{
"input": "5 10",
"output": "11110"
},
{
"input": "99 10",
"output": "111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "100 10",
"output": "1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111110"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "20 10",
"output": "11111111111111111110"
},
{
"input": "99 7",
"output": "777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "89 5",
"output": "55555555555555555555555555555555555555555555555555555555555555555555555555555555555555555"
},
{
"input": "6 10",
"output": "111110"
},
{
"input": "3 8",
"output": "888"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "100 7",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
}
] | 1,674,589,986
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 8
| 93
| 0
|
n, t = map(int, input().split())
for i in range((10**(n-1)), 10**n):
if i % t == 0:
print(i)
break
|
Title: Olesya and Rodion
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olesya loves numbers consisting of *n* digits, and Rodion only likes numbers that are divisible by *t*. Find some number that satisfies both of them.
Your task is: given the *n* and *t* print an integer strictly larger than zero consisting of *n* digits that is divisible by *t*. If such number doesn't exist, print <=-<=1.
Input Specification:
The single line contains two numbers, *n* and *t* (1<=≤<=*n*<=≤<=100, 2<=≤<=*t*<=≤<=10) — the length of the number and the number it should be divisible by.
Output Specification:
Print one such positive number without leading zeroes, — the answer to the problem, or <=-<=1, if such number doesn't exist. If there are multiple possible answers, you are allowed to print any of them.
Demo Input:
['3 2\n']
Demo Output:
['712']
Note:
none
|
```python
n, t = map(int, input().split())
for i in range((10**(n-1)), 10**n):
if i % t == 0:
print(i)
break
```
| 0
|
|
1
|
A
|
Theatre Square
|
PROGRAMMING
| 1,000
|
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0
|
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,695,293,332
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 15
| 0
|
a,b,c=map(int,input().split())
d=a%c
x=a//c+1
if d==0:
x=x-1
e=b%c
y=b//c+1
if e==0:
y=y+1
s=x*y
print(s)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
a,b,c=map(int,input().split())
d=a%c
x=a//c+1
if d==0:
x=x-1
e=b%c
y=b//c+1
if e==0:
y=y+1
s=x*y
print(s)
```
| 0
|
327
|
A
|
Flipping Game
|
PROGRAMMING
| 1,200
|
[
"brute force",
"dp",
"implementation"
] | null | null |
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
|
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
|
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
|
[
"5\n1 0 0 1 0\n",
"4\n1 0 0 1\n"
] |
[
"4\n",
"4\n"
] |
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1.
| 500
|
[
{
"input": "5\n1 0 0 1 0",
"output": "4"
},
{
"input": "4\n1 0 0 1",
"output": "4"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "8\n1 0 0 0 1 0 0 0",
"output": "7"
},
{
"input": "18\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "18"
},
{
"input": "23\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "22"
},
{
"input": "100\n0 1 0 1 1 1 0 1 0 1 0 0 1 1 1 1 0 0 1 1 1 1 1 1 1 0 0 1 1 1 0 1 1 0 0 0 1 1 1 1 0 0 1 1 1 0 0 1 1 0 1 1 1 0 0 0 1 0 0 0 0 0 1 1 0 0 1 1 1 1 1 1 1 1 0 1 1 1 0 1 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 0 1",
"output": "70"
},
{
"input": "100\n0 1 1 0 1 0 0 1 0 0 0 1 1 0 0 0 1 1 1 0 1 0 0 0 0 0 1 0 1 0 1 0 1 0 1 0 0 0 1 0 0 0 0 0 1 1 0 1 0 1 0 1 1 1 0 1 0 1 1 0 0 1 1 0 0 1 1 1 0 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 0 0 0 1 0 0 0 0 1 1 1 1",
"output": "60"
},
{
"input": "18\n0 1 0 1 0 1 0 1 0 1 1 0 1 1 0 1 1 0",
"output": "11"
},
{
"input": "25\n0 1 0 0 0 0 0 1 0 1 0 1 0 0 0 0 1 1 1 0 0 1 1 0 1",
"output": "18"
},
{
"input": "55\n0 0 1 1 0 0 0 1 0 1 1 0 1 1 1 0 1 1 1 1 1 0 0 1 0 0 1 0 1 1 0 0 1 0 1 1 0 1 1 1 1 0 1 1 0 0 0 0 1 1 0 1 1 1 1",
"output": "36"
},
{
"input": "75\n1 1 0 1 0 1 1 0 0 0 0 0 1 1 1 1 1 0 1 0 1 0 0 0 0 1 1 1 0 1 0 0 1 1 0 1 0 0 1 1 0 1 0 1 0 1 0 0 0 0 1 0 0 1 1 1 0 0 1 0 1 1 0 0 0 0 1 1 0 0 0 1 0 0 0",
"output": "44"
},
{
"input": "100\n0 0 1 0 1 0 0 1 1 0 1 1 0 1 0 1 1 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 0 1 1 0 0 1 1 1 0 0 0 0 1 0 1 1 1 0 0 1 0 1 1 1 1 1 1 1 0 1 0 1 0 0 1 0 1 1 1 0 0 0 0 1 0 1 1 0 0 1 1 0 1 1 1 1 0 1 1 1 0 0 1 1 0 1 0 1",
"output": "61"
},
{
"input": "100\n0 0 0 1 0 0 0 1 0 1 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 1 0 1 0 1 0 1 0 1 1 0 1 1 0 0 0 1 1 1 1 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 0 0 0 0 1 1 0 0 1 0 0 1 1 0 1 1 0 1 0 0 1 1 0 1 1 1 1 0 1 0 0 1 0 1 1 1 0 1 1 0",
"output": "61"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "99"
},
{
"input": "100\n0 0 1 1 1 0 1 1 0 0 1 0 1 0 1 0 0 1 0 1 1 0 0 1 1 1 1 1 1 0 1 0 0 1 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 0 0 1 0 0 1 1 0 0 0 1 1 1 0 1 1 0 0 0 0 1 0 0 1 0 1 0 0 0 0 0 0 1 1 1 0 1 1 1 0 1 1 1 1 1 0 0 0 0 1 0",
"output": "61"
},
{
"input": "100\n0 1 1 1 1 1 1 0 0 0 1 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 0 1 1 1 0 1 0 0 1 1 0 0 0 1 1 1 1 1 1 1 1 1 1 0 0 1 0 1 0 0 0 0 1 0 1 0 1 0 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 1 1 0 0 0 1 0 1 1 0 0 0 0 0 0 1",
"output": "59"
},
{
"input": "99\n1 1 0 0 0 1 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 0 1 1 0 0 0 0 0 0 1 1 0 0 1 0 1 1 1 0 0 0 0 0 1 0 0 0 0 0 0 1 0 1 1 0 1 0 0 1 1 0 1 0 0 0 1 1 1 1 0 1 1 1 0 0 1 1 0 0 0 0 1 0 0 0 0 0 1 0 1 1 1",
"output": "61"
},
{
"input": "2\n1 1",
"output": "1"
}
] | 1,677,686,999
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 20
| 92
| 0
|
n=int(input())
l=[int(i) for i in input().split()]
a=len(l)
su=0
an=0
while(a==1):
if(l[0]==1):
print(0)
a+=1
else:
print(1)
a+=1
if(a>2):
if(0 not in l ):
print(len(l)-1)
else:
a=l.index(0)
b=len(l) - l[::-1].index(0) - 1
for i in range(len(l)):
if(l[i]):
su-=1
else:
su+=1
if(su<0):
su=0
an=max(an,su)
print(l.count(1)+an)
|
Title: Flipping Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub got bored, so he invented a game to be played on paper.
He writes *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Each of those integers can be either 0 or 1. He's allowed to do exactly one move: he chooses two indices *i* and *j* (1<=≤<=*i*<=≤<=*j*<=≤<=*n*) and flips all values *a**k* for which their positions are in range [*i*,<=*j*] (that is *i*<=≤<=*k*<=≤<=*j*). Flip the value of *x* means to apply operation *x*<==<=1 - *x*.
The goal of the game is that after exactly one move to obtain the maximum number of ones. Write a program to solve the little game of Iahub.
Input Specification:
The first line of the input contains an integer *n* (1<=≤<=*n*<=≤<=100). In the second line of the input there are *n* integers: *a*1,<=*a*2,<=...,<=*a**n*. It is guaranteed that each of those *n* values is either 0 or 1.
Output Specification:
Print an integer — the maximal number of 1s that can be obtained after exactly one move.
Demo Input:
['5\n1 0 0 1 0\n', '4\n1 0 0 1\n']
Demo Output:
['4\n', '4\n']
Note:
In the first case, flip the segment from 2 to 5 (*i* = 2, *j* = 5). That flip changes the sequence, it becomes: [1 1 1 0 1]. So, it contains four ones. There is no way to make the whole sequence equal to [1 1 1 1 1].
In the second case, flipping only the second and the third element (*i* = 2, *j* = 3) will turn all numbers into 1.
|
```python
n=int(input())
l=[int(i) for i in input().split()]
a=len(l)
su=0
an=0
while(a==1):
if(l[0]==1):
print(0)
a+=1
else:
print(1)
a+=1
if(a>2):
if(0 not in l ):
print(len(l)-1)
else:
a=l.index(0)
b=len(l) - l[::-1].index(0) - 1
for i in range(len(l)):
if(l[i]):
su-=1
else:
su+=1
if(su<0):
su=0
an=max(an,su)
print(l.count(1)+an)
```
| 0
|
|
545
|
D
|
Queue
|
PROGRAMMING
| 1,300
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Little girl Susie went shopping with her mom and she wondered how to improve service quality.
There are *n* people in the queue. For each person we know time *t**i* needed to serve him. A person will be disappointed if the time he waits is more than the time needed to serve him. The time a person waits is the total time when all the people who stand in the queue in front of him are served. Susie thought that if we swap some people in the queue, then we can decrease the number of people who are disappointed.
Help Susie find out what is the maximum number of not disappointed people can be achieved by swapping people in the queue.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105).
The next line contains *n* integers *t**i* (1<=≤<=*t**i*<=≤<=109), separated by spaces.
|
Print a single number — the maximum number of not disappointed people in the queue.
|
[
"5\n15 2 1 5 3\n"
] |
[
"4\n"
] |
Value 4 is achieved at such an arrangement, for example: 1, 2, 3, 5, 15. Thus, you can make everything feel not disappointed except for the person with time 5.
| 1,750
|
[
{
"input": "5\n15 2 1 5 3",
"output": "4"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "10\n13 2 5 55 21 34 1 8 1 3",
"output": "6"
},
{
"input": "10\n8 256 16 1 2 1 64 4 128 32",
"output": "10"
},
{
"input": "10\n10000 40000 10000 50000 20000 100000 10000 100 30000 500",
"output": "6"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "15\n9 11 45 86 52 65 35 3 93 7 21 45 15 11 39",
"output": "6"
},
{
"input": "20\n16839799 17525904 91276752 42650694 60106463 12243176 54892123 25142243 16015971 41250998 11150057 6994983 67700784 16562412 82163675 46178521 33914268 91966607 93976858 84100064",
"output": "5"
},
{
"input": "26\n1000 4110030 64221 131521030 942374833 1003 2055015 32110 513757 16440130 263042057 32880256 128439 557559573 16051 8220066 469240078 65760513 256878 790176315 4012 2005 1027508 928528684 8030 805074697",
"output": "21"
}
] | 1,680,556,852
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 61
| 0
|
n=int(input())
a=list(map(int, input().split()))
a.sort()
c=1
s=0
for i in range(1, n):
s+=a[i-1]
if a[i]>=s:
c+=1
print(c)
|
Title: Queue
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Susie went shopping with her mom and she wondered how to improve service quality.
There are *n* people in the queue. For each person we know time *t**i* needed to serve him. A person will be disappointed if the time he waits is more than the time needed to serve him. The time a person waits is the total time when all the people who stand in the queue in front of him are served. Susie thought that if we swap some people in the queue, then we can decrease the number of people who are disappointed.
Help Susie find out what is the maximum number of not disappointed people can be achieved by swapping people in the queue.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105).
The next line contains *n* integers *t**i* (1<=≤<=*t**i*<=≤<=109), separated by spaces.
Output Specification:
Print a single number — the maximum number of not disappointed people in the queue.
Demo Input:
['5\n15 2 1 5 3\n']
Demo Output:
['4\n']
Note:
Value 4 is achieved at such an arrangement, for example: 1, 2, 3, 5, 15. Thus, you can make everything feel not disappointed except for the person with time 5.
|
```python
n=int(input())
a=list(map(int, input().split()))
a.sort()
c=1
s=0
for i in range(1, n):
s+=a[i-1]
if a[i]>=s:
c+=1
print(c)
```
| 0
|
|
743
|
C
|
Vladik and fractions
|
PROGRAMMING
| 1,500
|
[
"brute force",
"constructive algorithms",
"math",
"number theory"
] | null | null |
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
|
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
|
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
|
[
"3\n",
"7\n"
] |
[
"2 7 42\n",
"7 8 56\n"
] |
none
| 1,250
|
[
{
"input": "3",
"output": "2 7 42"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "2",
"output": "2 3 6"
},
{
"input": "5",
"output": "5 6 30"
},
{
"input": "4",
"output": "4 5 20"
},
{
"input": "7",
"output": "7 8 56"
},
{
"input": "82",
"output": "82 83 6806"
},
{
"input": "56",
"output": "56 57 3192"
},
{
"input": "30",
"output": "30 31 930"
},
{
"input": "79",
"output": "79 80 6320"
},
{
"input": "28",
"output": "28 29 812"
},
{
"input": "4116",
"output": "4116 4117 16945572"
},
{
"input": "1",
"output": "-1"
},
{
"input": "6491",
"output": "6491 6492 42139572"
},
{
"input": "8865",
"output": "8865 8866 78597090"
},
{
"input": "1239",
"output": "1239 1240 1536360"
},
{
"input": "3614",
"output": "3614 3615 13064610"
},
{
"input": "5988",
"output": "5988 5989 35862132"
},
{
"input": "8363",
"output": "8363 8364 69948132"
},
{
"input": "737",
"output": "737 738 543906"
},
{
"input": "3112",
"output": "3112 3113 9687656"
},
{
"input": "9562",
"output": "9562 9563 91441406"
},
{
"input": "1936",
"output": "1936 1937 3750032"
},
{
"input": "4311",
"output": "4311 4312 18589032"
},
{
"input": "6685",
"output": "6685 6686 44695910"
},
{
"input": "9060",
"output": "9060 9061 82092660"
},
{
"input": "1434",
"output": "1434 1435 2057790"
},
{
"input": "3809",
"output": "3809 3810 14512290"
},
{
"input": "6183",
"output": "6183 6184 38235672"
},
{
"input": "8558",
"output": "8558 8559 73247922"
},
{
"input": "932",
"output": "932 933 869556"
},
{
"input": "7274",
"output": "7274 7275 52918350"
},
{
"input": "9648",
"output": "9648 9649 93093552"
},
{
"input": "2023",
"output": "2023 2024 4094552"
},
{
"input": "4397",
"output": "4397 4398 19338006"
},
{
"input": "6772",
"output": "6772 6773 45866756"
},
{
"input": "9146",
"output": "9146 9147 83658462"
},
{
"input": "1521",
"output": "1521 1522 2314962"
},
{
"input": "4938",
"output": "4938 4939 24388782"
},
{
"input": "6143",
"output": "6143 6144 37742592"
},
{
"input": "6230",
"output": "6230 6231 38819130"
},
{
"input": "10000",
"output": "10000 10001 100010000"
},
{
"input": "1",
"output": "-1"
},
{
"input": "101",
"output": "101 102 10302"
},
{
"input": "9999",
"output": "9999 10000 99990000"
},
{
"input": "512",
"output": "512 513 262656"
},
{
"input": "511",
"output": "511 512 261632"
},
{
"input": "513",
"output": "513 514 263682"
},
{
"input": "9973",
"output": "9973 9974 99470702"
},
{
"input": "9972",
"output": "9972 9973 99450756"
},
{
"input": "9974",
"output": "9974 9975 99490650"
},
{
"input": "9409",
"output": "9409 9410 88538690"
},
{
"input": "9408",
"output": "9408 9409 88519872"
},
{
"input": "9410",
"output": "9410 9411 88557510"
},
{
"input": "719",
"output": "719 720 517680"
},
{
"input": "720",
"output": "720 721 519120"
},
{
"input": "721",
"output": "721 722 520562"
},
{
"input": "9796",
"output": "9796 9797 95971412"
},
{
"input": "9797",
"output": "9797 9798 95991006"
},
{
"input": "9798",
"output": "9798 9799 96010602"
},
{
"input": "4999",
"output": "4999 5000 24995000"
},
{
"input": "9998",
"output": "9998 9999 99970002"
}
] | 1,667,892,575
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
# LUOGU_RID: 93256855
n=int(input())
if n=1
print(-1)
else:
print(n,n+1,n*(n+1))
|
Title: Vladik and fractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vladik and Chloe decided to determine who of them is better at math. Vladik claimed that for any positive integer *n* he can represent fraction as a sum of three distinct positive fractions in form .
Help Vladik with that, i.e for a given *n* find three distinct positive integers *x*, *y* and *z* such that . Because Chloe can't check Vladik's answer if the numbers are large, he asks you to print numbers not exceeding 109.
If there is no such answer, print -1.
Input Specification:
The single line contains single integer *n* (1<=≤<=*n*<=≤<=104).
Output Specification:
If the answer exists, print 3 distinct numbers *x*, *y* and *z* (1<=≤<=*x*,<=*y*,<=*z*<=≤<=109, *x*<=≠<=*y*, *x*<=≠<=*z*, *y*<=≠<=*z*). Otherwise print -1.
If there are multiple answers, print any of them.
Demo Input:
['3\n', '7\n']
Demo Output:
['2 7 42\n', '7 8 56\n']
Note:
none
|
```python
# LUOGU_RID: 93256855
n=int(input())
if n=1
print(-1)
else:
print(n,n+1,n*(n+1))
```
| -1
|
|
549
|
C
|
The Game Of Parity
|
PROGRAMMING
| 2,200
|
[
"games"
] | null | null |
There are *n* cities in Westeros. The *i*-th city is inhabited by *a**i* people. Daenerys and Stannis play the following game: in one single move, a player chooses a certain town and burns it to the ground. Thus all its residents, sadly, die. Stannis starts the game. The game ends when Westeros has exactly *k* cities left.
The prophecy says that if the total number of surviving residents is even, then Daenerys wins: Stannis gets beheaded, and Daenerys rises on the Iron Throne. If the total number of surviving residents is odd, Stannis wins and everything goes in the completely opposite way.
Lord Petyr Baelish wants to know which candidates to the throne he should support, and therefore he wonders, which one of them has a winning strategy. Answer to this question of Lord Baelish and maybe you will become the next Lord of Harrenholl.
|
The first line contains two positive space-separated integers, *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105) — the initial number of cities in Westeros and the number of cities at which the game ends.
The second line contains *n* space-separated positive integers *a**i* (1<=≤<=*a**i*<=≤<=106), which represent the population of each city in Westeros.
|
Print string "Daenerys" (without the quotes), if Daenerys wins and "Stannis" (without the quotes), if Stannis wins.
|
[
"3 1\n1 2 1\n",
"3 1\n2 2 1\n",
"6 3\n5 20 12 7 14 101\n"
] |
[
"Stannis\n",
"Daenerys\n",
"Stannis\n"
] |
In the first sample Stannis will use his move to burn a city with two people and Daenerys will be forced to burn a city with one resident. The only survivor city will have one resident left, that is, the total sum is odd, and thus Stannis wins.
In the second sample, if Stannis burns a city with two people, Daenerys burns the city with one resident, or vice versa. In any case, the last remaining city will be inhabited by two people, that is, the total sum is even, and hence Daenerys wins.
| 2,000
|
[
{
"input": "3 1\n1 2 1",
"output": "Stannis"
},
{
"input": "3 1\n2 2 1",
"output": "Daenerys"
},
{
"input": "6 3\n5 20 12 7 14 101",
"output": "Stannis"
},
{
"input": "6 3\n346 118 330 1403 5244 480",
"output": "Daenerys"
},
{
"input": "7 4\n11 3532 99 3512 12 8 22",
"output": "Stannis"
},
{
"input": "9 4\n2 6 8 1 2 4 2 8 2",
"output": "Daenerys"
},
{
"input": "8 2\n1 3 22 45 21 132 78 901",
"output": "Daenerys"
},
{
"input": "1 1\n912959",
"output": "Stannis"
},
{
"input": "1 1\n107540",
"output": "Daenerys"
},
{
"input": "2 2\n67427 727097",
"output": "Daenerys"
},
{
"input": "2 2\n346010 923112",
"output": "Daenerys"
},
{
"input": "2 2\n125572 610583",
"output": "Stannis"
},
{
"input": "3 3\n198331 216610 697947",
"output": "Daenerys"
},
{
"input": "3 3\n349371 489962 45420",
"output": "Stannis"
},
{
"input": "4 4\n194368 948570 852413 562719",
"output": "Daenerys"
},
{
"input": "3 3\n814664 27142 437959",
"output": "Stannis"
},
{
"input": "3 3\n767153 643472 154791",
"output": "Daenerys"
},
{
"input": "4 4\n391529 690539 830662 546622",
"output": "Daenerys"
},
{
"input": "4 1\n1 1 2 2",
"output": "Stannis"
},
{
"input": "2 2\n1 2",
"output": "Stannis"
},
{
"input": "4 4\n2 5 5 5",
"output": "Stannis"
}
] | 1,433,617,042
| 2,842
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 61
| 0
|
n,k = map(int,input().split())
a = list(map(int,input().split()))
moves = n - k
even,odd = 0,0
for i in a:
if i % 2 == 0:
even += 1
else:
odd += 1
sMoves = moves//2 if moves%2 == 0 else moves//2+1
dMoves = moves - sMoves
print('Stannis') if odd>sMoves else print('Daenerys')
|
Title: The Game Of Parity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities in Westeros. The *i*-th city is inhabited by *a**i* people. Daenerys and Stannis play the following game: in one single move, a player chooses a certain town and burns it to the ground. Thus all its residents, sadly, die. Stannis starts the game. The game ends when Westeros has exactly *k* cities left.
The prophecy says that if the total number of surviving residents is even, then Daenerys wins: Stannis gets beheaded, and Daenerys rises on the Iron Throne. If the total number of surviving residents is odd, Stannis wins and everything goes in the completely opposite way.
Lord Petyr Baelish wants to know which candidates to the throne he should support, and therefore he wonders, which one of them has a winning strategy. Answer to this question of Lord Baelish and maybe you will become the next Lord of Harrenholl.
Input Specification:
The first line contains two positive space-separated integers, *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=2·105) — the initial number of cities in Westeros and the number of cities at which the game ends.
The second line contains *n* space-separated positive integers *a**i* (1<=≤<=*a**i*<=≤<=106), which represent the population of each city in Westeros.
Output Specification:
Print string "Daenerys" (without the quotes), if Daenerys wins and "Stannis" (without the quotes), if Stannis wins.
Demo Input:
['3 1\n1 2 1\n', '3 1\n2 2 1\n', '6 3\n5 20 12 7 14 101\n']
Demo Output:
['Stannis\n', 'Daenerys\n', 'Stannis\n']
Note:
In the first sample Stannis will use his move to burn a city with two people and Daenerys will be forced to burn a city with one resident. The only survivor city will have one resident left, that is, the total sum is odd, and thus Stannis wins.
In the second sample, if Stannis burns a city with two people, Daenerys burns the city with one resident, or vice versa. In any case, the last remaining city will be inhabited by two people, that is, the total sum is even, and hence Daenerys wins.
|
```python
n,k = map(int,input().split())
a = list(map(int,input().split()))
moves = n - k
even,odd = 0,0
for i in a:
if i % 2 == 0:
even += 1
else:
odd += 1
sMoves = moves//2 if moves%2 == 0 else moves//2+1
dMoves = moves - sMoves
print('Stannis') if odd>sMoves else print('Daenerys')
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Julia is going to cook a chicken in the kitchen of her dormitory. To save energy, the stove in the kitchen automatically turns off after *k* minutes after turning on.
During cooking, Julia goes to the kitchen every *d* minutes and turns on the stove if it is turned off. While the cooker is turned off, it stays warm. The stove switches on and off instantly.
It is known that the chicken needs *t* minutes to be cooked on the stove, if it is turned on, and 2*t* minutes, if it is turned off. You need to find out, how much time will Julia have to cook the chicken, if it is considered that the chicken is cooked evenly, with constant speed when the stove is turned on and at a constant speed when it is turned off.
|
The single line contains three integers *k*, *d* and *t* (1<=≤<=*k*,<=*d*,<=*t*<=≤<=1018).
|
Print a single number, the total time of cooking in minutes. The relative or absolute error must not exceed 10<=-<=9.
Namely, let's assume that your answer is *x* and the answer of the jury is *y*. The checker program will consider your answer correct if .
|
[
"3 2 6\n",
"4 2 20\n"
] |
[
"6.5\n",
"20.0\n"
] |
In the first example, the chicken will be cooked for 3 minutes on the turned on stove, after this it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cce5d3f2f46552034d5ae5d487725705429ec7a5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Then the chicken will be cooked for one minute on a turned off stove, it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a10fa55d1324328f9ba60c9343ed0ecb0506d678.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Thus, after four minutes the chicken will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6fcc8bd6c2188b260d9d18e7b6c9e3908848df71.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Before the fifth minute Julia will turn on the stove and after 2.5 minutes the chicken will be ready <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/87a86c8e9632089279245fff912c077126c4e704.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second example, when the stove is turned off, Julia will immediately turn it on, so the stove will always be turned on and the chicken will be cooked in 20 minutes.
| 0
|
[
{
"input": "3 2 6",
"output": "6.5"
},
{
"input": "4 2 20",
"output": "20.0"
},
{
"input": "8 10 9",
"output": "10.0"
},
{
"input": "43 50 140",
"output": "150.5"
},
{
"input": "251 79 76",
"output": "76.0"
},
{
"input": "892 67 1000",
"output": "1023.0"
},
{
"input": "1000 1000 1000",
"output": "1000.0"
},
{
"input": "87 4 1000",
"output": "1005.5"
},
{
"input": "1 629 384378949109878497",
"output": "767537647587662141"
},
{
"input": "2124 6621 12695",
"output": "19018"
},
{
"input": "27548 68747 111",
"output": "111.0"
},
{
"input": "74974 46016 1000000000",
"output": "1102134775.0"
},
{
"input": "223 844 704",
"output": "1014.5"
},
{
"input": "1 558 743",
"output": "1483"
},
{
"input": "43 387 402",
"output": "718"
},
{
"input": "972 2 763",
"output": "763.0"
},
{
"input": "330 167 15",
"output": "15.0"
},
{
"input": "387 43 650",
"output": "650.0"
},
{
"input": "1 314 824",
"output": "1642"
},
{
"input": "2 4 18",
"output": "24.0"
},
{
"input": "3 5 127",
"output": "158.0"
},
{
"input": "3260 4439 6837",
"output": "7426.5"
},
{
"input": "3950 7386 195",
"output": "195.0"
},
{
"input": "18036 47899 1000000000",
"output": "1452914012"
},
{
"input": "29 46 1000000000",
"output": "1226666661.0"
},
{
"input": "403 957 1000000000000000000",
"output": "1407352941176470446"
},
{
"input": "999999999999999999 1000000000000000000 1000000000000000000",
"output": "1000000000000000000.5"
},
{
"input": "9 1000000000000000000 1000000000000000000",
"output": "1999999999999999982"
},
{
"input": "1 2 1000000000000000000",
"output": "1333333333333333333.0"
},
{
"input": "2 5 1000000000000000000",
"output": "1428571428571428571.0"
},
{
"input": "81413279254461199 310548139128293806 1000000000000000000",
"output": "1572837149684581517.5"
},
{
"input": "6 3 417701740543616353",
"output": "417701740543616353.0"
},
{
"input": "17 68 4913",
"output": "7854"
},
{
"input": "68 17 4913",
"output": "4913.0"
},
{
"input": "121 395 621154158314692955",
"output": "950991831528308936"
},
{
"input": "897 443 134730567336441375",
"output": "160877739434079591.0"
},
{
"input": "200 10 979220166595737684",
"output": "979220166595737684.0"
},
{
"input": "740 251 930540301905511549",
"output": "938642796161889076.5"
},
{
"input": "4 232 801899894850800409",
"output": "1576616742418522838"
},
{
"input": "472 499 166288453006087540",
"output": "170912333779686266.5"
},
{
"input": "42 9 1000000000000000000",
"output": "1034482758620689654.0"
},
{
"input": "312 93 1000000000000000000",
"output": "1087719298245614020.0"
},
{
"input": "1000 1000 1000000000000000000",
"output": "1000000000000000000.0"
},
{
"input": "6000 1000 1000000000",
"output": "1000000000.0"
},
{
"input": "9999999999 33333 1000000000",
"output": "1000000000.0"
},
{
"input": "33333 9999999999 1000000000",
"output": "1999966667"
},
{
"input": "25441360464 2658201820 1000000000",
"output": "1000000000.0"
},
{
"input": "20958318104 46685 253251869",
"output": "253251869.0"
},
{
"input": "963276084 698548036 1000000000",
"output": "1036723916"
},
{
"input": "574520976350867177 413897686591532160 1000000000000000000",
"output": "1126637198416098571.5"
},
{
"input": "575556838390916379 15 1000000000000000000",
"output": "1000000000000000003.0"
},
{
"input": "1000000000000000000 1000000000000000000 1000000000000000000",
"output": "1000000000000000000.0"
},
{
"input": "1 1000000000000000000 1000000000000000000",
"output": "1999999999999999998"
},
{
"input": "8 1000000000000000000 1000000000000000000",
"output": "1999999999999999984"
},
{
"input": "1 976958144546785462 1000000000000000000",
"output": "1999999999999999997"
},
{
"input": "3 10 1000000000000000000",
"output": "1538461538461538461.0"
},
{
"input": "312200625484460654 543737694709247394 1000000000000000000",
"output": "1231537069224786740.0"
},
{
"input": "2 99 53",
"output": "102"
},
{
"input": "900000000000000000 1 1234",
"output": "1234.0"
}
] | 1,527,260,786
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 59
| 78
| 0
|
k,d,t=input().split()
k,d,t=int(k),int(d),int(t)
on=k
off=d-(k-1)%d-1
cycle=on+off/2
time=(on+off)*(t//cycle)
t-=cycle*(t//cycle)
if t<k:
print(t+time)
else:
print(time+k+(t-k)*2)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Julia is going to cook a chicken in the kitchen of her dormitory. To save energy, the stove in the kitchen automatically turns off after *k* minutes after turning on.
During cooking, Julia goes to the kitchen every *d* minutes and turns on the stove if it is turned off. While the cooker is turned off, it stays warm. The stove switches on and off instantly.
It is known that the chicken needs *t* minutes to be cooked on the stove, if it is turned on, and 2*t* minutes, if it is turned off. You need to find out, how much time will Julia have to cook the chicken, if it is considered that the chicken is cooked evenly, with constant speed when the stove is turned on and at a constant speed when it is turned off.
Input Specification:
The single line contains three integers *k*, *d* and *t* (1<=≤<=*k*,<=*d*,<=*t*<=≤<=1018).
Output Specification:
Print a single number, the total time of cooking in minutes. The relative or absolute error must not exceed 10<=-<=9.
Namely, let's assume that your answer is *x* and the answer of the jury is *y*. The checker program will consider your answer correct if .
Demo Input:
['3 2 6\n', '4 2 20\n']
Demo Output:
['6.5\n', '20.0\n']
Note:
In the first example, the chicken will be cooked for 3 minutes on the turned on stove, after this it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cce5d3f2f46552034d5ae5d487725705429ec7a5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Then the chicken will be cooked for one minute on a turned off stove, it will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/a10fa55d1324328f9ba60c9343ed0ecb0506d678.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Thus, after four minutes the chicken will be cooked for <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/6fcc8bd6c2188b260d9d18e7b6c9e3908848df71.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Before the fifth minute Julia will turn on the stove and after 2.5 minutes the chicken will be ready <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/87a86c8e9632089279245fff912c077126c4e704.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second example, when the stove is turned off, Julia will immediately turn it on, so the stove will always be turned on and the chicken will be cooked in 20 minutes.
|
```python
k,d,t=input().split()
k,d,t=int(k),int(d),int(t)
on=k
off=d-(k-1)%d-1
cycle=on+off/2
time=(on+off)*(t//cycle)
t-=cycle*(t//cycle)
if t<k:
print(t+time)
else:
print(time+k+(t-k)*2)
```
| 3
|
|
237
|
A
|
Free Cash
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
|
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
|
[
"4\n8 0\n8 10\n8 10\n8 45\n",
"3\n0 12\n10 11\n22 22\n"
] |
[
"2\n",
"1\n"
] |
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash.
| 500
|
[
{
"input": "4\n8 0\n8 10\n8 10\n8 45",
"output": "2"
},
{
"input": "3\n0 12\n10 11\n22 22",
"output": "1"
},
{
"input": "5\n12 8\n15 27\n15 27\n16 2\n19 52",
"output": "2"
},
{
"input": "7\n5 6\n7 34\n7 34\n7 34\n12 29\n15 19\n20 23",
"output": "3"
},
{
"input": "8\n0 36\n4 7\n4 7\n4 7\n11 46\n12 4\n15 39\n18 6",
"output": "3"
},
{
"input": "20\n4 12\n4 21\n4 27\n4 56\n5 55\n7 56\n11 28\n11 36\n14 58\n15 59\n16 8\n17 12\n17 23\n17 23\n17 23\n17 23\n17 23\n17 23\n20 50\n22 32",
"output": "6"
},
{
"input": "10\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30",
"output": "10"
},
{
"input": "50\n0 23\n1 21\n2 8\n2 45\n3 1\n4 19\n4 37\n7 7\n7 40\n8 43\n9 51\n10 13\n11 2\n11 19\n11 30\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 54\n13 32\n13 42\n14 29\n14 34\n14 48\n15 0\n15 27\n16 22\n16 31\n17 25\n17 26\n17 33\n18 14\n18 16\n18 20\n19 0\n19 5\n19 56\n20 22\n21 26\n22 0\n22 10\n22 11\n22 36\n23 17\n23 20",
"output": "8"
},
{
"input": "10\n0 39\n1 35\n1 49\n1 51\n5 24\n7 40\n7 56\n16 42\n23 33\n23 49",
"output": "1"
},
{
"input": "15\n0 16\n6 15\n8 2\n8 6\n8 7\n10 1\n10 1\n10 3\n10 12\n13 5\n14 16\n14 16\n14 16\n14 16\n14 16",
"output": "5"
},
{
"input": "2\n0 24\n1 0",
"output": "1"
},
{
"input": "1\n0 0",
"output": "1"
},
{
"input": "1\n1 5",
"output": "1"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "3"
},
{
"input": "1\n5 0",
"output": "1"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "5"
},
{
"input": "1\n10 10",
"output": "1"
},
{
"input": "1\n8 0",
"output": "1"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "10"
},
{
"input": "2\n0 0\n0 1",
"output": "1"
},
{
"input": "2\n8 5\n8 5",
"output": "2"
}
] | 1,596,992,991
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 186
| 6,656,000
|
n = int(input())
ss = set()
ans = 1
for i in range(n):
k,p = map(int,input().split())
ss.add(str(k)+":"+str(p))
print(n- len(ss) + 1)
|
Title: Free Cash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
Output Specification:
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
Demo Input:
['4\n8 0\n8 10\n8 10\n8 45\n', '3\n0 12\n10 11\n22 22\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash.
|
```python
n = int(input())
ss = set()
ans = 1
for i in range(n):
k,p = map(int,input().split())
ss.add(str(k)+":"+str(p))
print(n- len(ss) + 1)
```
| 0
|
|
699
|
A
|
Launch of Collider
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
There will be a launch of a new, powerful and unusual collider very soon, which located along a straight line. *n* particles will be launched inside it. All of them are located in a straight line and there can not be two or more particles located in the same point. The coordinates of the particles coincide with the distance in meters from the center of the collider, *x**i* is the coordinate of the *i*-th particle and its position in the collider at the same time. All coordinates of particle positions are even integers.
You know the direction of each particle movement — it will move to the right or to the left after the collider's launch start. All particles begin to move simultaneously at the time of the collider's launch start. Each particle will move straight to the left or straight to the right with the constant speed of 1 meter per microsecond. The collider is big enough so particles can not leave it in the foreseeable time.
Write the program which finds the moment of the first collision of any two particles of the collider. In other words, find the number of microseconds before the first moment when any two particles are at the same point.
|
The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of particles.
The second line contains *n* symbols "L" and "R". If the *i*-th symbol equals "L", then the *i*-th particle will move to the left, otherwise the *i*-th symbol equals "R" and the *i*-th particle will move to the right.
The third line contains the sequence of pairwise distinct even integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=109) — the coordinates of particles in the order from the left to the right. It is guaranteed that the coordinates of particles are given in the increasing order.
|
In the first line print the only integer — the first moment (in microseconds) when two particles are at the same point and there will be an explosion.
Print the only integer -1, if the collision of particles doesn't happen.
|
[
"4\nRLRL\n2 4 6 10\n",
"3\nLLR\n40 50 60\n"
] |
[
"1\n",
"-1\n"
] |
In the first sample case the first explosion will happen in 1 microsecond because the particles number 1 and 2 will simultaneously be at the same point with the coordinate 3.
In the second sample case there will be no explosion because there are no particles which will simultaneously be at the same point.
| 500
|
[
{
"input": "4\nRLRL\n2 4 6 10",
"output": "1"
},
{
"input": "3\nLLR\n40 50 60",
"output": "-1"
},
{
"input": "4\nRLLR\n46 230 264 470",
"output": "92"
},
{
"input": "6\nLLRLLL\n446 492 650 844 930 970",
"output": "97"
},
{
"input": "8\nRRLLLLLL\n338 478 512 574 594 622 834 922",
"output": "17"
},
{
"input": "10\nLRLRLLRRLR\n82 268 430 598 604 658 670 788 838 1000",
"output": "3"
},
{
"input": "2\nRL\n0 1000000000",
"output": "500000000"
},
{
"input": "12\nLRLLRRRRLRLL\n254 1260 1476 1768 2924 4126 4150 4602 5578 7142 8134 9082",
"output": "108"
},
{
"input": "14\nRLLRRLRLLRLLLR\n698 2900 3476 3724 3772 3948 4320 4798 5680 6578 7754 8034 8300 8418",
"output": "88"
},
{
"input": "16\nRRLLLRLRLLLLRLLR\n222 306 968 1060 1636 1782 2314 2710 3728 4608 5088 6790 6910 7156 7418 7668",
"output": "123"
},
{
"input": "18\nRLRLLRRRLLLRLRRLRL\n1692 2028 2966 3008 3632 4890 5124 5838 6596 6598 6890 8294 8314 8752 8868 9396 9616 9808",
"output": "10"
},
{
"input": "20\nRLLLLLLLRRRRLRRLRRLR\n380 902 1400 1834 2180 2366 2562 2596 2702 2816 3222 3238 3742 5434 6480 7220 7410 8752 9708 9970",
"output": "252"
},
{
"input": "22\nLRRRRRRRRRRRLLRRRRRLRL\n1790 2150 2178 2456 2736 3282 3622 4114 4490 4772 5204 5240 5720 5840 5910 5912 6586 7920 8584 9404 9734 9830",
"output": "48"
},
{
"input": "24\nLLRLRRLLRLRRRRLLRRLRLRRL\n100 360 864 1078 1360 1384 1438 2320 2618 3074 3874 3916 3964 5178 5578 6278 6630 6992 8648 8738 8922 8930 9276 9720",
"output": "27"
},
{
"input": "26\nRLLLLLLLRLRRLRLRLRLRLLLRRR\n908 1826 2472 2474 2728 3654 3716 3718 3810 3928 4058 4418 4700 5024 5768 6006 6128 6386 6968 7040 7452 7774 7822 8726 9338 9402",
"output": "59"
},
{
"input": "28\nRRLRLRRRRRRLLLRRLRRLLLRRLLLR\n156 172 1120 1362 2512 3326 3718 4804 4990 5810 6242 6756 6812 6890 6974 7014 7088 7724 8136 8596 8770 8840 9244 9250 9270 9372 9400 9626",
"output": "10"
},
{
"input": "30\nRLLRLRLLRRRLRRRLLLLLLRRRLRRLRL\n128 610 1680 2436 2896 2994 3008 3358 3392 4020 4298 4582 4712 4728 5136 5900 6088 6232 6282 6858 6934 7186 7224 7256 7614 8802 8872 9170 9384 9794",
"output": "7"
},
{
"input": "10\nLLLLRRRRRR\n0 2 4 6 8 10 12 14 16 18",
"output": "-1"
},
{
"input": "5\nLLLLL\n0 10 20 30 40",
"output": "-1"
},
{
"input": "6\nRRRRRR\n40 50 60 70 80 100",
"output": "-1"
},
{
"input": "1\nR\n0",
"output": "-1"
},
{
"input": "2\nRL\n2 1000000000",
"output": "499999999"
},
{
"input": "2\nRL\n0 400000",
"output": "200000"
},
{
"input": "2\nRL\n0 200002",
"output": "100001"
},
{
"input": "2\nRL\n2 20000000",
"output": "9999999"
},
{
"input": "4\nLLRL\n2 4 10 100",
"output": "45"
},
{
"input": "4\nRLRL\n2 10 12 14",
"output": "1"
},
{
"input": "2\nRL\n0 100000000",
"output": "50000000"
},
{
"input": "2\nRL\n2 600002",
"output": "300000"
},
{
"input": "1\nL\n0",
"output": "-1"
},
{
"input": "2\nRL\n0 600000",
"output": "300000"
},
{
"input": "5\nRRRRR\n0 2 4 6 8",
"output": "-1"
},
{
"input": "2\nRL\n2 200000000",
"output": "99999999"
},
{
"input": "2\nRL\n0 267382766",
"output": "133691383"
},
{
"input": "3\nRRL\n4 8 999999998",
"output": "499999995"
},
{
"input": "2\nRL\n0 2",
"output": "1"
},
{
"input": "2\nRL\n2 400002",
"output": "200000"
},
{
"input": "2\nLL\n2 4",
"output": "-1"
},
{
"input": "2\nLL\n0 2",
"output": "-1"
},
{
"input": "2\nRL\n0 100000",
"output": "50000"
},
{
"input": "2\nRL\n2 200000020",
"output": "100000009"
},
{
"input": "2\nRL\n2000000 4000000",
"output": "1000000"
},
{
"input": "2\nRL\n0 199998",
"output": "99999"
},
{
"input": "3\nLRR\n40 50 60",
"output": "-1"
},
{
"input": "2\nRL\n200 400400",
"output": "200100"
},
{
"input": "2\nRL\n2 400004",
"output": "200001"
},
{
"input": "2\nRL\n0 200000000",
"output": "100000000"
}
] | 1,654,585,437
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 46
| 0
|
n=int(input())
string=input()
lst=list(map(int,input().split()))
stack=[]
cnt=0
for i in range(n):
if stack and stack[-1]=='R' and string[i]=='L':
print((lst[i]-lst[i-1])//2)
exit()
else:
stack.append(string[i])
cnt+=1
print(-1)
|
Title: Launch of Collider
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There will be a launch of a new, powerful and unusual collider very soon, which located along a straight line. *n* particles will be launched inside it. All of them are located in a straight line and there can not be two or more particles located in the same point. The coordinates of the particles coincide with the distance in meters from the center of the collider, *x**i* is the coordinate of the *i*-th particle and its position in the collider at the same time. All coordinates of particle positions are even integers.
You know the direction of each particle movement — it will move to the right or to the left after the collider's launch start. All particles begin to move simultaneously at the time of the collider's launch start. Each particle will move straight to the left or straight to the right with the constant speed of 1 meter per microsecond. The collider is big enough so particles can not leave it in the foreseeable time.
Write the program which finds the moment of the first collision of any two particles of the collider. In other words, find the number of microseconds before the first moment when any two particles are at the same point.
Input Specification:
The first line contains the positive integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of particles.
The second line contains *n* symbols "L" and "R". If the *i*-th symbol equals "L", then the *i*-th particle will move to the left, otherwise the *i*-th symbol equals "R" and the *i*-th particle will move to the right.
The third line contains the sequence of pairwise distinct even integers *x*1,<=*x*2,<=...,<=*x**n* (0<=≤<=*x**i*<=≤<=109) — the coordinates of particles in the order from the left to the right. It is guaranteed that the coordinates of particles are given in the increasing order.
Output Specification:
In the first line print the only integer — the first moment (in microseconds) when two particles are at the same point and there will be an explosion.
Print the only integer -1, if the collision of particles doesn't happen.
Demo Input:
['4\nRLRL\n2 4 6 10\n', '3\nLLR\n40 50 60\n']
Demo Output:
['1\n', '-1\n']
Note:
In the first sample case the first explosion will happen in 1 microsecond because the particles number 1 and 2 will simultaneously be at the same point with the coordinate 3.
In the second sample case there will be no explosion because there are no particles which will simultaneously be at the same point.
|
```python
n=int(input())
string=input()
lst=list(map(int,input().split()))
stack=[]
cnt=0
for i in range(n):
if stack and stack[-1]=='R' and string[i]=='L':
print((lst[i]-lst[i-1])//2)
exit()
else:
stack.append(string[i])
cnt+=1
print(-1)
```
| 0
|
|
277
|
A
|
Learning Languages
|
PROGRAMMING
| 1,400
|
[
"dfs and similar",
"dsu"
] | null | null |
The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar.
Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating).
|
The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages.
Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages.
The numbers in the lines are separated by single spaces.
|
Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating).
|
[
"5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n",
"8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n",
"2 2\n1 2\n0\n"
] |
[
"0\n",
"2\n",
"1\n"
] |
In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4.
In the third sample employee 2 must learn language 2.
| 500
|
[
{
"input": "5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5",
"output": "0"
},
{
"input": "8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1",
"output": "2"
},
{
"input": "2 2\n1 2\n0",
"output": "1"
},
{
"input": "2 2\n0\n0",
"output": "2"
},
{
"input": "5 5\n1 3\n0\n0\n2 4 1\n0",
"output": "4"
},
{
"input": "6 2\n0\n0\n2 1 2\n1 1\n1 1\n0",
"output": "3"
},
{
"input": "7 3\n3 1 3 2\n3 2 1 3\n2 2 3\n1 1\n2 2 3\n3 3 2 1\n3 2 3 1",
"output": "0"
},
{
"input": "8 4\n0\n0\n4 2 3 1 4\n4 2 1 4 3\n3 4 3 1\n1 2\n2 4 1\n2 4 2",
"output": "2"
},
{
"input": "10 10\n5 7 5 2 8 1\n7 10 6 9 5 8 2 4\n2 2 7\n5 8 6 9 10 1\n2 9 5\n3 6 5 2\n6 5 8 7 9 10 4\n0\n1 1\n2 8 6",
"output": "1"
},
{
"input": "11 42\n4 20 26 9 24\n14 34 7 28 32 12 15 26 4 10 38 21 20 8 11\n4 21 8 36 6\n11 32 1 39 11 21 10 25 17 26 15 4\n2 8 12\n2 21 31\n8 17 10 3 39 32 30 5 15\n20 24 20 38 17 4 7 21 19 32 28 31 22 30 37 10 5 33 2 13 9\n7 38 34 42 27 20 11 6\n3 40 3 39\n14 39 40 4 30 33 8 36 28 14 23 16 7 25 9",
"output": "0"
},
{
"input": "100 100\n1 33\n0\n2 35 4\n2 40 78\n1 69\n0\n1 2\n0\n0\n2 81 34\n1 45\n0\n1 87\n1 50\n1 97\n0\n2 100 59\n0\n0\n0\n1 45\n0\n0\n0\n1 6\n1 54\n0\n0\n0\n4 79 96 52 84\n1 86\n0\n0\n0\n0\n0\n0\n0\n0\n3 90 2 80\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1 2\n0\n1 64\n0\n1 78\n1 82\n0\n0\n0\n0\n0\n1 6\n0\n0\n2 47 57\n1 95\n0\n2 91 79\n0\n1 27\n0\n1 74\n0\n0\n1 14\n0\n0\n2 90 19\n0\n1 10\n0\n0\n0\n0\n0\n1 57\n0\n2 28 50\n0\n0\n0\n1 47\n0\n0\n1 14\n0\n1 84\n1 1\n0\n0",
"output": "87"
},
{
"input": "2 2\n2 1 2\n2 1 2",
"output": "0"
},
{
"input": "2 2\n2 1 2\n1 1",
"output": "0"
},
{
"input": "2 2\n1 2\n1 1",
"output": "1"
},
{
"input": "3 100\n0\n0\n0",
"output": "3"
},
{
"input": "100 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "100"
},
{
"input": "3 3\n0\n0\n0",
"output": "3"
}
] | 1,678,125,346
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 62
| 0
|
from collections import defaultdict
# function to do depth first search
def dfs(node, visited, adj_list):
visited[node] = True
for neighbor in adj_list[node]:
if not visited[neighbor]:
dfs(neighbor, visited, adj_list)
# read input values
n, m = map(int, input().split())
# create adjacency list
adj_list = defaultdict(list)
for i in range(n):
lang_list = list(map(int, input().split()))[1:]
for lang in lang_list:
adj_list[lang].append(i)
# count number of components using depth first search
visited = [False] * n
num_components = 0
for i in range(n):
if not visited[i]:
num_components += 1
dfs(i, visited, adj_list)
# subtract 1 because we assume everyone already knows their native language
if num_components == 1:
print(num_components)
else:
print(num_components - 1)
|
Title: Learning Languages
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The "BerCorp" company has got *n* employees. These employees can use *m* approved official languages for the formal correspondence. The languages are numbered with integers from 1 to *m*. For each employee we have the list of languages, which he knows. This list could be empty, i. e. an employee may know no official languages. But the employees are willing to learn any number of official languages, as long as the company pays their lessons. A study course in one language for one employee costs 1 berdollar.
Find the minimum sum of money the company needs to spend so as any employee could correspond to any other one (their correspondence can be indirect, i. e. other employees can help out translating).
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=100) — the number of employees and the number of languages.
Then *n* lines follow — each employee's language list. At the beginning of the *i*-th line is integer *k**i* (0<=≤<=*k**i*<=≤<=*m*) — the number of languages the *i*-th employee knows. Next, the *i*-th line contains *k**i* integers — *a**ij* (1<=≤<=*a**ij*<=≤<=*m*) — the identifiers of languages the *i*-th employee knows. It is guaranteed that all the identifiers in one list are distinct. Note that an employee may know zero languages.
The numbers in the lines are separated by single spaces.
Output Specification:
Print a single integer — the minimum amount of money to pay so that in the end every employee could write a letter to every other one (other employees can help out translating).
Demo Input:
['5 5\n1 2\n2 2 3\n2 3 4\n2 4 5\n1 5\n', '8 7\n0\n3 1 2 3\n1 1\n2 5 4\n2 6 7\n1 3\n2 7 4\n1 1\n', '2 2\n1 2\n0\n']
Demo Output:
['0\n', '2\n', '1\n']
Note:
In the second sample the employee 1 can learn language 2, and employee 8 can learn language 4.
In the third sample employee 2 must learn language 2.
|
```python
from collections import defaultdict
# function to do depth first search
def dfs(node, visited, adj_list):
visited[node] = True
for neighbor in adj_list[node]:
if not visited[neighbor]:
dfs(neighbor, visited, adj_list)
# read input values
n, m = map(int, input().split())
# create adjacency list
adj_list = defaultdict(list)
for i in range(n):
lang_list = list(map(int, input().split()))[1:]
for lang in lang_list:
adj_list[lang].append(i)
# count number of components using depth first search
visited = [False] * n
num_components = 0
for i in range(n):
if not visited[i]:
num_components += 1
dfs(i, visited, adj_list)
# subtract 1 because we assume everyone already knows their native language
if num_components == 1:
print(num_components)
else:
print(num_components - 1)
```
| 0
|
|
75
|
A
|
Life Without Zeros
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Life Without Zeros
|
2
|
256
|
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
|
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
|
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
|
[
"101\n102\n",
"105\n106\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "101\n102",
"output": "YES"
},
{
"input": "105\n106",
"output": "NO"
},
{
"input": "544\n397",
"output": "YES"
},
{
"input": "822\n280",
"output": "NO"
},
{
"input": "101\n413",
"output": "NO"
},
{
"input": "309\n139",
"output": "NO"
},
{
"input": "693\n970",
"output": "NO"
},
{
"input": "981\n1",
"output": "YES"
},
{
"input": "352\n276",
"output": "YES"
},
{
"input": "164\n691",
"output": "YES"
},
{
"input": "110036\n43",
"output": "YES"
},
{
"input": "100\n1000",
"output": "NO"
},
{
"input": "1000000000\n1000000000",
"output": "YES"
},
{
"input": "999999999\n999999999",
"output": "YES"
},
{
"input": "6\n4",
"output": "NO"
},
{
"input": "123456\n876543",
"output": "YES"
},
{
"input": "1234567\n9876543",
"output": "NO"
},
{
"input": "1111111\n1119111",
"output": "NO"
},
{
"input": "10502405\n40403403",
"output": "YES"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "5\n4",
"output": "YES"
},
{
"input": "1\n6",
"output": "YES"
},
{
"input": "40\n17",
"output": "NO"
},
{
"input": "35\n81",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "2081\n7450",
"output": "NO"
},
{
"input": "84355694\n373629503",
"output": "NO"
},
{
"input": "885992048\n510468672",
"output": "NO"
},
{
"input": "540144752\n647307841",
"output": "NO"
},
{
"input": "341781108\n784147010",
"output": "NO"
},
{
"input": "960440938\n572334653",
"output": "NO"
},
{
"input": "657414510\n768771903",
"output": "NO"
},
{
"input": "501871728\n725074574",
"output": "NO"
},
{
"input": "968\n851",
"output": "YES"
},
{
"input": "943\n939",
"output": "YES"
},
{
"input": "347\n908",
"output": "NO"
},
{
"input": "611\n41",
"output": "YES"
},
{
"input": "737\n289",
"output": "NO"
},
{
"input": "168\n571",
"output": "YES"
},
{
"input": "868\n463",
"output": "YES"
},
{
"input": "815732007\n913882008",
"output": "NO"
},
{
"input": "459039901\n453033850",
"output": "NO"
},
{
"input": "975305404\n484601256",
"output": "NO"
}
] | 1,534,888,032
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 43
| 218
| 0
|
n = input()
m = input()
s1 = int(n) + int(m)
s = str(s1)
s = s.replace('0','')
n = n.replace('0','')
m = m.replace('0','')
k = int(n) + int(m)
if(int(k)==int(s)):
print("YES")
else:
print("NO")
# 1534888106664
|
Title: Life Without Zeros
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Can you imagine our life if we removed all zeros from it? For sure we will have many problems.
In this problem we will have a simple example if we removed all zeros from our life, it's the addition operation. Let's assume you are given this equation *a*<=+<=*b*<==<=*c*, where *a* and *b* are positive integers, and *c* is the sum of *a* and *b*. Now let's remove all zeros from this equation. Will the equation remain correct after removing all zeros?
For example if the equation is 101<=+<=102<==<=203, if we removed all zeros it will be 11<=+<=12<==<=23 which is still a correct equation.
But if the equation is 105<=+<=106<==<=211, if we removed all zeros it will be 15<=+<=16<==<=211 which is not a correct equation.
Input Specification:
The input will consist of two lines, the first line will contain the integer *a*, and the second line will contain the integer *b* which are in the equation as described above (1<=≤<=*a*,<=*b*<=≤<=109). There won't be any leading zeros in both. The value of *c* should be calculated as *c*<==<=*a*<=+<=*b*.
Output Specification:
The output will be just one line, you should print "YES" if the equation will remain correct after removing all zeros, and print "NO" otherwise.
Demo Input:
['101\n102\n', '105\n106\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
n = input()
m = input()
s1 = int(n) + int(m)
s = str(s1)
s = s.replace('0','')
n = n.replace('0','')
m = m.replace('0','')
k = int(n) + int(m)
if(int(k)==int(s)):
print("YES")
else:
print("NO")
# 1534888106664
```
| 3.9455
|
992
|
A
|
Nastya and an Array
|
PROGRAMMING
| 800
|
[
"implementation",
"sortings"
] | null | null |
Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties:
- In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes.
Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array.
|
Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero.
|
[
"5\n1 1 1 1 1\n",
"3\n2 0 -1\n",
"4\n5 -6 -5 1\n"
] |
[
"1\n",
"2\n",
"4\n"
] |
In the first example you can add - 1 to all non-zero elements in one second and make them equal to zero.
In the second example you can add - 2 on the first second, then the array becomes equal to [0, 0, - 3]. On the second second you can add 3 to the third (the only non-zero) element.
| 500
|
[
{
"input": "5\n1 1 1 1 1",
"output": "1"
},
{
"input": "3\n2 0 -1",
"output": "2"
},
{
"input": "4\n5 -6 -5 1",
"output": "4"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "2\n21794 -79194",
"output": "2"
},
{
"input": "3\n-63526 95085 -5239",
"output": "3"
},
{
"input": "3\n0 53372 -20572",
"output": "2"
},
{
"input": "13\n-2075 -32242 27034 -37618 -96962 82203 64846 48249 -71761 28908 -21222 -61370 46899",
"output": "13"
},
{
"input": "5\n806 0 1308 1954 683",
"output": "4"
},
{
"input": "8\n-26 0 -249 -289 -126 -206 288 -11",
"output": "7"
},
{
"input": "10\n2 2 2 1 2 -1 0 2 -1 1",
"output": "3"
},
{
"input": "1\n8",
"output": "1"
},
{
"input": "3\n0 0 0",
"output": "0"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "10"
},
{
"input": "5\n2 0 -1 0 0",
"output": "2"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "5\n0 0 0 0 0",
"output": "0"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n-1 0",
"output": "1"
},
{
"input": "4\n0 0 0 0",
"output": "0"
},
{
"input": "8\n10 9 -1 0 0 3 2 3",
"output": "5"
},
{
"input": "5\n5 0 1 2 3",
"output": "4"
},
{
"input": "3\n1 1 0",
"output": "1"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "5\n1 2 0 0 0",
"output": "2"
},
{
"input": "5\n1 0 0 0 0",
"output": "1"
},
{
"input": "5\n4 5 6 0 0",
"output": "3"
},
{
"input": "4\n-1 0 0 1",
"output": "2"
},
{
"input": "5\n3 0 0 4 5",
"output": "3"
},
{
"input": "3\n0 0 2",
"output": "1"
},
{
"input": "3\n1 0 0",
"output": "1"
},
{
"input": "4\n0 0 0 4",
"output": "1"
},
{
"input": "5\n-1 0 0 0 0",
"output": "1"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "10\n0 0 0 0 0 1 2 3 0 0",
"output": "3"
},
{
"input": "4\n0 1 2 3",
"output": "3"
},
{
"input": "3\n0 1 2",
"output": "2"
},
{
"input": "4\n2 0 0 -1",
"output": "2"
}
] | 1,534,962,160
| 520
|
Python 3
|
OK
|
TESTS
| 79
| 186
| 8,908,800
|
from collections import Counter
n = int(input())
arr = [int(x) for x in input().split()]
count = Counter(arr)
if 0 in arr:
print(len(count) - 1)
else:
print(len(count))
|
Title: Nastya and an Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nastya owns too many arrays now, so she wants to delete the least important of them. However, she discovered that this array is magic! Nastya now knows that the array has the following properties:
- In one second we can add an arbitrary (possibly negative) integer to all elements of the array that are not equal to zero. - When all elements of the array become equal to zero, the array explodes.
Nastya is always busy, so she wants to explode the array as fast as possible. Compute the minimum time in which the array can be exploded.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105) — the size of the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=105<=≤<=*a**i*<=≤<=105) — the elements of the array.
Output Specification:
Print a single integer — the minimum number of seconds needed to make all elements of the array equal to zero.
Demo Input:
['5\n1 1 1 1 1\n', '3\n2 0 -1\n', '4\n5 -6 -5 1\n']
Demo Output:
['1\n', '2\n', '4\n']
Note:
In the first example you can add - 1 to all non-zero elements in one second and make them equal to zero.
In the second example you can add - 2 on the first second, then the array becomes equal to [0, 0, - 3]. On the second second you can add 3 to the third (the only non-zero) element.
|
```python
from collections import Counter
n = int(input())
arr = [int(x) for x in input().split()]
count = Counter(arr)
if 0 in arr:
print(len(count) - 1)
else:
print(len(count))
```
| 3
|
|
702
|
B
|
Powers of Two
|
PROGRAMMING
| 1,500
|
[
"brute force",
"data structures",
"implementation",
"math"
] | null | null |
You are given *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Find the number of pairs of indexes *i*,<=*j* (*i*<=<<=*j*) that *a**i*<=+<=*a**j* is a power of 2 (i. e. some integer *x* exists so that *a**i*<=+<=*a**j*<==<=2*x*).
|
The first line contains the single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
|
Print the number of pairs of indexes *i*,<=*j* (*i*<=<<=*j*) that *a**i*<=+<=*a**j* is a power of 2.
|
[
"4\n7 3 2 1\n",
"3\n1 1 1\n"
] |
[
"2\n",
"3\n"
] |
In the first example the following pairs of indexes include in answer: (1, 4) and (2, 4).
In the second example all pairs of indexes (*i*, *j*) (where *i* < *j*) include in answer.
| 0
|
[
{
"input": "4\n7 3 2 1",
"output": "2"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "0"
},
{
"input": "10\n2827343 1373647 96204862 723505 796619138 71550121 799843967 5561265 402690754 446173607",
"output": "2"
},
{
"input": "10\n6 6 7 3 9 14 15 7 2 2",
"output": "9"
},
{
"input": "100\n3 6 12 1 16 4 9 5 4 4 5 8 12 4 6 14 5 1 2 2 2 1 7 1 9 10 6 13 7 8 3 11 8 11 7 5 15 6 14 10 4 2 10 9 1 8 14 9 5 11 3 4 1 12 6 8 13 4 8 5 4 13 13 1 3 9 14 7 14 10 7 3 12 8 9 8 6 15 9 10 12 14 15 4 16 8 8 4 8 7 5 10 16 4 10 13 6 16 16 5",
"output": "532"
},
{
"input": "1\n2",
"output": "0"
},
{
"input": "2\n1 1",
"output": "1"
}
] | 1,672,393,376
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 15
| 0
|
import math
n = int(input())
a = list(map(int,input().split()))
ta = []
for i in range(0,32):
ta.append(2**i)
c = 0
for i in range(n):
for j in range(32):
s = ta[j]-a[i]
for k in range(n):
if k!=i:
if s==a[k]:
print(ta[j],a[i],s)
c += 1
print(c//2)
|
Title: Powers of Two
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Find the number of pairs of indexes *i*,<=*j* (*i*<=<<=*j*) that *a**i*<=+<=*a**j* is a power of 2 (i. e. some integer *x* exists so that *a**i*<=+<=*a**j*<==<=2*x*).
Input Specification:
The first line contains the single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the number of pairs of indexes *i*,<=*j* (*i*<=<<=*j*) that *a**i*<=+<=*a**j* is a power of 2.
Demo Input:
['4\n7 3 2 1\n', '3\n1 1 1\n']
Demo Output:
['2\n', '3\n']
Note:
In the first example the following pairs of indexes include in answer: (1, 4) and (2, 4).
In the second example all pairs of indexes (*i*, *j*) (where *i* < *j*) include in answer.
|
```python
import math
n = int(input())
a = list(map(int,input().split()))
ta = []
for i in range(0,32):
ta.append(2**i)
c = 0
for i in range(n):
for j in range(32):
s = ta[j]-a[i]
for k in range(n):
if k!=i:
if s==a[k]:
print(ta[j],a[i],s)
c += 1
print(c//2)
```
| 0
|
|
63
|
A
|
Sinking Ship
|
PROGRAMMING
| 900
|
[
"implementation",
"sortings",
"strings"
] |
A. Sinking Ship
|
2
|
256
|
The ship crashed into a reef and is sinking. Now the entire crew must be evacuated. All *n* crew members have already lined up in a row (for convenience let's label them all from left to right with positive integers from 1 to *n*) and await further instructions. However, one should evacuate the crew properly, in a strict order. Specifically:
The first crew members to leave the ship are rats. Then women and children (both groups have the same priority) leave the ship. After that all men are evacuated from the ship. The captain leaves the sinking ship last.
If we cannot determine exactly who should leave the ship first for any two members of the crew by the rules from the previous paragraph, then the one who stands to the left in the line leaves the ship first (or in other words, the one whose number in the line is less).
For each crew member we know his status as a crew member, and also his name. All crew members have different names. Determine the order in which to evacuate the crew.
|
The first line contains an integer *n*, which is the number of people in the crew (1<=≤<=*n*<=≤<=100). Then follow *n* lines. The *i*-th of those lines contains two words — the name of the crew member who is *i*-th in line, and his status on the ship. The words are separated by exactly one space. There are no other spaces in the line. The names consist of Latin letters, the first letter is uppercase, the rest are lowercase. The length of any name is from 1 to 10 characters. The status can have the following values: rat for a rat, woman for a woman, child for a child, man for a man, captain for the captain. The crew contains exactly one captain.
|
Print *n* lines. The *i*-th of them should contain the name of the crew member who must be the *i*-th one to leave the ship.
|
[
"6\nJack captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman\n"
] |
[
"Teddy\nAlice\nBob\nJulia\nCharlie\nJack\n"
] |
none
| 500
|
[
{
"input": "6\nJack captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman",
"output": "Teddy\nAlice\nBob\nJulia\nCharlie\nJack"
},
{
"input": "1\nA captain",
"output": "A"
},
{
"input": "1\nAbcdefjhij captain",
"output": "Abcdefjhij"
},
{
"input": "5\nA captain\nB man\nD woman\nC child\nE rat",
"output": "E\nD\nC\nB\nA"
},
{
"input": "10\nCap captain\nD child\nC woman\nA woman\nE child\nMan man\nB child\nF woman\nRat rat\nRatt rat",
"output": "Rat\nRatt\nD\nC\nA\nE\nB\nF\nMan\nCap"
},
{
"input": "5\nJoyxnkypf captain\nDxssgr woman\nKeojmnpd rat\nGdv man\nHnw man",
"output": "Keojmnpd\nDxssgr\nGdv\nHnw\nJoyxnkypf"
},
{
"input": "11\nJue rat\nWyglbyphk rat\nGjlgu child\nGi man\nAttx rat\nTheorpkgx man\nYm rat\nX child\nB captain\nEnualf rat\nKktsgyuyv woman",
"output": "Jue\nWyglbyphk\nAttx\nYm\nEnualf\nGjlgu\nX\nKktsgyuyv\nGi\nTheorpkgx\nB"
},
{
"input": "22\nWswwcvvm woman\nBtmfats rat\nI rat\nOcmtsnwx man\nUrcqv rat\nYghnogt woman\nWtyfc man\nWqle child\nUjfrelpu rat\nDstixj man\nAhksnio woman\nKhkvaap woman\nSjppvwm rat\nEgdmsv rat\nDank rat\nNquicjnw rat\nLh captain\nTdyaqaqln rat\nQtj rat\nTfgwijvq rat\nNbiso child\nNqthvbf woman",
"output": "Btmfats\nI\nUrcqv\nUjfrelpu\nSjppvwm\nEgdmsv\nDank\nNquicjnw\nTdyaqaqln\nQtj\nTfgwijvq\nWswwcvvm\nYghnogt\nWqle\nAhksnio\nKhkvaap\nNbiso\nNqthvbf\nOcmtsnwx\nWtyfc\nDstixj\nLh"
},
{
"input": "36\nKqxmtwmsf child\nIze woman\nDlpr child\nK woman\nF captain\nRjwfeuhba rat\nBbv rat\nS rat\nMnmg woman\nSmzyx woman\nSr man\nQmhroracn rat\nSoqpuqock rat\nPibdq man\nIlrkrptx rat\nZaecfyqka man\nMmersfs child\nVvvocqi man\nHjeqxvq rat\nMpmb woman\nWmgu woman\nCerelmhoxi child\nA man\nDylv man\nXrdgmmtcpq woman\nXj woman\nCeh child\nOfccguo man\nNevr man\nAknkwdkq child\nBmo man\nLqo woman\nVej child\nT child\nRlijc man\nNsdtpdg woman",
"output": "Rjwfeuhba\nBbv\nS\nQmhroracn\nSoqpuqock\nIlrkrptx\nHjeqxvq\nKqxmtwmsf\nIze\nDlpr\nK\nMnmg\nSmzyx\nMmersfs\nMpmb\nWmgu\nCerelmhoxi\nXrdgmmtcpq\nXj\nCeh\nAknkwdkq\nLqo\nVej\nT\nNsdtpdg\nSr\nPibdq\nZaecfyqka\nVvvocqi\nA\nDylv\nOfccguo\nNevr\nBmo\nRlijc\nF"
},
{
"input": "2\nA captain\nB man",
"output": "B\nA"
},
{
"input": "2\nB woman\nA captain",
"output": "B\nA"
},
{
"input": "2\nX child\nY captain",
"output": "X\nY"
},
{
"input": "2\nX captain\nY rat",
"output": "Y\nX"
},
{
"input": "6\nAbdelrhman captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman",
"output": "Teddy\nAlice\nBob\nJulia\nCharlie\nAbdelrhman"
},
{
"input": "4\nAratos captain\nMind child\nAman woman\nCarrot man",
"output": "Mind\nAman\nCarrot\nAratos"
}
] | 1,622,129,337
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 26
| 186
| 0
|
from sys import stdin
d={}
for _ in range(int(stdin.readline())):
n,k=stdin.readline().split()
if k=='woman' or k=='child': k='common'
d[k]=d.get(k,"")+n+"\n"
print(str(d.get('rat',""))+str(d.get('common',""))+str(d.get('man',""))+str(d.get('captain',"")),end="")
|
Title: Sinking Ship
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The ship crashed into a reef and is sinking. Now the entire crew must be evacuated. All *n* crew members have already lined up in a row (for convenience let's label them all from left to right with positive integers from 1 to *n*) and await further instructions. However, one should evacuate the crew properly, in a strict order. Specifically:
The first crew members to leave the ship are rats. Then women and children (both groups have the same priority) leave the ship. After that all men are evacuated from the ship. The captain leaves the sinking ship last.
If we cannot determine exactly who should leave the ship first for any two members of the crew by the rules from the previous paragraph, then the one who stands to the left in the line leaves the ship first (or in other words, the one whose number in the line is less).
For each crew member we know his status as a crew member, and also his name. All crew members have different names. Determine the order in which to evacuate the crew.
Input Specification:
The first line contains an integer *n*, which is the number of people in the crew (1<=≤<=*n*<=≤<=100). Then follow *n* lines. The *i*-th of those lines contains two words — the name of the crew member who is *i*-th in line, and his status on the ship. The words are separated by exactly one space. There are no other spaces in the line. The names consist of Latin letters, the first letter is uppercase, the rest are lowercase. The length of any name is from 1 to 10 characters. The status can have the following values: rat for a rat, woman for a woman, child for a child, man for a man, captain for the captain. The crew contains exactly one captain.
Output Specification:
Print *n* lines. The *i*-th of them should contain the name of the crew member who must be the *i*-th one to leave the ship.
Demo Input:
['6\nJack captain\nAlice woman\nCharlie man\nTeddy rat\nBob child\nJulia woman\n']
Demo Output:
['Teddy\nAlice\nBob\nJulia\nCharlie\nJack\n']
Note:
none
|
```python
from sys import stdin
d={}
for _ in range(int(stdin.readline())):
n,k=stdin.readline().split()
if k=='woman' or k=='child': k='common'
d[k]=d.get(k,"")+n+"\n"
print(str(d.get('rat',""))+str(d.get('common',""))+str(d.get('man',""))+str(d.get('captain',"")),end="")
```
| 3.9535
|
935
|
A
|
Fafa and his Company
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees.
Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader.
Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly.
|
The input consists of a single line containing a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of employees in Fafa's company.
|
Print a single integer representing the answer to the problem.
|
[
"2\n",
"10\n"
] |
[
"1\n",
"3\n"
] |
In the second sample Fafa has 3 ways:
- choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
| 500
|
[
{
"input": "2",
"output": "1"
},
{
"input": "10",
"output": "3"
},
{
"input": "3",
"output": "1"
},
{
"input": "4",
"output": "2"
},
{
"input": "6",
"output": "3"
},
{
"input": "13",
"output": "1"
},
{
"input": "100000",
"output": "35"
},
{
"input": "1024",
"output": "10"
},
{
"input": "99999",
"output": "11"
},
{
"input": "10007",
"output": "1"
},
{
"input": "4096",
"output": "12"
},
{
"input": "65536",
"output": "16"
},
{
"input": "40320",
"output": "95"
},
{
"input": "30030",
"output": "63"
},
{
"input": "161",
"output": "3"
},
{
"input": "1000",
"output": "15"
},
{
"input": "10000",
"output": "24"
},
{
"input": "777",
"output": "7"
},
{
"input": "121",
"output": "2"
},
{
"input": "25",
"output": "2"
},
{
"input": "40000",
"output": "34"
},
{
"input": "99990",
"output": "47"
},
{
"input": "98765",
"output": "3"
},
{
"input": "56789",
"output": "3"
},
{
"input": "13579",
"output": "3"
},
{
"input": "97531",
"output": "3"
},
{
"input": "12345",
"output": "7"
},
{
"input": "54321",
"output": "7"
},
{
"input": "83160",
"output": "127"
},
{
"input": "9",
"output": "2"
},
{
"input": "21",
"output": "3"
},
{
"input": "11",
"output": "1"
},
{
"input": "15",
"output": "3"
}
] | 1,688,762,789
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 31
| 0
|
# это задача 1472A
t = int(input())
for i in range(t):
x = 1
w, h, n = map(int, input().split())
for j in range(n) :
if w % 2 == 0:
x = x + 1
w = w//2
if h % 2 == 0:
x = x + 1
h = h//2
if x >= n:
print("YES")
else:
print("NO")
|
Title: Fafa and his Company
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fafa owns a company that works on huge projects. There are *n* employees in Fafa's company. Whenever the company has a new project to start working on, Fafa has to divide the tasks of this project among all the employees.
Fafa finds doing this every time is very tiring for him. So, he decided to choose the best *l* employees in his company as team leaders. Whenever there is a new project, Fafa will divide the tasks among only the team leaders and each team leader will be responsible of some positive number of employees to give them the tasks. To make this process fair for the team leaders, each one of them should be responsible for the same number of employees. Moreover, every employee, who is not a team leader, has to be under the responsibility of exactly one team leader, and no team leader is responsible for another team leader.
Given the number of employees *n*, find in how many ways Fafa could choose the number of team leaders *l* in such a way that it is possible to divide employees between them evenly.
Input Specification:
The input consists of a single line containing a positive integer *n* (2<=≤<=*n*<=≤<=105) — the number of employees in Fafa's company.
Output Specification:
Print a single integer representing the answer to the problem.
Demo Input:
['2\n', '10\n']
Demo Output:
['1\n', '3\n']
Note:
In the second sample Fafa has 3 ways:
- choose only 1 employee as a team leader with 9 employees under his responsibility. - choose 2 employees as team leaders with 4 employees under the responsibility of each of them. - choose 5 employees as team leaders with 1 employee under the responsibility of each of them.
|
```python
# это задача 1472A
t = int(input())
for i in range(t):
x = 1
w, h, n = map(int, input().split())
for j in range(n) :
if w % 2 == 0:
x = x + 1
w = w//2
if h % 2 == 0:
x = x + 1
h = h//2
if x >= n:
print("YES")
else:
print("NO")
```
| -1
|
|
49
|
A
|
Sleuth
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Sleuth
|
2
|
256
|
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
|
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
|
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
|
[
"Is it a melon?\n",
"Is it an apple?\n",
"Is it a banana ?\n",
"Is it an apple and a banana simultaneouSLY?\n"
] |
[
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] |
none
| 500
|
[
{
"input": "Is it a melon?",
"output": "NO"
},
{
"input": "Is it an apple?",
"output": "YES"
},
{
"input": " Is it a banana ?",
"output": "YES"
},
{
"input": "Is it an apple and a banana simultaneouSLY?",
"output": "YES"
},
{
"input": "oHtSbDwzHb?",
"output": "NO"
},
{
"input": "sZecYdUvZHrXx?",
"output": "NO"
},
{
"input": "uMtXK?",
"output": "NO"
},
{
"input": "U?",
"output": "YES"
},
{
"input": "aqFDkCUKeHMyvZFcAyWlMUSQTFomtaWjoKLVyxLCw vcufPBFbaljOuHWiDCROYTcmbgzbaqHXKPOYEbuEtRqqoxBbOETCsQzhw?",
"output": "NO"
},
{
"input": "dJcNqQiFXzcbsj fItCpBLyXOnrSBPebwyFHlxUJHqCUzzCmcAvMiKL NunwOXnKeIxUZmBVwiCUfPkjRAkTPbkYCmwRRnDSLaz?",
"output": "NO"
},
{
"input": "gxzXbdcAQMuFKuuiPohtMgeypr wpDIoDSyOYTdvylcg SoEBZjnMHHYZGEqKgCgBeTbyTwyGuPZxkxsnSczotBdYyfcQsOVDVC?",
"output": "NO"
},
{
"input": "FQXBisXaJFMiHFQlXjixBDMaQuIbyqSBKGsBfTmBKCjszlGVZxEOqYYqRTUkGpSDDAoOXyXcQbHcPaegeOUBNeSD JiKOdECPOF?",
"output": "NO"
},
{
"input": "YhCuZnrWUBEed?",
"output": "NO"
},
{
"input": "hh?",
"output": "NO"
},
{
"input": "whU?",
"output": "YES"
},
{
"input": "fgwg?",
"output": "NO"
},
{
"input": "GlEmEPKrYcOnBNJUIFjszWUyVdvWw DGDjoCMtRJUburkPToCyDrOtMr?",
"output": "NO"
},
{
"input": "n?",
"output": "NO"
},
{
"input": "BueDOlxgzeNlxrzRrMbKiQdmGujEKmGxclvaPpTuHmTqBp?",
"output": "NO"
},
{
"input": "iehvZNQXDGCuVmJPOEysLyUryTdfaIxIuTzTadDbqRQGoCLXkxnyfWSGoLXebNnQQNTqAQJebbyYvHOfpUnXeWdjx?",
"output": "NO"
},
{
"input": " J ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " o ?",
"output": "YES"
},
{
"input": " T ?",
"output": "NO"
},
{
"input": " q ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " c ?",
"output": "NO"
},
{
"input": " B ?",
"output": "NO"
},
{
"input": "LuhxDHVwMPTtUIUMIQTuQETgXCOQPsfdFlyHvpfOVedjUTpGLAZGOHloIjJJtOLAlHPivzA?",
"output": "YES"
},
{
"input": "wmztmzFfwbGyOmNHENUFMTsFEMWYA?",
"output": "YES"
},
{
"input": "wGsfZCSwN PEUhNUrLfABrxA?",
"output": "YES"
},
{
"input": "mCDHENXjYbgMdBimAdPnewaHfpGWowjWrVAdvWczjw iDcUbyzMsmsnwbviiKiAyGVA?",
"output": "YES"
},
{
"input": "ARIWnwqFqxsQXsXXzHqvFjxOCttAGPUzDtWzsenPYdNXuFOIUGYZsLLK IaoxiyjBBRThoelwdPTkuCQfcBLUEJpCPIrVZlvUWA?",
"output": "YES"
},
{
"input": " PslvVpgpN BXkMFBEVXsyZFIQbBEFxGkYTeXKrOdcmhbiTUatYRUoYAayrchqbksswIlfIjerZPqptvCGnMUhyrQSvwltRhFzA?",
"output": "YES"
},
{
"input": "HpBkttwSjBXDmyleGiRWNUMPaAIE uzTrp KJDzaUiCdsMYOoWKHoUhWUoecCPmACymMUUbGav UMRpCytPETwNFAObZJA?",
"output": "YES"
}
] | 1,667,590,596
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 7
| 92
| 0
|
sentence = input()
sentence = sentence.rstrip()
vowels = ["a", "e", "i", "o", "u", "y"]
for i in range(1, len(sentence)):
if (sentence[len(sentence) - i]).lower() in vowels:
print("YES")
break
elif (sentence[len(sentence) - i]).lower() not in vowels and ((sentence[len(sentence) - i]).lower()).isalpha() == True:
print("NO")
break
|
Title: Sleuth
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
Input Specification:
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
Output Specification:
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
Demo Input:
['Is it a melon?\n', 'Is it an apple?\n', 'Is it a banana ?\n', 'Is it an apple and a banana simultaneouSLY?\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
none
|
```python
sentence = input()
sentence = sentence.rstrip()
vowels = ["a", "e", "i", "o", "u", "y"]
for i in range(1, len(sentence)):
if (sentence[len(sentence) - i]).lower() in vowels:
print("YES")
break
elif (sentence[len(sentence) - i]).lower() not in vowels and ((sentence[len(sentence) - i]).lower()).isalpha() == True:
print("NO")
break
```
| 0
|
441
|
A
|
Valera and Antique Items
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
|
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
|
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
|
[
"3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n",
"3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n"
] |
[
"3\n1 2 3\n",
"0\n\n"
] |
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
| 500
|
[
{
"input": "3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000",
"output": "3\n1 2 3"
},
{
"input": "3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000",
"output": "0"
},
{
"input": "2 100001\n1 895737\n1 541571",
"output": "0"
},
{
"input": "1 1000000\n1 1000000",
"output": "0"
},
{
"input": "1 1000000\n1 561774",
"output": "1\n1"
},
{
"input": "3 1000000\n5 1000000 568832 1000000 1000000 1000000\n13 1000000 1000000 1000000 596527 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000\n20 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000",
"output": "2\n1 2"
},
{
"input": "3 999999\n7 1000000 1000000 1000000 999999 1000000 999999 1000000\n6 999999 1000000 999999 1000000 999999 999999\n7 999999 1000000 1000000 999999 1000000 1000000 1000000",
"output": "0"
},
{
"input": "3 999999\n22 1000000 1000000 999999 999999 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 999999 1000000 1000000 999999 1000000 1000000 1000000 352800 999999 1000000\n14 999999 999999 999999 999999 999999 1000000 999999 999999 999999 999999 702638 999999 1000000 999999\n5 999999 1000000 1000000 999999 363236",
"output": "3\n1 2 3"
},
{
"input": "1 50001\n1 50000",
"output": "1\n1"
}
] | 1,467,767,896
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 62
| 0
|
enteros = input()
#n es número de vendedores
#v cantidad de dinero de Valera
n, v = enteros.split()
n = int(n)
v = int(v)
#print("n", n, "v", v)
resultado = []
for i in range(1, n+1):
#print("i =", i)
datos = input().split()
for j in datos[1:]:
if v > int(j):
resultado.append(i)
break
#print(datos[1])
print(len(resultado))
ordenados = sorted(resultado)
str_ordenados = [str(x) for x in ordenados]
print(" ".join(str_ordenados))
|
Title: Valera and Antique Items
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
Input Specification:
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
Output Specification:
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
Demo Input:
['3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n', '3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n']
Demo Output:
['3\n1 2 3\n', '0\n\n']
Note:
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
|
```python
enteros = input()
#n es número de vendedores
#v cantidad de dinero de Valera
n, v = enteros.split()
n = int(n)
v = int(v)
#print("n", n, "v", v)
resultado = []
for i in range(1, n+1):
#print("i =", i)
datos = input().split()
for j in datos[1:]:
if v > int(j):
resultado.append(i)
break
#print(datos[1])
print(len(resultado))
ordenados = sorted(resultado)
str_ordenados = [str(x) for x in ordenados]
print(" ".join(str_ordenados))
```
| 3
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.