contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
227
|
B
|
Effective Approach
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
|
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
|
[
"2\n1 2\n1\n1\n",
"2\n2 1\n1\n1\n",
"3\n3 1 2\n3\n1 2 3\n"
] |
[
"1 2\n",
"2 1\n",
"6 6\n"
] |
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
| 1,000
|
[
{
"input": "2\n1 2\n1\n1",
"output": "1 2"
},
{
"input": "2\n2 1\n1\n1",
"output": "2 1"
},
{
"input": "3\n3 1 2\n3\n1 2 3",
"output": "6 6"
},
{
"input": "9\n2 9 3 1 6 4 7 8 5\n9\n5 1 5 2 8 4 4 4 5",
"output": "58 32"
},
{
"input": "10\n3 10 9 2 7 6 5 8 4 1\n1\n4",
"output": "9 2"
},
{
"input": "10\n5 2 10 8 3 1 9 7 6 4\n9\n2 5 9 2 3 2 5 9 8",
"output": "31 68"
},
{
"input": "9\n3 8 4 7 1 2 5 6 9\n3\n2 7 1",
"output": "15 15"
},
{
"input": "9\n5 3 8 4 2 6 1 7 9\n4\n6 1 9 2",
"output": "27 13"
},
{
"input": "4\n1 3 2 4\n4\n3 1 2 3",
"output": "8 12"
},
{
"input": "3\n1 2 3\n8\n3 2 1 1 2 3 1 2",
"output": "15 17"
}
] | 1,643,007,960
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 6
| 2,000
| 13,004,800
|
n=int(input())
arr=[int(x) for x in input().split()]
q=int(input())
qrr=[int(x) for x in input().split()]
c1=0
c2=0
for i in qrr:
p=arr.index(i)+1
k=n-p+1
c1+=p
c2+=k
print(c1,c2)
|
Title: Effective Approach
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
Output Specification:
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Demo Input:
['2\n1 2\n1\n1\n', '2\n2 1\n1\n1\n', '3\n3 1 2\n3\n1 2 3\n']
Demo Output:
['1 2\n', '2 1\n', '6 6\n']
Note:
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element).
|
```python
n=int(input())
arr=[int(x) for x in input().split()]
q=int(input())
qrr=[int(x) for x in input().split()]
c1=0
c2=0
for i in qrr:
p=arr.index(i)+1
k=n-p+1
c1+=p
c2+=k
print(c1,c2)
```
| 0
|
|
898
|
E
|
Squares and not squares
|
PROGRAMMING
| 1,600
|
[
"constructive algorithms",
"greedy"
] | null | null |
Ann and Borya have *n* piles with candies and *n* is even number. There are *a**i* candies in pile with number *i*.
Ann likes numbers which are square of some integer and Borya doesn't like numbers which are square of any integer. During one move guys can select some pile with candies and add one candy to it (this candy is new and doesn't belong to any other pile) or remove one candy (if there is at least one candy in this pile).
Find out minimal number of moves that is required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer.
|
First line contains one even integer *n* (2<=≤<=*n*<=≤<=200<=000) — number of piles with candies.
Second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — amounts of candies in each pile.
|
Output minimal number of steps required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer. If condition is already satisfied output 0.
|
[
"4\n12 14 30 4\n",
"6\n0 0 0 0 0 0\n",
"6\n120 110 23 34 25 45\n",
"10\n121 56 78 81 45 100 1 0 54 78\n"
] |
[
"2\n",
"6\n",
"3\n",
"0\n"
] |
In first example you can satisfy condition in two moves. During each move you should add one candy to second pile. After it size of second pile becomes 16. After that Borya and Ann will have two piles with number of candies which is a square of integer (second and fourth pile) and two piles with number of candies which is not a square of any integer (first and third pile).
In second example you should add two candies to any three piles.
| 2,000
|
[
{
"input": "4\n12 14 30 4",
"output": "2"
},
{
"input": "6\n0 0 0 0 0 0",
"output": "6"
},
{
"input": "6\n120 110 23 34 25 45",
"output": "3"
},
{
"input": "10\n121 56 78 81 45 100 1 0 54 78",
"output": "0"
},
{
"input": "10\n0 675178538 310440616 608075179 0 0 0 0 0 0",
"output": "4"
},
{
"input": "10\n49727640 89440577 0 957792200 0 0 0 0 623726477 0",
"output": "2"
},
{
"input": "20\n4 595258838 0 305922562 0 471450344 1 1 29794053 307197649 0 32960227 1 0 0 1 1 0 0 1",
"output": "4"
},
{
"input": "100\n444272562 25 25 0 49 73291074 64 100 638092144 756033694 0 700405846 16 25 25 100 36 25 269573395 288578186 366853675 36 81 49 4 0 25 49 9 64 0 4 36 36 49 0 64 64 532899768 1 64 9 549673690 25 64 4 817183855 25 146555318 36 495564252 100 49 9 36 100 49 100 4 100 9 64 9 432227412 756728309 25 0 332072516 100 64 0 92286436 49 0 81 49 0 49 0 100 409473792 25 814343057 81 1 16 0 16 886097466 64 492116229 81 270298243 64 81 100 0 49 16 16",
"output": "28"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "2\n1 0",
"output": "1"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "2\n0 2",
"output": "0"
},
{
"input": "2\n2 0",
"output": "0"
},
{
"input": "2\n0 1000000000",
"output": "0"
},
{
"input": "2\n31622 31623",
"output": "61"
},
{
"input": "2\n31622 31622",
"output": "62"
}
] | 1,656,031,152
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 9
| 467
| 18,329,600
|
# Сложность по времени
# Сложность по памяти
import heapq
import math
n = int(input())
cnt = 0
cnt_zeros = 0
h = []
a = list(map(int, input().split()))
for x in a:
if x == 0:
cnt_zeros += 1
continue
t = x ** 0.5
t = math.floor(t)
if t * t == x:
cnt += 1
continue
heapq.heappush(h, min(x - t * t, (t + 1) ** 2 - x))
s = 0
if cnt + cnt_zeros < n // 2:
while cnt + cnt_zeros < n // 2:
s += heapq.heappop(h)
cnt += 1
print(s)
elif cnt + cnt_zeros == n // 2:
print(0)
else:
while cnt > cnt_zeros and cnt + cnt_zeros > n // 2:
s += 1
cnt -= 1
while cnt + cnt_zeros > n // 2:
s += 2
cnt_zeros -= 1
print(s)
|
Title: Squares and not squares
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ann and Borya have *n* piles with candies and *n* is even number. There are *a**i* candies in pile with number *i*.
Ann likes numbers which are square of some integer and Borya doesn't like numbers which are square of any integer. During one move guys can select some pile with candies and add one candy to it (this candy is new and doesn't belong to any other pile) or remove one candy (if there is at least one candy in this pile).
Find out minimal number of moves that is required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer.
Input Specification:
First line contains one even integer *n* (2<=≤<=*n*<=≤<=200<=000) — number of piles with candies.
Second line contains sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — amounts of candies in each pile.
Output Specification:
Output minimal number of steps required to make exactly *n*<=/<=2 piles contain number of candies that is a square of some integer and exactly *n*<=/<=2 piles contain number of candies that is not a square of any integer. If condition is already satisfied output 0.
Demo Input:
['4\n12 14 30 4\n', '6\n0 0 0 0 0 0\n', '6\n120 110 23 34 25 45\n', '10\n121 56 78 81 45 100 1 0 54 78\n']
Demo Output:
['2\n', '6\n', '3\n', '0\n']
Note:
In first example you can satisfy condition in two moves. During each move you should add one candy to second pile. After it size of second pile becomes 16. After that Borya and Ann will have two piles with number of candies which is a square of integer (second and fourth pile) and two piles with number of candies which is not a square of any integer (first and third pile).
In second example you should add two candies to any three piles.
|
```python
# Сложность по времени
# Сложность по памяти
import heapq
import math
n = int(input())
cnt = 0
cnt_zeros = 0
h = []
a = list(map(int, input().split()))
for x in a:
if x == 0:
cnt_zeros += 1
continue
t = x ** 0.5
t = math.floor(t)
if t * t == x:
cnt += 1
continue
heapq.heappush(h, min(x - t * t, (t + 1) ** 2 - x))
s = 0
if cnt + cnt_zeros < n // 2:
while cnt + cnt_zeros < n // 2:
s += heapq.heappop(h)
cnt += 1
print(s)
elif cnt + cnt_zeros == n // 2:
print(0)
else:
while cnt > cnt_zeros and cnt + cnt_zeros > n // 2:
s += 1
cnt -= 1
while cnt + cnt_zeros > n // 2:
s += 2
cnt_zeros -= 1
print(s)
```
| 0
|
|
958
|
C1
|
Encryption (easy)
|
PROGRAMMING
| 1,200
|
[
"brute force"
] | null | null |
Rebel spy Heidi has just obtained the plans for the Death Star from the Empire and, now on her way to safety, she is trying to break the encryption of the plans (of course they are encrypted – the Empire may be evil, but it is not stupid!). The encryption has several levels of security, and here is how the first one looks.
Heidi is presented with a screen that shows her a sequence of integers *A* and a positive integer *p*. She knows that the encryption code is a single number *S*, which is defined as follows:
Define the score of *X* to be the sum of the elements of *X* modulo *p*.
Heidi is given a sequence *A* that consists of *N* integers, and also given an integer *p*. She needs to split *A* into 2 parts such that:
- Each part contains at least 1 element of *A*, and each part consists of contiguous elements of *A*. - The two parts do not overlap. - The total sum *S* of the scores of those two parts is maximized. This is the encryption code.
Output the sum *S*, which is the encryption code.
|
The first line of the input contains two space-separated integer *N* and *p* (2<=≤<=*N*<=≤<=100<=000, 2<=≤<=*p*<=≤<=10<=000) – the number of elements in *A*, and the modulo for computing scores, respectively.
The second line contains *N* space-separated integers which are the elements of *A*. Each integer is from the interval [1,<=1<=000<=000].
|
Output the number *S* as described in the problem statement.
|
[
"4 10\n3 4 7 2\n",
"10 12\n16 3 24 13 9 8 7 5 12 12\n"
] |
[
"16\n",
"13\n"
] |
In the first example, the score is maximized if the input sequence is split into two parts as (3, 4), (7, 2). It gives the total score of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fc1f9aecea625f3be9a56917d3ba448d669ff278.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second example, the score is maximized if the first part consists of the first three elements, and the second part consists of the rest. Then, the score is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ffd0a0f4c65b0578601ae2fe11a80aec5192f53d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 0
|
[
{
"input": "4 10\n3 4 7 2",
"output": "16"
},
{
"input": "10 12\n16 3 24 13 9 8 7 5 12 12",
"output": "13"
},
{
"input": "2 2\n9 9",
"output": "2"
},
{
"input": "2 2\n8 8",
"output": "0"
},
{
"input": "5 50\n1 1 1 1 1",
"output": "5"
},
{
"input": "5 50\n100 150 200 100 50",
"output": "0"
}
] | 1,595,278,443
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 27
| 249
| 32,256,000
|
n, p = map(int, input().split())
seq = list(map(int, input().split()))
p1 = 0
p2 = 0
seqSum = sum(seq)
Sums = []
for i in range(n):
p1 += seq[i]
p2 = seqSum - p1
Sums.append((p1%p)+(p2%p))
print(max(Sums))
|
Title: Encryption (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Rebel spy Heidi has just obtained the plans for the Death Star from the Empire and, now on her way to safety, she is trying to break the encryption of the plans (of course they are encrypted – the Empire may be evil, but it is not stupid!). The encryption has several levels of security, and here is how the first one looks.
Heidi is presented with a screen that shows her a sequence of integers *A* and a positive integer *p*. She knows that the encryption code is a single number *S*, which is defined as follows:
Define the score of *X* to be the sum of the elements of *X* modulo *p*.
Heidi is given a sequence *A* that consists of *N* integers, and also given an integer *p*. She needs to split *A* into 2 parts such that:
- Each part contains at least 1 element of *A*, and each part consists of contiguous elements of *A*. - The two parts do not overlap. - The total sum *S* of the scores of those two parts is maximized. This is the encryption code.
Output the sum *S*, which is the encryption code.
Input Specification:
The first line of the input contains two space-separated integer *N* and *p* (2<=≤<=*N*<=≤<=100<=000, 2<=≤<=*p*<=≤<=10<=000) – the number of elements in *A*, and the modulo for computing scores, respectively.
The second line contains *N* space-separated integers which are the elements of *A*. Each integer is from the interval [1,<=1<=000<=000].
Output Specification:
Output the number *S* as described in the problem statement.
Demo Input:
['4 10\n3 4 7 2\n', '10 12\n16 3 24 13 9 8 7 5 12 12\n']
Demo Output:
['16\n', '13\n']
Note:
In the first example, the score is maximized if the input sequence is split into two parts as (3, 4), (7, 2). It gives the total score of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fc1f9aecea625f3be9a56917d3ba448d669ff278.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second example, the score is maximized if the first part consists of the first three elements, and the second part consists of the rest. Then, the score is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ffd0a0f4c65b0578601ae2fe11a80aec5192f53d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
n, p = map(int, input().split())
seq = list(map(int, input().split()))
p1 = 0
p2 = 0
seqSum = sum(seq)
Sums = []
for i in range(n):
p1 += seq[i]
p2 = seqSum - p1
Sums.append((p1%p)+(p2%p))
print(max(Sums))
```
| 3
|
|
688
|
B
|
Lovely Palindromes
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"math"
] | null | null |
Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not.
Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them.
Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number?
|
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000).
|
Print the *n*-th even-length palindrome number.
|
[
"1\n",
"10\n"
] |
[
"11\n",
"1001\n"
] |
The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
| 1,000
|
[
{
"input": "1",
"output": "11"
},
{
"input": "10",
"output": "1001"
},
{
"input": "11",
"output": "1111"
},
{
"input": "12",
"output": "1221"
},
{
"input": "100",
"output": "100001"
},
{
"input": "1321",
"output": "13211231"
},
{
"input": "2",
"output": "22"
},
{
"input": "3",
"output": "33"
},
{
"input": "4",
"output": "44"
},
{
"input": "5",
"output": "55"
},
{
"input": "6",
"output": "66"
},
{
"input": "7",
"output": "77"
},
{
"input": "8",
"output": "88"
},
{
"input": "9",
"output": "99"
},
{
"input": "13",
"output": "1331"
},
{
"input": "14",
"output": "1441"
},
{
"input": "15",
"output": "1551"
},
{
"input": "16",
"output": "1661"
},
{
"input": "17",
"output": "1771"
},
{
"input": "18",
"output": "1881"
},
{
"input": "19",
"output": "1991"
},
{
"input": "20",
"output": "2002"
},
{
"input": "26550",
"output": "2655005562"
},
{
"input": "16137",
"output": "1613773161"
},
{
"input": "91471",
"output": "9147117419"
},
{
"input": "41242",
"output": "4124224214"
},
{
"input": "30866",
"output": "3086666803"
},
{
"input": "4442231232741003009964183199713851566466079882929007253443848371978048610682180431295671905105980116",
"output": "44422312327410030099641831997138515664660798829290072534438483719780486106821804312956719051059801166110895015091765921340812860168408791738483443527009292889706646651583179913814699003001472321322444"
},
{
"input": "7806526084732010742850470902979267046151204705563201965818390803445852115032119297648697933316807252",
"output": "78065260847320107428504709029792670461512047055632019658183908034458521150321192976486979333168072522527086133397968467929112305112585443080938185691023655074021516407629792090740582470102374806256087"
},
{
"input": "2244399823612183124978103773977739948197709395321563148611877999503840818596183803323258317041875913",
"output": "22443998236121831249781037739777399481977093953215631486118779995038408185961838033232583170418759133195781407138523233083816958180483059997781168413651235939077918499377793773018794213812163289934422"
},
{
"input": "123451",
"output": "123451154321"
}
] | 1,681,965,823
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 40
| 77
| 409,600
|
import sys
def main() -> None:
read = sys.stdin.readline
val = read().strip()
val_2 = val[::-1]
print(val+val_2)
if __name__ == '__main__':
main()
|
Title: Lovely Palindromes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pari has a friend who loves palindrome numbers. A palindrome number is a number that reads the same forward or backward. For example 12321, 100001 and 1 are palindrome numbers, while 112 and 1021 are not.
Pari is trying to love them too, but only very special and gifted people can understand the beauty behind palindrome numbers. Pari loves integers with even length (i.e. the numbers with even number of digits), so she tries to see a lot of big palindrome numbers with even length (like a 2-digit 11 or 6-digit 122221), so maybe she could see something in them.
Now Pari asks you to write a program that gets a huge integer *n* from the input and tells what is the *n*-th even-length positive palindrome number?
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=10100<=000).
Output Specification:
Print the *n*-th even-length palindrome number.
Demo Input:
['1\n', '10\n']
Demo Output:
['11\n', '1001\n']
Note:
The first 10 even-length palindrome numbers are 11, 22, 33, ... , 88, 99 and 1001.
|
```python
import sys
def main() -> None:
read = sys.stdin.readline
val = read().strip()
val_2 = val[::-1]
print(val+val_2)
if __name__ == '__main__':
main()
```
| 3
|
|
35
|
A
|
Shell Game
|
PROGRAMMING
| 1,000
|
[
"implementation"
] |
A. Shell Game
|
2
|
64
|
Today the «Z» city residents enjoy a shell game competition. The residents are gathered on the main square to watch the breath-taking performance. The performer puts 3 non-transparent cups upside down in a row. Then he openly puts a small ball under one of the cups and starts to shuffle the cups around very quickly so that on the whole he makes exactly 3 shuffles. After that the spectators have exactly one attempt to guess in which cup they think the ball is and if the answer is correct they get a prize. Maybe you can try to find the ball too?
|
The first input line contains an integer from 1 to 3 — index of the cup which covers the ball before the shuffles. The following three lines describe the shuffles. Each description of a shuffle contains two distinct integers from 1 to 3 — indexes of the cups which the performer shuffled this time. The cups are numbered from left to right and are renumbered after each shuffle from left to right again. In other words, the cup on the left always has index 1, the one in the middle — index 2 and the one on the right — index 3.
|
In the first line output an integer from 1 to 3 — index of the cup which will have the ball after all the shuffles.
|
[
"1\n1 2\n2 1\n2 1\n",
"1\n2 1\n3 1\n1 3\n"
] |
[
"2\n",
"2\n"
] |
none
| 500
|
[
{
"input": "1\n1 2\n2 1\n2 1",
"output": "2"
},
{
"input": "1\n2 1\n3 1\n1 3",
"output": "2"
},
{
"input": "3\n3 1\n2 1\n1 2",
"output": "1"
},
{
"input": "1\n1 3\n1 2\n2 3",
"output": "2"
},
{
"input": "3\n3 2\n3 1\n3 1",
"output": "2"
},
{
"input": "1\n2 1\n1 3\n1 3",
"output": "2"
},
{
"input": "3\n3 1\n2 3\n3 2",
"output": "1"
},
{
"input": "2\n1 3\n1 2\n2 1",
"output": "2"
},
{
"input": "1\n1 3\n3 2\n1 2",
"output": "1"
},
{
"input": "1\n1 3\n1 3\n2 3",
"output": "1"
},
{
"input": "2\n1 2\n2 3\n2 1",
"output": "2"
},
{
"input": "3\n1 3\n3 2\n2 1",
"output": "2"
},
{
"input": "1\n1 2\n2 1\n2 3",
"output": "1"
},
{
"input": "1\n2 3\n1 3\n1 2",
"output": "3"
},
{
"input": "2\n3 1\n3 2\n2 3",
"output": "2"
},
{
"input": "2\n1 3\n3 1\n3 1",
"output": "2"
},
{
"input": "1\n3 2\n1 3\n3 1",
"output": "1"
},
{
"input": "3\n1 3\n1 2\n1 3",
"output": "2"
},
{
"input": "1\n3 2\n3 1\n1 2",
"output": "3"
},
{
"input": "2\n2 3\n1 3\n1 3",
"output": "3"
}
] | 1,674,987,572
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 62
| 0
|
f = open('input.txt')
lmao = f.readlines()
n = int(lmao[0][:-2])
for i in range(3):
l = [int(i) for i in lmao[i+1].split()[:-2]]
if n in l:
l.remove(n)
n = l[0]
with open('output.txt', 'w') as f: f.writelines(str(n))
|
Title: Shell Game
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Today the «Z» city residents enjoy a shell game competition. The residents are gathered on the main square to watch the breath-taking performance. The performer puts 3 non-transparent cups upside down in a row. Then he openly puts a small ball under one of the cups and starts to shuffle the cups around very quickly so that on the whole he makes exactly 3 shuffles. After that the spectators have exactly one attempt to guess in which cup they think the ball is and if the answer is correct they get a prize. Maybe you can try to find the ball too?
Input Specification:
The first input line contains an integer from 1 to 3 — index of the cup which covers the ball before the shuffles. The following three lines describe the shuffles. Each description of a shuffle contains two distinct integers from 1 to 3 — indexes of the cups which the performer shuffled this time. The cups are numbered from left to right and are renumbered after each shuffle from left to right again. In other words, the cup on the left always has index 1, the one in the middle — index 2 and the one on the right — index 3.
Output Specification:
In the first line output an integer from 1 to 3 — index of the cup which will have the ball after all the shuffles.
Demo Input:
['1\n1 2\n2 1\n2 1\n', '1\n2 1\n3 1\n1 3\n']
Demo Output:
['2\n', '2\n']
Note:
none
|
```python
f = open('input.txt')
lmao = f.readlines()
n = int(lmao[0][:-2])
for i in range(3):
l = [int(i) for i in lmao[i+1].split()[:-2]]
if n in l:
l.remove(n)
n = l[0]
with open('output.txt', 'w') as f: f.writelines(str(n))
```
| -1
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,696,531,325
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 62
| 0
|
x = input().split("+")
x.sort()
n = ""
for i in x:
n = n+i+"+"
print(n[0:-1])
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
x = input().split("+")
x.sort()
n = ""
for i in x:
n = n+i+"+"
print(n[0:-1])
```
| 3
|
|
50
|
A
|
Domino piling
|
PROGRAMMING
| 800
|
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500
|
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,675,706,530
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 35
| 124
| 0
|
a=list(map(int,input().split()))
c=a[0]*a[1]
b=2
d=c/b
print(int(d))
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
a=list(map(int,input().split()))
c=a[0]*a[1]
b=2
d=c/b
print(int(d))
```
| 3.969
|
420
|
A
|
Start Up
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it?
The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper.
There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not.
|
The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font:
|
Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes).
|
[
"AHA\n",
"Z\n",
"XO\n"
] |
[
"YES\n",
"NO\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "AHA",
"output": "YES"
},
{
"input": "Z",
"output": "NO"
},
{
"input": "XO",
"output": "NO"
},
{
"input": "AAA",
"output": "YES"
},
{
"input": "AHHA",
"output": "YES"
},
{
"input": "BAB",
"output": "NO"
},
{
"input": "OMMMAAMMMO",
"output": "YES"
},
{
"input": "YYHUIUGYI",
"output": "NO"
},
{
"input": "TT",
"output": "YES"
},
{
"input": "UUU",
"output": "YES"
},
{
"input": "WYYW",
"output": "YES"
},
{
"input": "MITIM",
"output": "YES"
},
{
"input": "VO",
"output": "NO"
},
{
"input": "WWS",
"output": "NO"
},
{
"input": "VIYMAXXAVM",
"output": "NO"
},
{
"input": "OVWIHIWVYXMVAAAATOXWOIUUHYXHIHHVUIOOXWHOXTUUMUUVHVWWYUTIAUAITAOMHXWMTTOIVMIVOTHOVOIOHYHAOXWAUVWAVIVM",
"output": "NO"
},
{
"input": "CC",
"output": "NO"
},
{
"input": "QOQ",
"output": "NO"
},
{
"input": "AEEA",
"output": "NO"
},
{
"input": "OQQQO",
"output": "NO"
},
{
"input": "HNCMEEMCNH",
"output": "NO"
},
{
"input": "QDPINBMCRFWXPDBFGOZVVOCEMJRUCTOADEWEGTVBVBFWWRPGYEEYGPRWWFBVBVTGEWEDAOTCURJMECOVVZOGFBDPXWFRCMBNIPDQ",
"output": "NO"
},
{
"input": "A",
"output": "YES"
},
{
"input": "B",
"output": "NO"
},
{
"input": "C",
"output": "NO"
},
{
"input": "D",
"output": "NO"
},
{
"input": "E",
"output": "NO"
},
{
"input": "F",
"output": "NO"
},
{
"input": "G",
"output": "NO"
},
{
"input": "H",
"output": "YES"
},
{
"input": "I",
"output": "YES"
},
{
"input": "J",
"output": "NO"
},
{
"input": "K",
"output": "NO"
},
{
"input": "L",
"output": "NO"
},
{
"input": "M",
"output": "YES"
},
{
"input": "N",
"output": "NO"
},
{
"input": "O",
"output": "YES"
},
{
"input": "P",
"output": "NO"
},
{
"input": "Q",
"output": "NO"
},
{
"input": "R",
"output": "NO"
},
{
"input": "S",
"output": "NO"
},
{
"input": "T",
"output": "YES"
},
{
"input": "U",
"output": "YES"
},
{
"input": "V",
"output": "YES"
},
{
"input": "W",
"output": "YES"
},
{
"input": "X",
"output": "YES"
},
{
"input": "Y",
"output": "YES"
},
{
"input": "JL",
"output": "NO"
},
{
"input": "AAAKTAAA",
"output": "NO"
},
{
"input": "AKA",
"output": "NO"
},
{
"input": "AAJAA",
"output": "NO"
},
{
"input": "ABA",
"output": "NO"
},
{
"input": "AAAAAABAAAAAA",
"output": "NO"
},
{
"input": "ZZ",
"output": "NO"
},
{
"input": "ADA",
"output": "NO"
},
{
"input": "N",
"output": "NO"
},
{
"input": "P",
"output": "NO"
},
{
"input": "LAL",
"output": "NO"
},
{
"input": "AABAA",
"output": "NO"
},
{
"input": "AZA",
"output": "NO"
},
{
"input": "V",
"output": "YES"
},
{
"input": "SSS",
"output": "NO"
},
{
"input": "NNN",
"output": "NO"
},
{
"input": "S",
"output": "NO"
},
{
"input": "I",
"output": "YES"
},
{
"input": "SS",
"output": "NO"
},
{
"input": "E",
"output": "NO"
}
] | 1,594,119,539
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 80
| 140
| 22,835,200
|
def cifre(s):
l = [ 'B','C','D','E','F','G','J','K','L','N',
'P','Q','R','S','Z' ]
for i in range(len(l)):
if s !=s[::-1] or s.find(l[i])!=-1:
return False
return True
s = input()
if cifre(s):
print("YES")
else:
print("NO")
|
Title: Start Up
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, a start up by two students of a state university of city F gained incredible popularity. Now it's time to start a new company. But what do we call it?
The market analysts came up with a very smart plan: the name of the company should be identical to its reflection in a mirror! In other words, if we write out the name of the company on a piece of paper in a line (horizontally, from left to right) with large English letters, then put this piece of paper in front of the mirror, then the reflection of the name in the mirror should perfectly match the line written on the piece of paper.
There are many suggestions for the company name, so coming up to the mirror with a piece of paper for each name wouldn't be sensible. The founders of the company decided to automatize this process. They asked you to write a program that can, given a word, determine whether the word is a 'mirror' word or not.
Input Specification:
The first line contains a non-empty name that needs to be checked. The name contains at most 105 large English letters. The name will be written with the next sans serif font:
Output Specification:
Print 'YES' (without the quotes), if the given name matches its mirror reflection. Otherwise, print 'NO' (without the quotes).
Demo Input:
['AHA\n', 'Z\n', 'XO\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none
|
```python
def cifre(s):
l = [ 'B','C','D','E','F','G','J','K','L','N',
'P','Q','R','S','Z' ]
for i in range(len(l)):
if s !=s[::-1] or s.find(l[i])!=-1:
return False
return True
s = input()
if cifre(s):
print("YES")
else:
print("NO")
```
| 3
|
|
115
|
A
|
Party
|
PROGRAMMING
| 900
|
[
"dfs and similar",
"graphs",
"trees"
] | null | null |
A company has *n* employees numbered from 1 to *n*. Each employee either has no immediate manager or exactly one immediate manager, who is another employee with a different number. An employee *A* is said to be the superior of another employee *B* if at least one of the following is true:
- Employee *A* is the immediate manager of employee *B* - Employee *B* has an immediate manager employee *C* such that employee *A* is the superior of employee *C*.
The company will not have a managerial cycle. That is, there will not exist an employee who is the superior of his/her own immediate manager.
Today the company is going to arrange a party. This involves dividing all *n* employees into several groups: every employee must belong to exactly one group. Furthermore, within any single group, there must not be two employees *A* and *B* such that *A* is the superior of *B*.
What is the minimum number of groups that must be formed?
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of employees.
The next *n* lines contain the integers *p**i* (1<=≤<=*p**i*<=≤<=*n* or *p**i*<==<=-1). Every *p**i* denotes the immediate manager for the *i*-th employee. If *p**i* is -1, that means that the *i*-th employee does not have an immediate manager.
It is guaranteed, that no employee will be the immediate manager of him/herself (*p**i*<=≠<=*i*). Also, there will be no managerial cycles.
|
Print a single integer denoting the minimum number of groups that will be formed in the party.
|
[
"5\n-1\n1\n2\n1\n-1\n"
] |
[
"3\n"
] |
For the first example, three groups are sufficient, for example:
- Employee 1 - Employees 2 and 4 - Employees 3 and 5
| 500
|
[
{
"input": "5\n-1\n1\n2\n1\n-1",
"output": "3"
},
{
"input": "4\n-1\n1\n2\n3",
"output": "4"
},
{
"input": "12\n-1\n1\n2\n3\n-1\n5\n6\n7\n-1\n9\n10\n11",
"output": "4"
},
{
"input": "6\n-1\n-1\n2\n3\n1\n1",
"output": "3"
},
{
"input": "3\n-1\n1\n1",
"output": "2"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "2\n2\n-1",
"output": "2"
},
{
"input": "2\n-1\n-1",
"output": "1"
},
{
"input": "3\n2\n-1\n1",
"output": "3"
},
{
"input": "3\n-1\n-1\n-1",
"output": "1"
},
{
"input": "5\n4\n5\n1\n-1\n4",
"output": "3"
},
{
"input": "12\n-1\n1\n1\n1\n1\n1\n3\n4\n3\n3\n4\n7",
"output": "4"
},
{
"input": "12\n-1\n-1\n1\n-1\n1\n1\n5\n11\n8\n6\n6\n4",
"output": "5"
},
{
"input": "12\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n2\n-1\n-1\n-1",
"output": "2"
},
{
"input": "12\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1\n-1",
"output": "1"
},
{
"input": "12\n3\n4\n2\n8\n7\n1\n10\n12\n5\n-1\n9\n11",
"output": "12"
},
{
"input": "12\n5\n6\n7\n1\n-1\n9\n12\n4\n8\n-1\n3\n2",
"output": "11"
},
{
"input": "12\n-1\n9\n11\n6\n6\n-1\n6\n3\n8\n6\n1\n6",
"output": "6"
},
{
"input": "12\n7\n8\n4\n12\n7\n9\n-1\n-1\n-1\n8\n6\n-1",
"output": "3"
},
{
"input": "12\n-1\n10\n-1\n1\n-1\n5\n9\n12\n-1\n-1\n3\n-1",
"output": "2"
},
{
"input": "12\n-1\n7\n9\n12\n1\n7\n-1\n-1\n8\n5\n4\n-1",
"output": "3"
},
{
"input": "12\n11\n11\n8\n9\n1\n1\n2\n-1\n10\n3\n-1\n8",
"output": "5"
},
{
"input": "12\n-1\n8\n9\n-1\n4\n2\n11\n1\n-1\n6\n-1\n10",
"output": "6"
},
{
"input": "12\n7\n4\n4\n-1\n6\n7\n9\n7\n-1\n7\n4\n1",
"output": "4"
},
{
"input": "12\n-1\n6\n10\n6\n1\n11\n5\n9\n11\n5\n1\n9",
"output": "4"
},
{
"input": "12\n8\n6\n6\n8\n6\n-1\n6\n6\n8\n6\n8\n8",
"output": "3"
},
{
"input": "12\n3\n8\n9\n12\n2\n8\n11\n12\n2\n9\n-1\n11",
"output": "7"
},
{
"input": "7\n7\n6\n-1\n-1\n4\n4\n-1",
"output": "3"
},
{
"input": "77\n53\n-1\n48\n-1\n51\n-1\n54\n43\n70\n19\n64\n31\n45\n58\n6\n61\n41\n56\n34\n-1\n54\n-1\n66\n65\n74\n16\n38\n1\n2\n61\n-1\n34\n-1\n-1\n7\n19\n57\n13\n61\n42\n-1\n34\n65\n16\n31\n61\n6\n5\n34\n15\n-1\n13\n4\n22\n74\n7\n-1\n70\n38\n61\n45\n53\n46\n22\n-1\n65\n34\n19\n43\n48\n33\n58\n36\n-1\n47\n24\n34",
"output": "6"
},
{
"input": "5\n2\n3\n4\n5\n-1",
"output": "5"
}
] | 1,694,870,299
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 106
| 686
| 0
|
s0L = 0
abc = []
van = int(input())
for bc in range(van):
abc.append(int(input()))
for bc in range(van):
dfg = 0
while abc[bc] != -1:
dfg+=1
bc = abc[bc]-1
s0L = max(dfg,s0L)
print(s0L+1)
|
Title: Party
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A company has *n* employees numbered from 1 to *n*. Each employee either has no immediate manager or exactly one immediate manager, who is another employee with a different number. An employee *A* is said to be the superior of another employee *B* if at least one of the following is true:
- Employee *A* is the immediate manager of employee *B* - Employee *B* has an immediate manager employee *C* such that employee *A* is the superior of employee *C*.
The company will not have a managerial cycle. That is, there will not exist an employee who is the superior of his/her own immediate manager.
Today the company is going to arrange a party. This involves dividing all *n* employees into several groups: every employee must belong to exactly one group. Furthermore, within any single group, there must not be two employees *A* and *B* such that *A* is the superior of *B*.
What is the minimum number of groups that must be formed?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000) — the number of employees.
The next *n* lines contain the integers *p**i* (1<=≤<=*p**i*<=≤<=*n* or *p**i*<==<=-1). Every *p**i* denotes the immediate manager for the *i*-th employee. If *p**i* is -1, that means that the *i*-th employee does not have an immediate manager.
It is guaranteed, that no employee will be the immediate manager of him/herself (*p**i*<=≠<=*i*). Also, there will be no managerial cycles.
Output Specification:
Print a single integer denoting the minimum number of groups that will be formed in the party.
Demo Input:
['5\n-1\n1\n2\n1\n-1\n']
Demo Output:
['3\n']
Note:
For the first example, three groups are sufficient, for example:
- Employee 1 - Employees 2 and 4 - Employees 3 and 5
|
```python
s0L = 0
abc = []
van = int(input())
for bc in range(van):
abc.append(int(input()))
for bc in range(van):
dfg = 0
while abc[bc] != -1:
dfg+=1
bc = abc[bc]-1
s0L = max(dfg,s0L)
print(s0L+1)
```
| 3
|
|
119
|
A
|
Epic Game
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
|
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
|
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
|
[
"3 5 9\n",
"1 1 100\n"
] |
[
"0",
"1"
] |
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
| 500
|
[
{
"input": "3 5 9",
"output": "0"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "23 12 16",
"output": "1"
},
{
"input": "95 26 29",
"output": "1"
},
{
"input": "73 32 99",
"output": "1"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "41 12 65",
"output": "1"
},
{
"input": "13 61 100",
"output": "1"
},
{
"input": "100 100 10",
"output": "0"
},
{
"input": "12 24 26",
"output": "1"
},
{
"input": "73 21 96",
"output": "1"
},
{
"input": "17 22 81",
"output": "1"
},
{
"input": "14 88 97",
"output": "1"
},
{
"input": "42 81 17",
"output": "0"
},
{
"input": "34 36 19",
"output": "1"
},
{
"input": "21 87 12",
"output": "1"
},
{
"input": "97 92 98",
"output": "1"
},
{
"input": "49 25 62",
"output": "1"
},
{
"input": "29 17 44",
"output": "1"
},
{
"input": "10 1 10",
"output": "0"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "100 100 1",
"output": "0"
},
{
"input": "11 99 55",
"output": "0"
},
{
"input": "8 13 21",
"output": "0"
},
{
"input": "34 55 89",
"output": "0"
},
{
"input": "21 34 55",
"output": "1"
},
{
"input": "13 21 34",
"output": "1"
},
{
"input": "34 21 55",
"output": "0"
},
{
"input": "10 20 84",
"output": "1"
},
{
"input": "4 2 5",
"output": "0"
},
{
"input": "3 2 3",
"output": "0"
},
{
"input": "31 23 1",
"output": "0"
},
{
"input": "100 100 100",
"output": "0"
},
{
"input": "100 1 100",
"output": "0"
},
{
"input": "1 100 100",
"output": "1"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "17 23 100",
"output": "1"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "1 1 2",
"output": "1"
},
{
"input": "2 1 1",
"output": "0"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "2 1 2",
"output": "0"
},
{
"input": "10 10 3",
"output": "1"
},
{
"input": "2 2 1",
"output": "0"
},
{
"input": "9 5 1",
"output": "0"
}
] | 1,589,462,860
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 248
| 6,963,200
|
a,b,n = map(int,input().split())
flag = True
while flag:
for x in range(1,a+1)[::-1]:
if a%x==0 and n%x==0 and (n-x)>=0:
n-=x
break
else:
print(1)
flag = False
break
for y in range(1,b+1)[::-1]:
if b%y==0 and n%y==0 and (n-x)>=0:
n-=y
break
else:
print(0)
flag = False
break
|
Title: Epic Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
Input Specification:
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
Output Specification:
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
Demo Input:
['3 5 9\n', '1 1 100\n']
Demo Output:
['0', '1']
Note:
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that.
|
```python
a,b,n = map(int,input().split())
flag = True
while flag:
for x in range(1,a+1)[::-1]:
if a%x==0 and n%x==0 and (n-x)>=0:
n-=x
break
else:
print(1)
flag = False
break
for y in range(1,b+1)[::-1]:
if b%y==0 and n%y==0 and (n-x)>=0:
n-=y
break
else:
print(0)
flag = False
break
```
| 3
|
|
103
|
A
|
Testing Pants for Sadness
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation",
"math"
] |
A. Testing Pants for Sadness
|
2
|
256
|
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=≤<=*a**i*<=≤<=109), the number of answer variants to question *i*.
|
Print a single number — the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
[
"2\n1 1\n",
"2\n2 2\n",
"1\n10\n"
] |
[
"2",
"5",
"10"
] |
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
| 500
|
[
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n2 2",
"output": "5"
},
{
"input": "1\n10",
"output": "10"
},
{
"input": "3\n2 4 1",
"output": "10"
},
{
"input": "4\n5 5 3 1",
"output": "22"
},
{
"input": "2\n1000000000 1000000000",
"output": "2999999999"
},
{
"input": "10\n5 7 8 1 10 3 6 4 10 6",
"output": "294"
},
{
"input": "100\n5 7 5 3 5 4 6 5 3 6 4 6 6 2 1 9 6 5 3 8 4 10 1 9 1 3 7 6 5 5 8 8 7 7 8 9 2 10 3 5 4 2 6 10 2 6 9 6 1 9 3 7 7 8 3 9 9 5 10 10 3 10 7 8 3 9 8 3 2 4 10 2 1 1 7 3 9 10 4 6 9 8 2 1 4 10 1 10 6 8 7 5 3 3 6 2 7 10 3 8",
"output": "24212"
},
{
"input": "100\n96 23 25 62 34 30 85 15 26 61 59 87 34 99 60 41 52 73 63 84 50 89 42 29 87 99 19 94 84 43 82 90 41 100 60 61 99 49 26 3 97 5 24 34 51 59 69 61 11 41 72 60 33 36 18 29 82 53 18 80 52 98 38 32 56 95 55 79 32 80 37 64 45 13 62 80 70 29 1 58 88 24 79 68 41 80 12 72 52 39 64 19 54 56 70 58 19 3 83 62",
"output": "261115"
},
{
"input": "100\n883 82 79 535 478 824 700 593 262 385 403 183 176 386 126 648 710 516 922 97 800 728 372 9 954 911 975 526 476 3 74 459 471 174 295 831 698 21 927 698 580 856 712 430 5 473 592 40 301 230 763 266 38 213 393 70 333 779 811 249 130 456 763 657 578 699 939 660 898 918 438 855 892 85 35 232 54 593 849 777 917 979 796 322 473 887 284 105 522 415 86 480 80 592 516 227 680 574 488 644",
"output": "2519223"
},
{
"input": "100\n6659 5574 5804 7566 7431 1431 3871 6703 200 300 3523 3580 8500 2312 4812 3149 3324 5846 8965 5758 5831 1341 7733 4477 355 3024 2941 9938 1494 16 1038 8262 9938 9230 5192 8113 7575 7696 5566 2884 8659 1951 1253 6480 3877 3707 5482 3825 5359 44 3219 3258 1785 5478 4525 5950 2417 1991 8885 4264 8769 2961 7107 8904 5097 2319 5713 8811 9723 8677 2153 3237 7174 9528 9260 7390 3050 6823 6239 5222 4602 933 7823 4198 8304 244 5845 3189 4490 3216 7877 6323 1938 4597 880 1206 1691 1405 4122 5950",
"output": "24496504"
},
{
"input": "50\n515844718 503470143 928669067 209884122 322869098 241621928 844696197 105586164 552680307 968792756 135928721 842094825 298782438 829020472 791637138 285482545 811025527 428952878 887796419 11883658 546401594 6272027 100292274 308219869 372132044 955814846 644008184 521195760 919389466 215065725 687764134 655750167 181397022 404292682 643251185 776299412 741398345 865144798 369796727 673902099 124966684 35796775 794385099 594562033 550366869 868093561 695094388 580789105 755076935 198783899",
"output": "685659563557"
},
{
"input": "10\n12528238 329065023 620046219 303914458 356423530 751571368 72944261 883971060 123105651 868129460",
"output": "27409624352"
},
{
"input": "1\n84355694",
"output": "84355694"
},
{
"input": "2\n885992042 510468669",
"output": "1906929379"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n2 1 2 2 2 2 1 2 2 1 2 2 2 1 2 1 2 2 1 2 2 2 2 2 2 1 2 1 1 2 1 1 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 2 2 1 1 1 2 2 1 1 2 1 1 2 2 2 2 1 2 2 2 1 2 1 2 2 1 2 1 1 1 2 2 1 2 1 2 1 1 1 2 1 2 2 2 1 1 1",
"output": "2686"
},
{
"input": "100\n1 3 2 1 1 2 1 3 2 2 3 1 1 1 2 2 1 3 3 1 1 2 2 3 2 1 3 1 3 2 1 1 3 3 2 1 2 2 2 3 2 2 3 2 2 3 2 1 3 1 1 2 1 3 2 2 1 1 1 1 1 1 3 1 2 3 1 1 1 1 1 2 3 3 1 1 1 1 2 3 3 1 3 2 2 3 2 1 3 2 2 3 1 1 3 2 3 2 3 1",
"output": "4667"
}
] | 1,674,914,376
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 30
| 0
|
n = int(input())
l = [int(i) for i in input().split()]
print(sum(l)+2)
|
Title: Testing Pants for Sadness
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The average miner Vaganych took refresher courses. As soon as a miner completes the courses, he should take exams. The hardest one is a computer test called "Testing Pants for Sadness".
The test consists of *n* questions; the questions are to be answered strictly in the order in which they are given, from question 1 to question *n*. Question *i* contains *a**i* answer variants, exactly one of them is correct.
A click is regarded as selecting any answer in any question. The goal is to select the correct answer for each of the *n* questions. If Vaganych selects a wrong answer for some question, then all selected answers become unselected and the test starts from the very beginning, from question 1 again. But Vaganych remembers everything. The order of answers for each question and the order of questions remain unchanged, as well as the question and answers themselves.
Vaganych is very smart and his memory is superb, yet he is unbelievably unlucky and knows nothing whatsoever about the test's theme. How many clicks will he have to perform in the worst case?
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100). It is the number of questions in the test. The second line contains space-separated *n* positive integers *a**i* (1<=≤<=*a**i*<=≤<=109), the number of answer variants to question *i*.
Output Specification:
Print a single number — the minimal number of clicks needed to pass the test it the worst-case scenario.
Please do not use the %lld specificator to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Demo Input:
['2\n1 1\n', '2\n2 2\n', '1\n10\n']
Demo Output:
['2', '5', '10']
Note:
Note to the second sample. In the worst-case scenario you will need five clicks:
- the first click selects the first variant to the first question, this answer turns out to be wrong. - the second click selects the second variant to the first question, it proves correct and we move on to the second question; - the third click selects the first variant to the second question, it is wrong and we go back to question 1; - the fourth click selects the second variant to the first question, it proves as correct as it was and we move on to the second question; - the fifth click selects the second variant to the second question, it proves correct, the test is finished.
|
```python
n = int(input())
l = [int(i) for i in input().split()]
print(sum(l)+2)
```
| 0
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,693,006,140
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 30
| 0
|
size = int(input())
list = []
for _ in range(size):
list.append(int(input()))
sum=0
for i in range(0,size):
sum+=list[i]
print(sum/size)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
size = int(input())
list = []
for _ in range(size):
list.append(int(input()))
sum=0
for i in range(0,size):
sum+=list[i]
print(sum/size)
```
| -1
|
|
625
|
A
|
Guest From the Past
|
PROGRAMMING
| 1,700
|
[
"implementation",
"math"
] | null | null |
Kolya Gerasimov loves kefir very much. He lives in year 1984 and knows all the details of buying this delicious drink. One day, as you probably know, he found himself in year 2084, and buying kefir there is much more complicated.
Kolya is hungry, so he went to the nearest milk shop. In 2084 you may buy kefir in a plastic liter bottle, that costs *a* rubles, or in glass liter bottle, that costs *b* rubles. Also, you may return empty glass bottle and get *c* (*c*<=<<=*b*) rubles back, but you cannot return plastic bottles.
Kolya has *n* rubles and he is really hungry, so he wants to drink as much kefir as possible. There were no plastic bottles in his 1984, so Kolya doesn't know how to act optimally and asks for your help.
|
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1018) — the number of rubles Kolya has at the beginning.
Then follow three lines containing integers *a*, *b* and *c* (1<=≤<=*a*<=≤<=1018, 1<=≤<=*c*<=<<=*b*<=≤<=1018) — the cost of one plastic liter bottle, the cost of one glass liter bottle and the money one can get back by returning an empty glass bottle, respectively.
|
Print the only integer — maximum number of liters of kefir, that Kolya can drink.
|
[
"10\n11\n9\n8\n",
"10\n5\n6\n1\n"
] |
[
"2\n",
"2\n"
] |
In the first sample, Kolya can buy one glass bottle, then return it and buy one more glass bottle. Thus he will drink 2 liters of kefir.
In the second sample, Kolya can buy two plastic bottle and get two liters of kefir, or he can buy one liter glass bottle, then return it and buy one plastic bottle. In both cases he will drink two liters of kefir.
| 750
|
[
{
"input": "10\n11\n9\n8",
"output": "2"
},
{
"input": "10\n5\n6\n1",
"output": "2"
},
{
"input": "2\n2\n2\n1",
"output": "1"
},
{
"input": "10\n3\n3\n1",
"output": "4"
},
{
"input": "10\n1\n2\n1",
"output": "10"
},
{
"input": "10\n2\n3\n1",
"output": "5"
},
{
"input": "9\n2\n4\n1",
"output": "4"
},
{
"input": "9\n2\n2\n1",
"output": "8"
},
{
"input": "9\n10\n10\n1",
"output": "0"
},
{
"input": "10\n2\n2\n1",
"output": "9"
},
{
"input": "1000000000000000000\n2\n10\n9",
"output": "999999999999999995"
},
{
"input": "501000000000000000\n300000000000000000\n301000000000000000\n100000000000000000",
"output": "2"
},
{
"input": "10\n1\n9\n8",
"output": "10"
},
{
"input": "10\n8\n8\n7",
"output": "3"
},
{
"input": "10\n5\n5\n1",
"output": "2"
},
{
"input": "29\n3\n3\n1",
"output": "14"
},
{
"input": "45\n9\n9\n8",
"output": "37"
},
{
"input": "45\n9\n9\n1",
"output": "5"
},
{
"input": "100\n10\n10\n9",
"output": "91"
},
{
"input": "179\n10\n9\n1",
"output": "22"
},
{
"input": "179\n2\n2\n1",
"output": "178"
},
{
"input": "179\n179\n179\n1",
"output": "1"
},
{
"input": "179\n59\n59\n58",
"output": "121"
},
{
"input": "500\n250\n250\n1",
"output": "2"
},
{
"input": "500\n1\n250\n1",
"output": "500"
},
{
"input": "501\n500\n500\n499",
"output": "2"
},
{
"input": "501\n450\n52\n1",
"output": "9"
},
{
"input": "501\n300\n301\n100",
"output": "2"
},
{
"input": "500\n179\n10\n1",
"output": "55"
},
{
"input": "1000\n500\n10\n9",
"output": "991"
},
{
"input": "1000\n2\n10\n9",
"output": "995"
},
{
"input": "1001\n1000\n1000\n999",
"output": "2"
},
{
"input": "10000\n10000\n10000\n1",
"output": "1"
},
{
"input": "10000\n10\n5000\n4999",
"output": "5500"
},
{
"input": "1000000000\n999999998\n999999999\n999999998",
"output": "3"
},
{
"input": "1000000000\n50\n50\n49",
"output": "999999951"
},
{
"input": "1000000000\n500\n5000\n4999",
"output": "999995010"
},
{
"input": "1000000000\n51\n100\n98",
"output": "499999952"
},
{
"input": "1000000000\n100\n51\n50",
"output": "999999950"
},
{
"input": "1000000000\n2\n5\n4",
"output": "999999998"
},
{
"input": "1000000000000000000\n999999998000000000\n999999999000000000\n999999998000000000",
"output": "3"
},
{
"input": "1000000000\n2\n2\n1",
"output": "999999999"
},
{
"input": "999999999\n2\n999999998\n1",
"output": "499999999"
},
{
"input": "999999999999999999\n2\n2\n1",
"output": "999999999999999998"
},
{
"input": "999999999999999999\n10\n10\n9",
"output": "999999999999999990"
},
{
"input": "999999999999999999\n999999999999999998\n999999999999999998\n999999999999999997",
"output": "2"
},
{
"input": "999999999999999999\n501\n501\n1",
"output": "1999999999999999"
},
{
"input": "999999999999999999\n2\n50000000000000000\n49999999999999999",
"output": "974999999999999999"
},
{
"input": "999999999999999999\n180\n180\n1",
"output": "5586592178770949"
},
{
"input": "1000000000000000000\n42\n41\n1",
"output": "24999999999999999"
},
{
"input": "1000000000000000000\n41\n40\n1",
"output": "25641025641025641"
},
{
"input": "100000000000000000\n79\n100\n25",
"output": "1333333333333333"
},
{
"input": "1\n100\n5\n4",
"output": "0"
},
{
"input": "1000000000000000000\n1000000000000000000\n10000000\n9999999",
"output": "999999999990000001"
},
{
"input": "999999999999999999\n999999999000000000\n900000000000000000\n899999999999999999",
"output": "100000000000000000"
},
{
"input": "13\n10\n15\n11",
"output": "1"
},
{
"input": "1\n1000\n5\n4",
"output": "0"
},
{
"input": "10\n100\n10\n1",
"output": "1"
},
{
"input": "3\n2\n100000\n99999",
"output": "1"
},
{
"input": "4\n2\n4\n2",
"output": "2"
},
{
"input": "5\n3\n6\n4",
"output": "1"
},
{
"input": "1\n7\n65\n49",
"output": "0"
},
{
"input": "10\n20\n100\n99",
"output": "0"
},
{
"input": "10000000000\n10000000000\n9000000000\n8999999999",
"output": "1000000001"
},
{
"input": "90\n30\n101\n100",
"output": "3"
},
{
"input": "999999999999999\n5\n500000000000000\n499999999999999",
"output": "599999999999999"
},
{
"input": "1000000000000000000\n1000000000000000000\n1000000000\n999999999",
"output": "999999999000000001"
},
{
"input": "1\n1000000000000000000\n1000000000\n999999999",
"output": "0"
},
{
"input": "100000000000000000\n100000000000000000\n1000000000\n999999999",
"output": "99999999000000001"
},
{
"input": "100000000000000009\n100\n1000000000000000\n999999999999999",
"output": "99010000000000009"
},
{
"input": "10\n20\n10\n9",
"output": "1"
},
{
"input": "10\n4\n14\n13",
"output": "2"
},
{
"input": "11\n3\n9\n7",
"output": "4"
},
{
"input": "1000000000\n5\n7\n4",
"output": "333333332"
},
{
"input": "12155\n1943\n28717\n24074",
"output": "6"
},
{
"input": "1000000000000000000\n10\n20\n5",
"output": "100000000000000000"
},
{
"input": "98\n33\n440\n314",
"output": "2"
},
{
"input": "1070252292\n57449678\n237309920\n221182550",
"output": "56"
},
{
"input": "100\n3\n102\n101",
"output": "33"
},
{
"input": "100000000000000000\n100000000000000001\n1000000000000000\n999999999999999",
"output": "99000000000000001"
},
{
"input": "66249876257975628\n302307316\n406102416\n182373516",
"output": "296116756"
},
{
"input": "10\n5\n10\n1",
"output": "2"
},
{
"input": "1000000000000000000\n10\n1000000000\n999999998",
"output": "499999999600000000"
}
] | 1,455,031,811
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 10
| 1,000
| 0
|
sum = 0
sumik = 0
ss = 0
ssu = 0
n = int(input())
a = int(input())
b = int(input())
c = int(input())
n1 = n
a1 = a
b1 = b
c1 = c
while (n >= a):
n = n - a
sum += 1
ss = sum
while(n1>= b1):
n1 = n1 - b1
n1 = n1 + c1
sumik += 1
ssu = sumik
print(max(ss, ssu))
|
Title: Guest From the Past
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kolya Gerasimov loves kefir very much. He lives in year 1984 and knows all the details of buying this delicious drink. One day, as you probably know, he found himself in year 2084, and buying kefir there is much more complicated.
Kolya is hungry, so he went to the nearest milk shop. In 2084 you may buy kefir in a plastic liter bottle, that costs *a* rubles, or in glass liter bottle, that costs *b* rubles. Also, you may return empty glass bottle and get *c* (*c*<=<<=*b*) rubles back, but you cannot return plastic bottles.
Kolya has *n* rubles and he is really hungry, so he wants to drink as much kefir as possible. There were no plastic bottles in his 1984, so Kolya doesn't know how to act optimally and asks for your help.
Input Specification:
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1018) — the number of rubles Kolya has at the beginning.
Then follow three lines containing integers *a*, *b* and *c* (1<=≤<=*a*<=≤<=1018, 1<=≤<=*c*<=<<=*b*<=≤<=1018) — the cost of one plastic liter bottle, the cost of one glass liter bottle and the money one can get back by returning an empty glass bottle, respectively.
Output Specification:
Print the only integer — maximum number of liters of kefir, that Kolya can drink.
Demo Input:
['10\n11\n9\n8\n', '10\n5\n6\n1\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample, Kolya can buy one glass bottle, then return it and buy one more glass bottle. Thus he will drink 2 liters of kefir.
In the second sample, Kolya can buy two plastic bottle and get two liters of kefir, or he can buy one liter glass bottle, then return it and buy one plastic bottle. In both cases he will drink two liters of kefir.
|
```python
sum = 0
sumik = 0
ss = 0
ssu = 0
n = int(input())
a = int(input())
b = int(input())
c = int(input())
n1 = n
a1 = a
b1 = b
c1 = c
while (n >= a):
n = n - a
sum += 1
ss = sum
while(n1>= b1):
n1 = n1 - b1
n1 = n1 + c1
sumik += 1
ssu = sumik
print(max(ss, ssu))
```
| 0
|
|
110
|
A
|
Nearly Lucky Number
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Nearly Lucky Number
|
2
|
256
|
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
|
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
|
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
|
[
"40047\n",
"7747774\n",
"1000000000000000000\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
| 500
|
[
{
"input": "40047",
"output": "NO"
},
{
"input": "7747774",
"output": "YES"
},
{
"input": "1000000000000000000",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "4",
"output": "NO"
},
{
"input": "474404774",
"output": "NO"
},
{
"input": "4744000695826",
"output": "YES"
},
{
"input": "10000000004744744",
"output": "YES"
},
{
"input": "446486416781684178",
"output": "YES"
},
{
"input": "999999999",
"output": "NO"
},
{
"input": "7777",
"output": "YES"
},
{
"input": "87414417444",
"output": "NO"
},
{
"input": "111222333444555667",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "4700",
"output": "NO"
},
{
"input": "3794555488744477",
"output": "NO"
},
{
"input": "444444444444444444",
"output": "NO"
},
{
"input": "474447447774444774",
"output": "NO"
},
{
"input": "777777777777777",
"output": "NO"
},
{
"input": "34777745021000000",
"output": "NO"
},
{
"input": "963",
"output": "NO"
},
{
"input": "855474448854788540",
"output": "NO"
},
{
"input": "999999999999994744",
"output": "YES"
},
{
"input": "400000000474",
"output": "YES"
},
{
"input": "123456789123456789",
"output": "YES"
},
{
"input": "740577777584945874",
"output": "NO"
},
{
"input": "7777777",
"output": "YES"
},
{
"input": "4444000111222333",
"output": "YES"
},
{
"input": "9847745885202111",
"output": "YES"
},
{
"input": "123456000000",
"output": "NO"
},
{
"input": "4744447444444",
"output": "NO"
},
{
"input": "7477",
"output": "YES"
},
{
"input": "4747477",
"output": "YES"
},
{
"input": "777777777444444444",
"output": "NO"
}
] | 1,694,294,830
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 3
| 124
| 0
|
x=input()
n=0
for i in x:
if(i=="7" or i=="4"):
continue
else:
n+=1
break
if (n==0):
print("YES")
else:
print("NO")
|
Title: Nearly Lucky Number
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Unfortunately, not all numbers are lucky. Petya calls a number nearly lucky if the number of lucky digits in it is a lucky number. He wonders whether number *n* is a nearly lucky number.
Input Specification:
The only line contains an integer *n* (1<=≤<=*n*<=≤<=1018).
Please do not use the %lld specificator to read or write 64-bit numbers in С++. It is preferred to use the cin, cout streams or the %I64d specificator.
Output Specification:
Print on the single line "YES" if *n* is a nearly lucky number. Otherwise, print "NO" (without the quotes).
Demo Input:
['40047\n', '7747774\n', '1000000000000000000\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
In the first sample there are 3 lucky digits (first one and last two), so the answer is "NO".
In the second sample there are 7 lucky digits, 7 is lucky number, so the answer is "YES".
In the third sample there are no lucky digits, so the answer is "NO".
|
```python
x=input()
n=0
for i in x:
if(i=="7" or i=="4"):
continue
else:
n+=1
break
if (n==0):
print("YES")
else:
print("NO")
```
| 0
|
525
|
C
|
Ilya and Sticks
|
PROGRAMMING
| 1,600
|
[
"greedy",
"math",
"sortings"
] | null | null |
In the evening, after the contest Ilya was bored, and he really felt like maximizing. He remembered that he had a set of *n* sticks and an instrument. Each stick is characterized by its length *l**i*.
Ilya decided to make a rectangle from the sticks. And due to his whim, he decided to make rectangles in such a way that maximizes their total area. Each stick is used in making at most one rectangle, it is possible that some of sticks remain unused. Bending sticks is not allowed.
Sticks with lengths *a*1, *a*2, *a*3 and *a*4 can make a rectangle if the following properties are observed:
- *a*1<=≤<=*a*2<=≤<=*a*3<=≤<=*a*4 - *a*1<==<=*a*2 - *a*3<==<=*a*4
A rectangle can be made of sticks with lengths of, for example, 3 3 3 3 or 2 2 4 4. A rectangle cannot be made of, for example, sticks 5 5 5 7.
Ilya also has an instrument which can reduce the length of the sticks. The sticks are made of a special material, so the length of each stick can be reduced by at most one. For example, a stick with length 5 can either stay at this length or be transformed into a stick of length 4.
You have to answer the question — what maximum total area of the rectangles can Ilya get with a file if makes rectangles from the available sticks?
|
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of the available sticks.
The second line of the input contains *n* positive integers *l**i* (2<=≤<=*l**i*<=≤<=106) — the lengths of the sticks.
|
The first line of the output must contain a single non-negative integer — the maximum total area of the rectangles that Ilya can make from the available sticks.
|
[
"4\n2 4 4 2\n",
"4\n2 2 3 5\n",
"4\n100003 100004 100005 100006\n"
] |
[
"8\n",
"0\n",
"10000800015\n"
] |
none
| 1,000
|
[
{
"input": "4\n2 4 4 2",
"output": "8"
},
{
"input": "4\n2 2 3 5",
"output": "0"
},
{
"input": "4\n100003 100004 100005 100006",
"output": "10000800015"
},
{
"input": "8\n5 3 3 3 3 4 4 4",
"output": "25"
},
{
"input": "10\n123 124 123 124 2 2 2 2 9 9",
"output": "15270"
},
{
"input": "8\n10 10 10 10 11 10 11 10",
"output": "210"
},
{
"input": "1\n1000000",
"output": "0"
},
{
"input": "10\n10519 10519 10520 10520 10520 10521 10521 10521 10522 10523",
"output": "221372362"
},
{
"input": "100\n4116 4116 4117 4117 4117 4117 4118 4119 4119 4119 4119 4120 4120 4120 4120 4121 4122 4123 4123 4123 4123 4124 4124 4124 4124 4125 4126 4126 4126 4126 4127 4127 4127 4127 4128 4128 4128 4128 4129 4129 4130 4130 4131 4132 4133 4133 4134 4134 4135 4135 4136 4137 4137 4137 4138 4139 4140 4140 4141 4141 4142 4143 4143 4143 4144 4144 4144 4144 4145 4145 4145 4146 4146 4146 4147 4147 4147 4147 4148 4148 4148 4149 4149 4149 4150 4151 4151 4151 4152 4152 4153 4153 4154 4154 4155 4155 4155 4155 4156 4156",
"output": "427591742"
},
{
"input": "10\n402840 873316 567766 493234 711262 291654 683001 496971 64909 190173",
"output": "0"
},
{
"input": "45\n1800 4967 1094 551 871 3505 846 960 4868 4304 2112 496 2293 2128 2430 2119 4497 2159 774 4520 3535 1013 452 1458 1895 1191 958 1133 416 2613 4172 3926 1665 4237 539 101 2448 1212 2631 4530 3026 412 1006 2515 1922",
"output": "0"
},
{
"input": "69\n2367 2018 3511 1047 1789 2332 1082 4678 2036 4108 2357 339 536 2272 3638 2588 754 3795 375 506 3243 1033 4531 1216 4266 2547 3540 4642 1256 2248 4705 14 629 876 2304 1673 4186 2356 3172 2664 3896 552 4293 1507 3307 2661 3143 4565 58 1298 4380 2738 917 2054 2676 4464 1314 3752 3378 1823 4219 3142 4258 1833 886 4286 4040 1070 2206",
"output": "7402552"
},
{
"input": "93\n13 2633 3005 1516 2681 3262 1318 1935 665 2450 2601 1644 214 929 4873 955 1983 3945 3488 2927 1516 1026 2150 974 150 2442 2610 1664 636 3369 266 2536 3132 2515 2582 1169 4462 4961 200 2848 4793 2795 4657 474 2640 2488 378 544 1805 1390 1548 2683 1474 4027 1724 2078 183 3717 1727 1780 552 2905 4260 1444 2906 3779 400 1491 1467 4480 3680 2539 4681 2875 4021 2711 106 853 3094 4531 4066 372 2129 2577 3996 2350 943 4478 3058 3333 4592 232 2780",
"output": "4403980"
},
{
"input": "21\n580 3221 3987 2012 35 629 1554 654 756 2254 4307 2948 3457 4612 4620 4320 1777 556 3088 348 1250",
"output": "0"
},
{
"input": "45\n4685 272 3481 3942 952 3020 329 4371 2923 2057 4526 2791 1674 3269 829 2713 3006 2166 1228 2795 983 1065 3875 4028 3429 3720 697 734 4393 1176 2820 1173 4598 2281 2549 4341 1504 172 4230 1193 3022 3742 1232 3433 1871",
"output": "0"
},
{
"input": "69\n3766 2348 4437 4438 3305 386 2026 1629 1552 400 4770 4069 4916 1926 2037 1079 2801 854 803 216 2152 4622 1494 3786 775 3615 4766 2781 235 836 1892 2234 3563 1843 4314 3836 320 2776 4796 1378 380 2421 3057 964 4717 1122 620 530 3455 1639 1618 3109 3120 564 2382 1995 1173 4510 286 1088 218 734 2779 3738 456 1668 4476 2780 3555",
"output": "12334860"
},
{
"input": "4\n2 2 2 4",
"output": "0"
},
{
"input": "8\n10 10 10 11 14 14 14 16",
"output": "140"
},
{
"input": "2\n2 3",
"output": "0"
},
{
"input": "3\n2 3 5",
"output": "0"
},
{
"input": "8\n2 1000000 2 1000000 2 1000000 2 1000000",
"output": "1000000000004"
},
{
"input": "4\n2 4 6 8",
"output": "0"
},
{
"input": "4\n2 3 6 8",
"output": "0"
},
{
"input": "5\n2 2 3 4 5",
"output": "8"
},
{
"input": "5\n1000000 999999 999999 999999 999999",
"output": "999998000001"
},
{
"input": "6\n2 2 2 2 2 2",
"output": "4"
},
{
"input": "4\n2 4 5 5",
"output": "0"
},
{
"input": "20\n4 4 8 4 5 6 7 4 5 4 6 4 4 5 7 6 5 8 8 4",
"output": "149"
},
{
"input": "10\n8 4 6 6 8 5 7 7 6 8",
"output": "92"
},
{
"input": "11\n4 4 9 9 3 8 8 8 6 4 3",
"output": "84"
},
{
"input": "8\n2 3 3 4 4 5 5 5",
"output": "26"
},
{
"input": "4\n3 3 3 2",
"output": "6"
},
{
"input": "5\n3 3 10 100 100",
"output": "300"
},
{
"input": "8\n9 9 9 8 8 7 7 6",
"output": "114"
},
{
"input": "4\n5 6 6 7",
"output": "30"
},
{
"input": "5\n9 9 5 2 2",
"output": "18"
},
{
"input": "6\n3 4 100 200 1001 1002",
"output": "3003"
},
{
"input": "6\n3 4 5 100 101 102",
"output": "404"
},
{
"input": "5\n2 2 4 6 6",
"output": "12"
},
{
"input": "6\n2 3 8 10 13 14",
"output": "26"
},
{
"input": "7\n2 2 2 2 2 2 2",
"output": "4"
},
{
"input": "5\n5 2 2 2 2",
"output": "4"
},
{
"input": "6\n3 4 100 200 1000 1001",
"output": "3000"
},
{
"input": "5\n5 5 7 9 9",
"output": "45"
},
{
"input": "5\n8 8 7 4 4",
"output": "32"
},
{
"input": "5\n2 2 5 8 9",
"output": "16"
},
{
"input": "5\n4 4 4 2 2",
"output": "8"
},
{
"input": "5\n3 10 100 1000 10000",
"output": "0"
},
{
"input": "6\n10 10 7 4 2 2",
"output": "20"
},
{
"input": "6\n5 5 7 9 10 10",
"output": "50"
},
{
"input": "7\n10 10 7 5 3 2 2",
"output": "20"
},
{
"input": "7\n10 9 9 9 9 2 2",
"output": "81"
}
] | 1,580,590,261
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 171
| 0
|
from collections import *
from operator import itemgetter
def remove():
tem = all.copy()
for i, j in tem:
if j <= 1:
extra.append(all.popleft())
else:
all.rotate(-1)
def even():
global ans
for i in range(len(all)):
ans += all[i][0] * all[i][0] * (all[i][1] // 4)
all[i][1] %= 4
if all[i][1] == 1:
extra.append(all[i])
else:
if i < len(all) - 1 and all[i][1] >= 2:
ans += all[i][0] * all[i + 1][0]
all[i][1] -= 2
all[i + 1][1] -= 2
if all[i][1] > 0:
extra.append(all[i])
else:
if all[i][1] > 0:
extra.append(all[i])
return deque(sorted(extra, key=itemgetter(0, 1), reverse=True))
def merge():
tem, l = deque([]), len(extra)
while (extra):
if extra[0][1] > 1:
tem.append(extra.popleft())
elif len(extra) > 1 and extra[0][0] - 1 == extra[1][0]:
extra[1][1] += 1
extra.popleft()
tem.append(extra.popleft())
else:
extra.popleft()
return tem
def solve():
global ans
remove()
extra = even()
tem = merge()
for i in range(1, len(tem), 2):
ans += tem[i][0] * tem[i - 1][0]
return ans
n, a = int(input()), list(map(int, input().split()))
c = Counter(a)
all, extra, ans = deque(sorted([[x, y] for x, y in c.items()], key=itemgetter(0, 1), reverse=True)), deque([]), 0
print(solve())
|
Title: Ilya and Sticks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the evening, after the contest Ilya was bored, and he really felt like maximizing. He remembered that he had a set of *n* sticks and an instrument. Each stick is characterized by its length *l**i*.
Ilya decided to make a rectangle from the sticks. And due to his whim, he decided to make rectangles in such a way that maximizes their total area. Each stick is used in making at most one rectangle, it is possible that some of sticks remain unused. Bending sticks is not allowed.
Sticks with lengths *a*1, *a*2, *a*3 and *a*4 can make a rectangle if the following properties are observed:
- *a*1<=≤<=*a*2<=≤<=*a*3<=≤<=*a*4 - *a*1<==<=*a*2 - *a*3<==<=*a*4
A rectangle can be made of sticks with lengths of, for example, 3 3 3 3 or 2 2 4 4. A rectangle cannot be made of, for example, sticks 5 5 5 7.
Ilya also has an instrument which can reduce the length of the sticks. The sticks are made of a special material, so the length of each stick can be reduced by at most one. For example, a stick with length 5 can either stay at this length or be transformed into a stick of length 4.
You have to answer the question — what maximum total area of the rectangles can Ilya get with a file if makes rectangles from the available sticks?
Input Specification:
The first line of the input contains a positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of the available sticks.
The second line of the input contains *n* positive integers *l**i* (2<=≤<=*l**i*<=≤<=106) — the lengths of the sticks.
Output Specification:
The first line of the output must contain a single non-negative integer — the maximum total area of the rectangles that Ilya can make from the available sticks.
Demo Input:
['4\n2 4 4 2\n', '4\n2 2 3 5\n', '4\n100003 100004 100005 100006\n']
Demo Output:
['8\n', '0\n', '10000800015\n']
Note:
none
|
```python
from collections import *
from operator import itemgetter
def remove():
tem = all.copy()
for i, j in tem:
if j <= 1:
extra.append(all.popleft())
else:
all.rotate(-1)
def even():
global ans
for i in range(len(all)):
ans += all[i][0] * all[i][0] * (all[i][1] // 4)
all[i][1] %= 4
if all[i][1] == 1:
extra.append(all[i])
else:
if i < len(all) - 1 and all[i][1] >= 2:
ans += all[i][0] * all[i + 1][0]
all[i][1] -= 2
all[i + 1][1] -= 2
if all[i][1] > 0:
extra.append(all[i])
else:
if all[i][1] > 0:
extra.append(all[i])
return deque(sorted(extra, key=itemgetter(0, 1), reverse=True))
def merge():
tem, l = deque([]), len(extra)
while (extra):
if extra[0][1] > 1:
tem.append(extra.popleft())
elif len(extra) > 1 and extra[0][0] - 1 == extra[1][0]:
extra[1][1] += 1
extra.popleft()
tem.append(extra.popleft())
else:
extra.popleft()
return tem
def solve():
global ans
remove()
extra = even()
tem = merge()
for i in range(1, len(tem), 2):
ans += tem[i][0] * tem[i - 1][0]
return ans
n, a = int(input()), list(map(int, input().split()))
c = Counter(a)
all, extra, ans = deque(sorted([[x, y] for x, y in c.items()], key=itemgetter(0, 1), reverse=True)), deque([]), 0
print(solve())
```
| 0
|
|
515
|
C
|
Drazil and Factorial
|
PROGRAMMING
| 1,400
|
[
"greedy",
"math",
"sortings"
] | null | null |
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
|
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
|
[
"4\n1234\n",
"3\n555\n"
] |
[
"33222\n",
"555\n"
] |
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
| 1,000
|
[
{
"input": "4\n1234",
"output": "33222"
},
{
"input": "3\n555",
"output": "555"
},
{
"input": "15\n012345781234578",
"output": "7777553333222222222222"
},
{
"input": "1\n8",
"output": "7222"
},
{
"input": "10\n1413472614",
"output": "75333332222222"
},
{
"input": "8\n68931246",
"output": "77553333332222222"
},
{
"input": "7\n4424368",
"output": "75333332222222222"
},
{
"input": "6\n576825",
"output": "7755532222"
},
{
"input": "5\n97715",
"output": "7775332"
},
{
"input": "3\n915",
"output": "75332"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "15\n028745260720699",
"output": "7777755533333332222222222"
},
{
"input": "13\n5761790121605",
"output": "7775555333322"
},
{
"input": "10\n3312667105",
"output": "755533332"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "15\n989898989898989",
"output": "777777777777777333333333333333322222222222222222222222222222"
},
{
"input": "15\n000000000000007",
"output": "7"
},
{
"input": "15\n999999999999990",
"output": "77777777777777333333333333333333333333333322222222222222"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "1\n3",
"output": "3"
},
{
"input": "1\n4",
"output": "322"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n6",
"output": "53"
},
{
"input": "1\n7",
"output": "7"
},
{
"input": "1\n9",
"output": "7332"
},
{
"input": "2\n09",
"output": "7332"
},
{
"input": "13\n1337251172966",
"output": "777555333333222"
},
{
"input": "15\n987654329876543",
"output": "777777555533333333332222222222222"
},
{
"input": "9\n234567899",
"output": "777755333333322222222"
},
{
"input": "2\n99",
"output": "77333322"
},
{
"input": "2\n66",
"output": "5533"
},
{
"input": "3\n999",
"output": "777333333222"
},
{
"input": "5\n99999",
"output": "77777333333333322222"
},
{
"input": "9\n123456789",
"output": "77755333332222222"
},
{
"input": "9\n987654321",
"output": "77755333332222222"
},
{
"input": "3\n666",
"output": "555333"
},
{
"input": "2\n26",
"output": "532"
},
{
"input": "6\n555777",
"output": "777555"
},
{
"input": "10\n1234567899",
"output": "777755333333322222222"
},
{
"input": "4\n6666",
"output": "55553333"
},
{
"input": "4\n9754",
"output": "775333222"
},
{
"input": "2\n95",
"output": "75332"
},
{
"input": "14\n11122233344455",
"output": "55333333222222222"
},
{
"input": "12\n836544897832",
"output": "77777553333333222222222222222"
}
] | 1,657,720,706
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 61
| 0
|
l=["","","2","3","322","5","53","7","7222","7332"]
n=int(input())
s,k=input(),""
for i in range(n):
k+=l[int(s[i])]
k=list(k)
k.sort(reverse=True)
print(*k, sep="")
|
Title: Drazil and Factorial
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Drazil is playing a math game with Varda.
Let's define for positive integer *x* as a product of factorials of its digits. For example, .
First, they choose a decimal number *a* consisting of *n* digits that contains at least one digit larger than 1. This number may possibly start with leading zeroes. Then they should find maximum positive number *x* satisfying following two conditions:
1. *x* doesn't contain neither digit 0 nor digit 1.
2. = .
Help friends find such number.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=15) — the number of digits in *a*.
The second line contains *n* digits of *a*. There is at least one digit in *a* that is larger than 1. Number *a* may possibly contain leading zeroes.
Output Specification:
Output a maximum possible integer satisfying the conditions above. There should be no zeroes and ones in this number decimal representation.
Demo Input:
['4\n1234\n', '3\n555\n']
Demo Output:
['33222\n', '555\n']
Note:
In the first case, <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/f5a4207f23215fddce977ab5ea9e9d2e7578fb52.png" style="max-width: 100.0%;max-height: 100.0%;"/>
|
```python
l=["","","2","3","322","5","53","7","7222","7332"]
n=int(input())
s,k=input(),""
for i in range(n):
k+=l[int(s[i])]
k=list(k)
k.sort(reverse=True)
print(*k, sep="")
```
| 3
|
|
687
|
B
|
Remainders Game
|
PROGRAMMING
| 1,800
|
[
"chinese remainder theorem",
"math",
"number theory"
] | null | null |
Today Pari and Arya are playing a game called Remainders.
Pari chooses two positive integer *x* and *k*, and tells Arya *k* but not *x*. Arya have to find the value . There are *n* ancient numbers *c*1,<=*c*2,<=...,<=*c**n* and Pari has to tell Arya if Arya wants. Given *k* and the ancient values, tell us if Arya has a winning strategy independent of value of *x* or not. Formally, is it true that Arya can understand the value for any positive integer *x*?
Note, that means the remainder of *x* after dividing it by *y*.
|
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<= *k*<=≤<=1<=000<=000) — the number of ancient integers and value *k* that is chosen by Pari.
The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=1<=000<=000).
|
Print "Yes" (without quotes) if Arya has a winning strategy independent of value of *x*, or "No" (without quotes) otherwise.
|
[
"4 5\n2 3 5 12\n",
"2 7\n2 3\n"
] |
[
"Yes\n",
"No\n"
] |
In the first sample, Arya can understand <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d170efffcde0907ee6bcf32de21051bce0677a2c.png" style="max-width: 100.0%;max-height: 100.0%;"/> because 5 is one of the ancient numbers.
In the second sample, Arya can't be sure what <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/57b5f6a96f5db073270dd3ed4266c69299ec701d.png" style="max-width: 100.0%;max-height: 100.0%;"/> is. For example 1 and 7 have the same remainders after dividing by 2 and 3, but they differ in remainders after dividing by 7.
| 1,000
|
[
{
"input": "4 5\n2 3 5 12",
"output": "Yes"
},
{
"input": "2 7\n2 3",
"output": "No"
},
{
"input": "1 6\n8",
"output": "No"
},
{
"input": "2 3\n9 4",
"output": "Yes"
},
{
"input": "4 16\n19 16 13 9",
"output": "Yes"
},
{
"input": "5 10\n5 16 19 9 17",
"output": "Yes"
},
{
"input": "11 95\n31 49 8 139 169 121 71 17 43 29 125",
"output": "No"
},
{
"input": "17 71\n173 43 139 73 169 199 49 81 11 89 131 107 23 29 125 152 17",
"output": "No"
},
{
"input": "13 86\n41 64 17 31 13 97 19 25 81 47 61 37 71",
"output": "No"
},
{
"input": "15 91\n49 121 83 67 128 125 27 113 41 169 149 19 37 29 71",
"output": "Yes"
},
{
"input": "2 4\n2 2",
"output": "No"
},
{
"input": "14 87\n1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619",
"output": "No"
},
{
"input": "12 100\n1766 1766 1766 1766 1766 1766 1766 1766 1766 1766 1766 1766",
"output": "No"
},
{
"input": "1 994619\n216000",
"output": "No"
},
{
"input": "1 651040\n911250",
"output": "No"
},
{
"input": "1 620622\n60060",
"output": "No"
},
{
"input": "1 1\n559872",
"output": "Yes"
},
{
"input": "88 935089\n967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967",
"output": "No"
},
{
"input": "93 181476\n426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426",
"output": "No"
},
{
"input": "91 4900\n630 630 70 630 910 630 630 630 770 70 770 630 630 770 70 630 70 630 70 630 70 630 630 70 910 630 630 630 770 630 630 630 70 910 70 630 70 630 770 630 630 70 630 770 70 630 70 70 630 630 70 70 70 70 630 70 70 770 910 630 70 630 770 70 910 70 630 910 630 70 770 70 70 630 770 630 70 630 70 70 630 70 630 770 630 70 630 630 70 910 630",
"output": "No"
},
{
"input": "61 531012\n698043 698043 698043 963349 698043 698043 698043 963349 698043 698043 698043 963349 698043 698043 698043 698043 966694 698043 698043 698043 698043 698043 698043 636247 698043 963349 698043 698043 698043 698043 697838 698043 963349 698043 698043 966694 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 963349 698043 698043 698043 698043 963349 698043",
"output": "No"
},
{
"input": "1 216000\n648000",
"output": "Yes"
},
{
"input": "2 8\n4 4",
"output": "No"
},
{
"input": "3 8\n4 4 4",
"output": "No"
},
{
"input": "2 8\n2 4",
"output": "No"
},
{
"input": "3 12\n2 2 3",
"output": "No"
},
{
"input": "10 4\n2 2 2 2 2 2 2 2 2 2",
"output": "No"
},
{
"input": "10 1024\n1 2 4 8 16 32 64 128 256 512",
"output": "No"
},
{
"input": "3 24\n2 2 3",
"output": "No"
},
{
"input": "1 8\n2",
"output": "No"
},
{
"input": "2 9\n3 3",
"output": "No"
},
{
"input": "3 4\n2 2 2",
"output": "No"
},
{
"input": "3 4\n1 2 2",
"output": "No"
},
{
"input": "1 4\n2",
"output": "No"
},
{
"input": "1 100003\n2",
"output": "No"
},
{
"input": "1 2\n12",
"output": "Yes"
},
{
"input": "2 988027\n989018 995006",
"output": "Yes"
},
{
"input": "3 9\n3 3 3",
"output": "No"
},
{
"input": "1 49\n7",
"output": "No"
},
{
"input": "2 600000\n200000 300000",
"output": "Yes"
},
{
"input": "3 8\n2 2 2",
"output": "No"
},
{
"input": "7 510510\n524288 531441 390625 823543 161051 371293 83521",
"output": "Yes"
},
{
"input": "2 30\n6 10",
"output": "Yes"
},
{
"input": "2 27000\n5400 4500",
"output": "Yes"
},
{
"input": "3 8\n1 2 4",
"output": "No"
},
{
"input": "4 16\n2 2 2 2",
"output": "No"
},
{
"input": "2 16\n4 8",
"output": "No"
},
{
"input": "2 8\n4 2",
"output": "No"
},
{
"input": "3 4\n2 2 3",
"output": "No"
},
{
"input": "1 8\n4",
"output": "No"
},
{
"input": "1 999983\n2",
"output": "No"
},
{
"input": "3 16\n2 4 8",
"output": "No"
},
{
"input": "2 216\n12 18",
"output": "No"
},
{
"input": "2 16\n8 8",
"output": "No"
},
{
"input": "2 36\n18 12",
"output": "Yes"
},
{
"input": "2 36\n12 18",
"output": "Yes"
},
{
"input": "2 1000000\n1000000 1000000",
"output": "Yes"
},
{
"input": "3 20\n2 2 5",
"output": "No"
},
{
"input": "1 2\n6",
"output": "Yes"
},
{
"input": "4 4\n2 3 6 5",
"output": "No"
},
{
"input": "1 2\n1",
"output": "No"
},
{
"input": "1 6\n6",
"output": "Yes"
},
{
"input": "2 16\n4 4",
"output": "No"
},
{
"input": "2 3779\n1 2",
"output": "No"
},
{
"input": "2 8\n4 12",
"output": "No"
},
{
"input": "2 24\n4 6",
"output": "No"
},
{
"input": "1 1\n5",
"output": "Yes"
},
{
"input": "10 255255\n1000000 700000 300000 110000 130000 170000 190000 230000 290000 310000",
"output": "Yes"
},
{
"input": "2 1000\n500 2",
"output": "No"
},
{
"input": "4 8\n2 2 2 2",
"output": "No"
},
{
"input": "1 666013\n1",
"output": "No"
},
{
"input": "1 999983\n1",
"output": "No"
},
{
"input": "1 125\n5",
"output": "No"
},
{
"input": "2 32\n4 8",
"output": "No"
},
{
"input": "3 32\n2 4 8",
"output": "No"
},
{
"input": "3 8\n2 4 11",
"output": "No"
},
{
"input": "1 32\n2",
"output": "No"
},
{
"input": "4 4\n2 2 2 2",
"output": "No"
},
{
"input": "8 32\n2 2 2 2 2 2 2 2",
"output": "No"
},
{
"input": "3 24\n2 4 3",
"output": "No"
},
{
"input": "2 4\n2 6",
"output": "No"
},
{
"input": "2 24\n6 4",
"output": "No"
},
{
"input": "1 20998\n2",
"output": "No"
},
{
"input": "1 1\n1",
"output": "Yes"
},
{
"input": "2 20998\n2 10499",
"output": "Yes"
},
{
"input": "1 5\n1",
"output": "No"
},
{
"input": "2 25\n5 5",
"output": "No"
},
{
"input": "5 2\n2 2 2 2 2",
"output": "Yes"
},
{
"input": "3 12\n2 3 6",
"output": "No"
},
{
"input": "1 1\n3",
"output": "Yes"
},
{
"input": "2 16\n8 4",
"output": "No"
},
{
"input": "40 10\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "No"
}
] | 1,608,082,174
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 17
| 374
| 11,673,600
|
from typing import List
def MCD(a,b):
while(b):
a,b = b, a % b
return a
def MCM(a,b):
mcd=MCD(a,b)
result=a*b/mcd
return result
def MCMList(list,list_count,k):
copy=k
mcm=1
pointer=list_count-1
while 1:
if pointer<0:break
temp=list[pointer]
if mcm<k:
mcm=MCM(temp,mcm)
mcd=MCD(temp,copy)
copy=copy/mcd
if copy==1:
if mcm>k:return True
else: return False
pointer-=1
if copy==1:
if mcm>k:return True
else: return False
def RemaindersGame():
n,k=map(int, input().split())
anciest=list(map(lambda x: int(x), input().split()))
bool=MCMList(anciest,n,k)
if bool:
print("Yes")
else:
print("No")
RemaindersGame()
|
Title: Remainders Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today Pari and Arya are playing a game called Remainders.
Pari chooses two positive integer *x* and *k*, and tells Arya *k* but not *x*. Arya have to find the value . There are *n* ancient numbers *c*1,<=*c*2,<=...,<=*c**n* and Pari has to tell Arya if Arya wants. Given *k* and the ancient values, tell us if Arya has a winning strategy independent of value of *x* or not. Formally, is it true that Arya can understand the value for any positive integer *x*?
Note, that means the remainder of *x* after dividing it by *y*.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<= *k*<=≤<=1<=000<=000) — the number of ancient integers and value *k* that is chosen by Pari.
The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=1<=000<=000).
Output Specification:
Print "Yes" (without quotes) if Arya has a winning strategy independent of value of *x*, or "No" (without quotes) otherwise.
Demo Input:
['4 5\n2 3 5 12\n', '2 7\n2 3\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first sample, Arya can understand <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d170efffcde0907ee6bcf32de21051bce0677a2c.png" style="max-width: 100.0%;max-height: 100.0%;"/> because 5 is one of the ancient numbers.
In the second sample, Arya can't be sure what <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/57b5f6a96f5db073270dd3ed4266c69299ec701d.png" style="max-width: 100.0%;max-height: 100.0%;"/> is. For example 1 and 7 have the same remainders after dividing by 2 and 3, but they differ in remainders after dividing by 7.
|
```python
from typing import List
def MCD(a,b):
while(b):
a,b = b, a % b
return a
def MCM(a,b):
mcd=MCD(a,b)
result=a*b/mcd
return result
def MCMList(list,list_count,k):
copy=k
mcm=1
pointer=list_count-1
while 1:
if pointer<0:break
temp=list[pointer]
if mcm<k:
mcm=MCM(temp,mcm)
mcd=MCD(temp,copy)
copy=copy/mcd
if copy==1:
if mcm>k:return True
else: return False
pointer-=1
if copy==1:
if mcm>k:return True
else: return False
def RemaindersGame():
n,k=map(int, input().split())
anciest=list(map(lambda x: int(x), input().split()))
bool=MCMList(anciest,n,k)
if bool:
print("Yes")
else:
print("No")
RemaindersGame()
```
| 0
|
|
289
|
B
|
Polo the Penguin and Matrix
|
PROGRAMMING
| 1,400
|
[
"brute force",
"dp",
"implementation",
"sortings",
"ternary search"
] | null | null |
Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*.
In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so.
|
The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104).
|
In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes).
|
[
"2 2 2\n2 4\n6 8\n",
"1 2 7\n6 7\n"
] |
[
"4\n",
"-1\n"
] |
none
| 1,000
|
[
{
"input": "2 2 2\n2 4\n6 8",
"output": "4"
},
{
"input": "1 2 7\n6 7",
"output": "-1"
},
{
"input": "3 2 1\n5 7\n1 2\n5 100",
"output": "104"
},
{
"input": "3 3 3\n5 8 5\n11 11 17\n14 5 2",
"output": "12"
},
{
"input": "3 3 3\n5 8 5\n11 11 17\n14 5 3",
"output": "-1"
},
{
"input": "2 2 4\n5 5\n5 5",
"output": "0"
},
{
"input": "7 4 5\n7 7 7 12\n7 12 12 7\n7 7 7 7\n7 7 12 7\n7 7 12 12\n12 12 7 12\n7 7 7 7",
"output": "9"
},
{
"input": "7 7 47\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91\n91 91 91 91 91 91 91",
"output": "0"
},
{
"input": "7 7 47\n47 47 47 47 47 47 47\n47 47 47 47 77 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 47 47\n47 47 47 47 47 127 47",
"output": "-1"
},
{
"input": "7 5 47\n9583 1734 4601 5353 2110\n3802 5165 7985 6293 324\n7045 653 9160 7891 4930\n1781 3520 4178 2298 3943\n1405 2956 5447 5494 6528\n3097 1640 7750 4883 8032\n4225 8455 1875 4789 4366",
"output": "1508"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 1 8\n12",
"output": "0"
}
] | 1,515,082,425
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 122
| 5,529,600
|
import sys
array = []
n, m, d = input().split()
n, m, d = int(n), int(m), int(d)
sum = 0
for i in range(n):
array += list(map(int, input().split()))
for j in range(m*n):
sum += array[j]
if sum % d != 0:
print('-1')
else:
memo = {}
ans = sys.maxsize
for i in range(n*m):
iterations = 0
for j in range(n*m):
if (array[j], array[i]) in memo:
iterations = memo[(array[j], array[i])]
else:
target = array[i]
element = array[j]
if element > target:
val = (element - target) // d
else:
val = (target - element) // d
memo[(element, target)] = val
iterations += val
if ans > iterations:
ans = iterations
print(ans)
|
Title: Polo the Penguin and Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little penguin Polo has an *n*<=×<=*m* matrix, consisting of integers. Let's index the matrix rows from 1 to *n* from top to bottom and let's index the columns from 1 to *m* from left to right. Let's represent the matrix element on the intersection of row *i* and column *j* as *a**ij*.
In one move the penguin can add or subtract number *d* from some matrix element. Find the minimum number of moves needed to make all matrix elements equal. If the described plan is impossible to carry out, say so.
Input Specification:
The first line contains three integers *n*, *m* and *d* (1<=≤<=*n*,<=*m*<=≤<=100,<=1<=≤<=*d*<=≤<=104) — the matrix sizes and the *d* parameter. Next *n* lines contain the matrix: the *j*-th integer in the *i*-th row is the matrix element *a**ij* (1<=≤<=*a**ij*<=≤<=104).
Output Specification:
In a single line print a single integer — the minimum number of moves the penguin needs to make all matrix elements equal. If that is impossible, print "-1" (without the quotes).
Demo Input:
['2 2 2\n2 4\n6 8\n', '1 2 7\n6 7\n']
Demo Output:
['4\n', '-1\n']
Note:
none
|
```python
import sys
array = []
n, m, d = input().split()
n, m, d = int(n), int(m), int(d)
sum = 0
for i in range(n):
array += list(map(int, input().split()))
for j in range(m*n):
sum += array[j]
if sum % d != 0:
print('-1')
else:
memo = {}
ans = sys.maxsize
for i in range(n*m):
iterations = 0
for j in range(n*m):
if (array[j], array[i]) in memo:
iterations = memo[(array[j], array[i])]
else:
target = array[i]
element = array[j]
if element > target:
val = (element - target) // d
else:
val = (target - element) // d
memo[(element, target)] = val
iterations += val
if ans > iterations:
ans = iterations
print(ans)
```
| 0
|
|
961
|
B
|
Lecture Sleep
|
PROGRAMMING
| 1,200
|
[
"data structures",
"dp",
"implementation",
"two pointers"
] | null | null |
Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute.
Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing.
You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells.
You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
|
The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake.
The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute.
The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture.
|
Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
|
[
"6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n"
] |
[
"16\n"
] |
In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.
| 0
|
[
{
"input": "6 3\n1 3 5 2 5 4\n1 1 0 1 0 0",
"output": "16"
},
{
"input": "5 3\n1 9999 10000 10000 10000\n0 0 0 0 0",
"output": "30000"
},
{
"input": "3 3\n10 10 10\n1 1 0",
"output": "30"
},
{
"input": "1 1\n423\n0",
"output": "423"
},
{
"input": "6 6\n1 3 5 2 5 4\n1 1 0 1 0 0",
"output": "20"
},
{
"input": "5 2\n1 2 3 4 20\n0 0 0 1 0",
"output": "24"
},
{
"input": "3 1\n1 2 3\n0 0 1",
"output": "5"
},
{
"input": "4 2\n4 5 6 8\n1 0 1 0",
"output": "18"
},
{
"input": "6 3\n1 3 5 2 1 15\n1 1 0 1 0 0",
"output": "22"
},
{
"input": "5 5\n1 2 3 4 5\n1 1 1 0 1",
"output": "15"
},
{
"input": "3 3\n3 3 3\n1 0 1",
"output": "9"
},
{
"input": "5 5\n500 44 3 4 50\n1 0 0 0 0",
"output": "601"
},
{
"input": "2 2\n3 2\n1 0",
"output": "5"
},
{
"input": "7 6\n4 9 1 7 1 8 4\n0 0 0 1 0 1 0",
"output": "30"
},
{
"input": "4 3\n6 5 9 6\n1 1 0 1",
"output": "26"
},
{
"input": "2 1\n3 2\n0 0",
"output": "3"
},
{
"input": "1 1\n10\n0",
"output": "10"
},
{
"input": "2 1\n3 2\n1 0",
"output": "5"
},
{
"input": "4 2\n3 6 7 2\n0 0 1 1",
"output": "18"
},
{
"input": "10 5\n3 5 9 2 5 9 3 8 8 1\n0 1 1 1 0 1 0 0 0 0",
"output": "49"
},
{
"input": "10 4\n9 5 6 4 3 9 5 1 10 7\n0 0 0 0 0 0 1 0 0 1",
"output": "36"
},
{
"input": "9 8\n3 3 7 7 1 9 10 7 1\n1 1 1 1 1 1 1 1 1",
"output": "48"
},
{
"input": "2 1\n3 4\n0 0",
"output": "4"
},
{
"input": "2 1\n3 2\n0 1",
"output": "5"
},
{
"input": "10 1\n6 6 8 7 6 6 3 2 5 6\n0 0 1 0 0 1 0 1 1 1",
"output": "34"
},
{
"input": "3 2\n10 10 6\n0 0 0",
"output": "20"
},
{
"input": "6 3\n1 3 5 2 5 4\n1 1 1 1 1 1",
"output": "20"
},
{
"input": "10 5\n1 1 1 1 1 1 1 1 10000 1\n1 1 1 1 1 1 1 1 0 1",
"output": "10009"
}
] | 1,605,464,241
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 108
| 307,200
|
n,k = map(int,input().split())
lst = list(map(int,input().split()))
lst2 = list(map(int,input().split()))
ans = 0
for i in range(n):
if lst2[i] == 1:
ans += lst[i]
lst3 = [0]*n
for i in range(n):
if lst2[i] == 0:
lst3[i] = lst[i]
lst4 = [0]*n
lst4[0] = lst3[0]
for i in range(1,n):
lst4[i] = lst3[i] + lst4[i-1]
best = sum(lst4[:k])
for i in range(k+1,n):
sum1 = lst4[i] - lst4[i-k]
best = max(sum1,best)
ans += best
print(ans)
|
Title: Lecture Sleep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute.
Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing.
You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells.
You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
Input Specification:
The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake.
The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute.
The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture.
Output Specification:
Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
Demo Input:
['6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n']
Demo Output:
['16\n']
Note:
In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.
|
```python
n,k = map(int,input().split())
lst = list(map(int,input().split()))
lst2 = list(map(int,input().split()))
ans = 0
for i in range(n):
if lst2[i] == 1:
ans += lst[i]
lst3 = [0]*n
for i in range(n):
if lst2[i] == 0:
lst3[i] = lst[i]
lst4 = [0]*n
lst4[0] = lst3[0]
for i in range(1,n):
lst4[i] = lst3[i] + lst4[i-1]
best = sum(lst4[:k])
for i in range(k+1,n):
sum1 = lst4[i] - lst4[i-k]
best = max(sum1,best)
ans += best
print(ans)
```
| 0
|
|
379
|
A
|
New Year Candles
|
PROGRAMMING
| 1,000
|
[
"implementation"
] | null | null |
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
|
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
|
Print a single integer — the number of hours Vasily can light up the room for.
|
[
"4 2\n",
"6 3\n"
] |
[
"7\n",
"8\n"
] |
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
| 500
|
[
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,683,650,145
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 32
| 46
| 0
|
a, b = list(map(int, input().strip().split()))
hours = a
while a // b > 0:
new_candles, leftover_candles = divmod(a, b)
hours += new_candles
a = new_candles + leftover_candles
print(hours)
|
Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours.
|
```python
a, b = list(map(int, input().strip().split()))
hours = a
while a // b > 0:
new_candles, leftover_candles = divmod(a, b)
hours += new_candles
a = new_candles + leftover_candles
print(hours)
```
| 3
|
|
697
|
A
|
Pineapple Incident
|
PROGRAMMING
| 900
|
[
"implementation",
"math"
] | null | null |
Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc.
Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time.
|
The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively.
|
Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output.
|
[
"3 10 4\n",
"3 10 3\n",
"3 8 51\n",
"3 8 52\n"
] |
[
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] |
In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3.
In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
| 500
|
[
{
"input": "3 10 4",
"output": "NO"
},
{
"input": "3 10 3",
"output": "YES"
},
{
"input": "3 8 51",
"output": "YES"
},
{
"input": "3 8 52",
"output": "YES"
},
{
"input": "456947336 740144 45",
"output": "NO"
},
{
"input": "33 232603 599417964",
"output": "YES"
},
{
"input": "4363010 696782227 701145238",
"output": "YES"
},
{
"input": "9295078 2 6",
"output": "NO"
},
{
"input": "76079 281367 119938421",
"output": "YES"
},
{
"input": "93647 7 451664565",
"output": "YES"
},
{
"input": "5 18553 10908",
"output": "NO"
},
{
"input": "6 52 30",
"output": "NO"
},
{
"input": "6431 855039 352662",
"output": "NO"
},
{
"input": "749399100 103031711 761562532",
"output": "NO"
},
{
"input": "21 65767 55245",
"output": "NO"
},
{
"input": "4796601 66897 4860613",
"output": "NO"
},
{
"input": "8 6728951 860676",
"output": "NO"
},
{
"input": "914016 6 914019",
"output": "NO"
},
{
"input": "60686899 78474 60704617",
"output": "NO"
},
{
"input": "3 743604 201724",
"output": "NO"
},
{
"input": "571128 973448796 10",
"output": "NO"
},
{
"input": "688051712 67 51",
"output": "NO"
},
{
"input": "74619 213344 6432326",
"output": "NO"
},
{
"input": "6947541 698167 6",
"output": "NO"
},
{
"input": "83 6 6772861",
"output": "NO"
},
{
"input": "251132 67561 135026988",
"output": "NO"
},
{
"input": "8897216 734348516 743245732",
"output": "YES"
},
{
"input": "50 64536 153660266",
"output": "YES"
},
{
"input": "876884 55420 971613604",
"output": "YES"
},
{
"input": "0 6906451 366041903",
"output": "YES"
},
{
"input": "11750 8 446010134",
"output": "YES"
},
{
"input": "582692707 66997 925047377",
"output": "YES"
},
{
"input": "11 957526890 957526901",
"output": "YES"
},
{
"input": "556888 514614196 515171084",
"output": "YES"
},
{
"input": "6 328006 584834704",
"output": "YES"
},
{
"input": "4567998 4 204966403",
"output": "YES"
},
{
"input": "60 317278 109460971",
"output": "YES"
},
{
"input": "906385 342131991 685170368",
"output": "YES"
},
{
"input": "1 38 902410512",
"output": "YES"
},
{
"input": "29318 787017 587931018",
"output": "YES"
},
{
"input": "351416375 243431 368213115",
"output": "YES"
},
{
"input": "54 197366062 197366117",
"output": "YES"
},
{
"input": "586389 79039 850729874",
"output": "YES"
},
{
"input": "723634470 2814619 940360134",
"output": "YES"
},
{
"input": "0 2 0",
"output": "YES"
},
{
"input": "0 2 1",
"output": "NO"
},
{
"input": "0 2 2",
"output": "YES"
},
{
"input": "0 2 3",
"output": "YES"
},
{
"input": "0 2 1000000000",
"output": "YES"
},
{
"input": "0 10 23",
"output": "NO"
},
{
"input": "0 2 999999999",
"output": "YES"
},
{
"input": "10 5 11",
"output": "NO"
},
{
"input": "1 2 1000000000",
"output": "YES"
},
{
"input": "1 10 20",
"output": "NO"
},
{
"input": "1 2 999999937",
"output": "YES"
},
{
"input": "10 3 5",
"output": "NO"
},
{
"input": "3 2 5",
"output": "YES"
},
{
"input": "0 4 0",
"output": "YES"
},
{
"input": "0 215 403",
"output": "NO"
},
{
"input": "5 2 10",
"output": "YES"
},
{
"input": "0 2 900000000",
"output": "YES"
},
{
"input": "0 79 4000",
"output": "NO"
},
{
"input": "5 1000 1000",
"output": "NO"
},
{
"input": "1 5 103",
"output": "NO"
},
{
"input": "5 2 6",
"output": "NO"
},
{
"input": "120 2 1000000000",
"output": "YES"
},
{
"input": "2 2 1000000000",
"output": "YES"
},
{
"input": "5 5 13",
"output": "NO"
},
{
"input": "10 5 15",
"output": "YES"
},
{
"input": "11 2 0",
"output": "NO"
},
{
"input": "3 8 53",
"output": "NO"
},
{
"input": "2 2 4",
"output": "YES"
},
{
"input": "4 4 0",
"output": "NO"
},
{
"input": "1 2 3",
"output": "YES"
},
{
"input": "5 3 9",
"output": "YES"
},
{
"input": "5 6 19",
"output": "NO"
},
{
"input": "3 10 125",
"output": "NO"
},
{
"input": "5 3 8",
"output": "YES"
},
{
"input": "6 3 9",
"output": "YES"
},
{
"input": "0 3 5",
"output": "NO"
},
{
"input": "5 3 300000035",
"output": "YES"
},
{
"input": "5 2 7",
"output": "YES"
},
{
"input": "1 5 6",
"output": "YES"
},
{
"input": "4 2 6",
"output": "YES"
},
{
"input": "0 3 999999998",
"output": "NO"
},
{
"input": "0 10001 0",
"output": "YES"
},
{
"input": "6 5 3",
"output": "NO"
},
{
"input": "1 5 1000000000",
"output": "NO"
},
{
"input": "1 3 6",
"output": "NO"
},
{
"input": "3 3 1000000000",
"output": "YES"
},
{
"input": "3 3 4",
"output": "NO"
},
{
"input": "3 3 5",
"output": "NO"
},
{
"input": "3 3 0",
"output": "NO"
},
{
"input": "1 2 4",
"output": "YES"
},
{
"input": "5 5 10",
"output": "YES"
}
] | 1,628,244,750
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 6
| 62
| 6,963,200
|
a,b,p = map(int, input().split())
def check(x,t,s):
if x == t or x == (t+s):
return True
else:
p = (x-t) /s
q = (x-t-s-1) /s
if (p > 0 and p - int(p) == 0 ) or ( q > 0 and q - int(q) == 0) :
return True
else:
return False
if check(p,a,b):
print("YES")
else:
print("NO")
|
Title: Pineapple Incident
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ted has a pineapple. This pineapple is able to bark like a bulldog! At time *t* (in seconds) it barks for the first time. Then every *s* seconds after it, it barks twice with 1 second interval. Thus it barks at times *t*, *t*<=+<=*s*, *t*<=+<=*s*<=+<=1, *t*<=+<=2*s*, *t*<=+<=2*s*<=+<=1, etc.
Barney woke up in the morning and wants to eat the pineapple, but he can't eat it when it's barking. Barney plans to eat it at time *x* (in seconds), so he asked you to tell him if it's gonna bark at that time.
Input Specification:
The first and only line of input contains three integers *t*, *s* and *x* (0<=≤<=*t*,<=*x*<=≤<=109, 2<=≤<=*s*<=≤<=109) — the time the pineapple barks for the first time, the pineapple barking interval, and the time Barney wants to eat the pineapple respectively.
Output Specification:
Print a single "YES" (without quotes) if the pineapple will bark at time *x* or a single "NO" (without quotes) otherwise in the only line of output.
Demo Input:
['3 10 4\n', '3 10 3\n', '3 8 51\n', '3 8 52\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
In the first and the second sample cases pineapple will bark at moments 3, 13, 14, ..., so it won't bark at the moment 4 and will bark at the moment 3.
In the third and fourth sample cases pineapple will bark at moments 3, 11, 12, 19, 20, 27, 28, 35, 36, 43, 44, 51, 52, 59, ..., so it will bark at both moments 51 and 52.
|
```python
a,b,p = map(int, input().split())
def check(x,t,s):
if x == t or x == (t+s):
return True
else:
p = (x-t) /s
q = (x-t-s-1) /s
if (p > 0 and p - int(p) == 0 ) or ( q > 0 and q - int(q) == 0) :
return True
else:
return False
if check(p,a,b):
print("YES")
else:
print("NO")
```
| 0
|
|
839
|
C
|
Journey
|
PROGRAMMING
| 1,500
|
[
"dfs and similar",
"dp",
"graphs",
"probabilities",
"trees"
] | null | null |
There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads.
Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities.
Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value).
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities.
Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road.
It is guaranteed that one can reach any city from any other by the roads.
|
Print a number — the expected length of their journey. The journey starts in the city 1.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
|
[
"4\n1 2\n1 3\n2 4\n",
"5\n1 2\n1 3\n3 4\n2 5\n"
] |
[
"1.500000000000000\n",
"2.000000000000000\n"
] |
In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5.
In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
| 1,500
|
[
{
"input": "4\n1 2\n1 3\n2 4",
"output": "1.500000000000000"
},
{
"input": "5\n1 2\n1 3\n3 4\n2 5",
"output": "2.000000000000000"
},
{
"input": "70\n1 25\n57 1\n18 1\n65 1\n38 1\n1 41\n1 5\n1 69\n1 3\n31 1\n1 8\n1 9\n53 1\n70 1\n45 1\n1 24\n1 42\n1 30\n1 12\n1 37\n64 1\n1 28\n1 58\n1 22\n11 1\n1 4\n1 27\n1 16\n1 21\n54 1\n1 51\n1 43\n29 1\n56 1\n1 39\n32 1\n1 15\n1 17\n1 19\n1 40\n36 1\n48 1\n63 1\n1 7\n1 47\n1 13\n1 46\n60 1\n1 6\n23 1\n20 1\n1 52\n2 1\n26 1\n1 59\n1 66\n10 1\n1 62\n1 68\n1 55\n50 1\n33 1\n44 1\n1 34\n1 35\n1 61\n14 1\n67 1\n49 1",
"output": "1.000000000000000"
},
{
"input": "10\n8 6\n9 10\n8 7\n1 4\n1 8\n9 5\n9 8\n2 5\n3 1",
"output": "1.500000000000000"
},
{
"input": "1",
"output": "0.000000000000000"
}
] | 1,685,020,410
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 77
| 2,867,200
|
n = int(input())
g = [[] for _ in range(n + 1)]
for _ in range(1, n):
a, b = map(int, input().split())
g[a].append(b)
g[b].append(a)
import numpy as np
def get_expected_value(cur: int, prev: int) -> int:
res = [1]
for child in g[cur]:
if child != prev:
res.append(get_expected_value(cur=child, prev=cur))
if cur == 1:
res.pop(0)
return np.average(res) if cur == 1 else np.sum(res)
print(get_expected_value(cur=1, prev=0))
|
Title: Journey
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads.
Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities.
Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities.
Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road.
It is guaranteed that one can reach any city from any other by the roads.
Output Specification:
Print a number — the expected length of their journey. The journey starts in the city 1.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
Demo Input:
['4\n1 2\n1 3\n2 4\n', '5\n1 2\n1 3\n3 4\n2 5\n']
Demo Output:
['1.500000000000000\n', '2.000000000000000\n']
Note:
In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5.
In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
|
```python
n = int(input())
g = [[] for _ in range(n + 1)]
for _ in range(1, n):
a, b = map(int, input().split())
g[a].append(b)
g[b].append(a)
import numpy as np
def get_expected_value(cur: int, prev: int) -> int:
res = [1]
for child in g[cur]:
if child != prev:
res.append(get_expected_value(cur=child, prev=cur))
if cur == 1:
res.pop(0)
return np.average(res) if cur == 1 else np.sum(res)
print(get_expected_value(cur=1, prev=0))
```
| -1
|
|
45
|
A
|
Codecraft III
|
PROGRAMMING
| 900
|
[
"implementation"
] |
A. Codecraft III
|
2
|
256
|
Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that.
All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December.
|
The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III.
|
Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December.
|
[
"November\n3\n",
"May\n24\n"
] |
[
"February\n",
"May\n"
] |
none
| 0
|
[
{
"input": "November\n3",
"output": "February"
},
{
"input": "May\n24",
"output": "May"
},
{
"input": "April\n0",
"output": "April"
},
{
"input": "September\n0",
"output": "September"
},
{
"input": "August\n0",
"output": "August"
},
{
"input": "June\n1",
"output": "July"
},
{
"input": "July\n2",
"output": "September"
},
{
"input": "September\n3",
"output": "December"
},
{
"input": "July\n4",
"output": "November"
},
{
"input": "August\n24",
"output": "August"
},
{
"input": "May\n48",
"output": "May"
},
{
"input": "November\n47",
"output": "October"
},
{
"input": "December\n49",
"output": "January"
},
{
"input": "June\n99",
"output": "September"
},
{
"input": "March\n100",
"output": "July"
},
{
"input": "December\n1",
"output": "January"
},
{
"input": "January\n11",
"output": "December"
},
{
"input": "December\n0",
"output": "December"
},
{
"input": "January\n0",
"output": "January"
},
{
"input": "July\n77",
"output": "December"
},
{
"input": "February\n11",
"output": "January"
},
{
"input": "February\n22",
"output": "December"
},
{
"input": "July\n33",
"output": "April"
},
{
"input": "May\n44",
"output": "January"
},
{
"input": "June\n97",
"output": "July"
}
] | 1,687,521,333
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 25
| 92
| 0
|
lis=["January","February","March","April","May","June","July","August","September","October","November","December"]
S=input()
M=int(input())
while(M>12):
M-=12
if(M==12):
print(S)
else:
reached=0
ind=lis.index(S)
while(reached != M):
reached+=1
ind+=1
if(ind>11):
ind=0
print(lis[ind])
|
Title: Codecraft III
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that.
All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December.
Input Specification:
The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III.
Output Specification:
Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December.
Demo Input:
['November\n3\n', 'May\n24\n']
Demo Output:
['February\n', 'May\n']
Note:
none
|
```python
lis=["January","February","March","April","May","June","July","August","September","October","November","December"]
S=input()
M=int(input())
while(M>12):
M-=12
if(M==12):
print(S)
else:
reached=0
ind=lis.index(S)
while(reached != M):
reached+=1
ind+=1
if(ind>11):
ind=0
print(lis[ind])
```
| 3.977
|
155
|
A
|
I_love_\%username\%
|
PROGRAMMING
| 800
|
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500
|
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,693,775,007
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 37
| 124
| 0
|
n=int(input())
l=list(map(int,input().split()))
a=0
min=l[0]
max=l[0]
for i in range(n):
if l[i]>max:
max=l[i]
a+=1
if l[i]<min:
min=l[i]
a+=1
print(a)
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
n=int(input())
l=list(map(int,input().split()))
a=0
min=l[0]
max=l[0]
for i in range(n):
if l[i]>max:
max=l[i]
a+=1
if l[i]<min:
min=l[i]
a+=1
print(a)
```
| 3
|
|
572
|
A
|
Arrays
|
PROGRAMMING
| 900
|
[
"sortings"
] | null | null |
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
|
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
|
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
|
[
"3 3\n2 1\n1 2 3\n3 4 5\n",
"3 3\n3 3\n1 2 3\n3 4 5\n",
"5 2\n3 1\n1 1 1 1 1\n2 2\n"
] |
[
"YES\n",
"NO\n",
"YES\n"
] |
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 500
|
[
{
"input": "3 3\n2 1\n1 2 3\n3 4 5",
"output": "YES"
},
{
"input": "3 3\n3 3\n1 2 3\n3 4 5",
"output": "NO"
},
{
"input": "5 2\n3 1\n1 1 1 1 1\n2 2",
"output": "YES"
},
{
"input": "3 5\n1 1\n5 5 5\n5 5 5 5 5",
"output": "NO"
},
{
"input": "1 1\n1 1\n1\n1",
"output": "NO"
},
{
"input": "3 3\n1 1\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n1 2\n1 2 3\n1 2 3",
"output": "YES"
},
{
"input": "3 3\n2 2\n1 2 3\n1 2 3",
"output": "NO"
},
{
"input": "10 15\n10 1\n1 1 5 17 22 29 32 36 39 48\n9 10 20 23 26 26 32 32 33 39 43 45 47 49 49",
"output": "YES"
},
{
"input": "10 15\n1 15\n91 91 91 92 92 94 94 95 98 100\n92 92 93 93 93 94 95 96 97 98 98 99 99 100 100",
"output": "YES"
},
{
"input": "15 10\n12 5\n9 25 25 32 32 38 40 41 46 46 48 51 64 64 73\n5 14 30 35 50 52 67 79 89 99",
"output": "YES"
},
{
"input": "15 10\n4 10\n22 32 35 45 45 50 51 55 79 80 83 88 90 92 93\n46 48 52 55 60 60 68 75 80 81",
"output": "YES"
},
{
"input": "20 30\n2 8\n6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 10\n1 1 2 2 2 2 2 2 2 3 3 4 5 5 5 5 6 6 6 6 6 6 7 7 7 8 8 9 10 10",
"output": "NO"
},
{
"input": "20 30\n19 29\n1 1 2 2 2 3 4 4 7 7 7 8 8 8 8 8 9 9 9 9\n6 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "NO"
},
{
"input": "1 1\n1 1\n-1000000000\n30",
"output": "YES"
},
{
"input": "3 3\n1 3\n1 3 3\n3 3 3",
"output": "YES"
},
{
"input": "3 3\n1 1\n3 3 3\n2 2 2",
"output": "NO"
},
{
"input": "5 5\n3 3\n1 5 6 7 8\n1 2 5 6 7",
"output": "NO"
},
{
"input": "3 4\n2 2\n5 6 7\n1 2 3 4",
"output": "NO"
},
{
"input": "3 3\n3 3\n1 2 3\n4 5 6",
"output": "YES"
},
{
"input": "5 5\n4 5\n2 2 3 4 5\n5 6 7 8 9",
"output": "YES"
}
] | 1,687,670,412
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 15
| 0
|
n = intput()
|
Title: Arrays
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two arrays *A* and *B* consisting of integers, sorted in non-decreasing order. Check whether it is possible to choose *k* numbers in array *A* and choose *m* numbers in array *B* so that any number chosen in the first array is strictly less than any number chosen in the second array.
Input Specification:
The first line contains two integers *n**A*,<=*n**B* (1<=≤<=*n**A*,<=*n**B*<=≤<=105), separated by a space — the sizes of arrays *A* and *B*, correspondingly.
The second line contains two integers *k* and *m* (1<=≤<=*k*<=≤<=*n**A*,<=1<=≤<=*m*<=≤<=*n**B*), separated by a space.
The third line contains *n**A* numbers *a*1,<=*a*2,<=... *a**n**A* (<=-<=109<=≤<=*a*1<=≤<=*a*2<=≤<=...<=≤<=*a**n**A*<=≤<=109), separated by spaces — elements of array *A*.
The fourth line contains *n**B* integers *b*1,<=*b*2,<=... *b**n**B* (<=-<=109<=≤<=*b*1<=≤<=*b*2<=≤<=...<=≤<=*b**n**B*<=≤<=109), separated by spaces — elements of array *B*.
Output Specification:
Print "YES" (without the quotes), if you can choose *k* numbers in array *A* and *m* numbers in array *B* so that any number chosen in array *A* was strictly less than any number chosen in array *B*. Otherwise, print "NO" (without the quotes).
Demo Input:
['3 3\n2 1\n1 2 3\n3 4 5\n', '3 3\n3 3\n1 2 3\n3 4 5\n', '5 2\n3 1\n1 1 1 1 1\n2 2\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first sample test you can, for example, choose numbers 1 and 2 from array *A* and number 3 from array *B* (1 < 3 and 2 < 3).
In the second sample test the only way to choose *k* elements in the first array and *m* elements in the second one is to choose all numbers in both arrays, but then not all the numbers chosen in *A* will be less than all the numbers chosen in *B*: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/7280148ed5eab0a7d418d4f92b32061243a8ca58.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
n = intput()
```
| -1
|
|
381
|
A
|
Sereja and Dima
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500
|
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,674,905,592
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 0
|
def cardGame(arr,size):
arr.sort()
wube = 0
heni = 0
while arr:
wube += arr.pop()
if arr:
heni += arr.pop()
else:
break
print(wube, heni)
size = int(input())
lists = list(map(int,input().split()))
cardGame(lists,size)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
def cardGame(arr,size):
arr.sort()
wube = 0
heni = 0
while arr:
wube += arr.pop()
if arr:
heni += arr.pop()
else:
break
print(wube, heni)
size = int(input())
lists = list(map(int,input().split()))
cardGame(lists,size)
```
| 0
|
|
996
|
A
|
Hit the Lottery
|
PROGRAMMING
| 800
|
[
"dp",
"greedy"
] | null | null |
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
|
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
|
Output the minimum number of bills that Allen could receive.
|
[
"125\n",
"43\n",
"1000000000\n"
] |
[
"3\n",
"5\n",
"10000000\n"
] |
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
| 500
|
[
{
"input": "125",
"output": "3"
},
{
"input": "43",
"output": "5"
},
{
"input": "1000000000",
"output": "10000000"
},
{
"input": "4",
"output": "4"
},
{
"input": "5",
"output": "1"
},
{
"input": "1",
"output": "1"
},
{
"input": "74",
"output": "8"
},
{
"input": "31",
"output": "3"
},
{
"input": "59",
"output": "8"
},
{
"input": "79",
"output": "9"
},
{
"input": "7",
"output": "3"
},
{
"input": "55",
"output": "4"
},
{
"input": "40",
"output": "2"
},
{
"input": "719",
"output": "13"
},
{
"input": "847",
"output": "13"
},
{
"input": "225",
"output": "4"
},
{
"input": "4704",
"output": "51"
},
{
"input": "1132",
"output": "15"
},
{
"input": "7811",
"output": "80"
},
{
"input": "7981",
"output": "84"
},
{
"input": "82655",
"output": "830"
},
{
"input": "6364",
"output": "70"
},
{
"input": "74611",
"output": "748"
},
{
"input": "45391",
"output": "459"
},
{
"input": "620448",
"output": "6210"
},
{
"input": "265145",
"output": "2654"
},
{
"input": "671704",
"output": "6721"
},
{
"input": "365173",
"output": "3658"
},
{
"input": "7130872",
"output": "71314"
},
{
"input": "9628747",
"output": "96292"
},
{
"input": "8898399",
"output": "88993"
},
{
"input": "9497953",
"output": "94985"
},
{
"input": "19070947",
"output": "190714"
},
{
"input": "20185520",
"output": "201856"
},
{
"input": "91402248",
"output": "914028"
},
{
"input": "27035533",
"output": "270360"
},
{
"input": "22717528",
"output": "227180"
},
{
"input": "24403439",
"output": "244041"
},
{
"input": "163565555",
"output": "1635659"
},
{
"input": "152541908",
"output": "1525423"
},
{
"input": "668439837",
"output": "6684403"
},
{
"input": "20",
"output": "1"
},
{
"input": "999999999",
"output": "10000009"
},
{
"input": "10",
"output": "1"
},
{
"input": "7",
"output": "3"
},
{
"input": "6",
"output": "2"
},
{
"input": "99999999",
"output": "1000009"
},
{
"input": "1000001",
"output": "10001"
},
{
"input": "2521",
"output": "27"
}
] | 1,685,542,749
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 2
| 1,000
| 0
|
num = int(input())
t = 0
while(num!=0):
if(num>=100):
num = num-100
t+=1
elif(num>=20):
num = num-20
t+=1
elif(num>=10):
num = num-10
t+=1
elif(num>=5):
num = num-5
t+=1
else:
num = num-1
t+=1
print(t)
|
Title: Hit the Lottery
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Allen has a LOT of money. He has $n$ dollars in the bank. For security reasons, he wants to withdraw it in cash (we will not disclose the reasons here). The denominations for dollar bills are $1$, $5$, $10$, $20$, $100$. What is the minimum number of bills Allen could receive after withdrawing his entire balance?
Input Specification:
The first and only line of input contains a single integer $n$ ($1 \le n \le 10^9$).
Output Specification:
Output the minimum number of bills that Allen could receive.
Demo Input:
['125\n', '43\n', '1000000000\n']
Demo Output:
['3\n', '5\n', '10000000\n']
Note:
In the first sample case, Allen can withdraw this with a $100$ dollar bill, a $20$ dollar bill, and a $5$ dollar bill. There is no way for Allen to receive $125$ dollars in one or two bills.
In the second sample case, Allen can withdraw two $20$ dollar bills and three $1$ dollar bills.
In the third sample case, Allen can withdraw $100000000$ (ten million!) $100$ dollar bills.
|
```python
num = int(input())
t = 0
while(num!=0):
if(num>=100):
num = num-100
t+=1
elif(num>=20):
num = num-20
t+=1
elif(num>=10):
num = num-10
t+=1
elif(num>=5):
num = num-5
t+=1
else:
num = num-1
t+=1
print(t)
```
| 0
|
|
48
|
D
|
Permutations
|
PROGRAMMING
| 1,500
|
[
"greedy"
] |
D. Permutations
|
1
|
256
|
A permutation is a sequence of integers from 1 to *n* of length *n* containing each number exactly once. For example, (1), (4,<=3,<=5,<=1,<=2), (3,<=2,<=1) are permutations, and (1,<=1), (4,<=3,<=1), (2,<=3,<=4) are not.
There are many tasks on permutations. Today you are going to solve one of them. Let’s imagine that somebody took several permutations (perhaps, with a different number of elements), wrote them down consecutively as one array and then shuffled the resulting array. The task is to restore the initial permutations if it is possible.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The next line contains the mixed array of *n* integers, divided with a single space. The numbers in the array are from 1 to 105.
|
If this array can be split into several permutations so that every element of the array belongs to exactly one permutation, print in the first line the number of permutations. The second line should contain *n* numbers, corresponding to the elements of the given array. If the *i*-th element belongs to the first permutation, the *i*-th number should be 1, if it belongs to the second one, then its number should be 2 and so on. The order of the permutations’ numbering is free.
If several solutions are possible, print any one of them. If there’s no solution, print in the first line <=-<=1.
|
[
"9\n1 2 3 1 2 1 4 2 5\n",
"4\n4 3 2 1\n",
"4\n1 2 2 3\n"
] |
[
"3\n3 1 2 1 2 2 2 3 2\n",
"1\n1 1 1 1 ",
"-1\n"
] |
In the first sample test the array is split into three permutations: (2, 1), (3, 2, 1, 4, 5), (1, 2). The first permutation is formed by the second and the fourth elements of the array, the second one — by the third, the fifth, the sixth, the seventh and the ninth elements, the third one — by the first and the eigth elements. Clearly, there are other splitting variants possible.
| 0
|
[
{
"input": "9\n1 2 3 1 2 1 4 2 5",
"output": "3\n1 1 1 2 2 3 1 3 1 "
},
{
"input": "4\n4 3 2 1",
"output": "1\n1 1 1 1 "
},
{
"input": "4\n1 2 2 3",
"output": "-1"
},
{
"input": "1\n1",
"output": "1\n1 "
},
{
"input": "1\n2",
"output": "-1"
},
{
"input": "5\n1 1 1 1 1",
"output": "5\n1 2 3 4 5 "
},
{
"input": "3\n2 1 1",
"output": "2\n1 1 2 "
},
{
"input": "6\n3 3 2 2 1 1",
"output": "2\n1 2 1 2 1 2 "
},
{
"input": "2\n1000 1",
"output": "-1"
},
{
"input": "5\n2 2 1 1 3",
"output": "2\n1 2 1 2 1 "
},
{
"input": "10\n2 1 2 4 6 1 5 3 7 1",
"output": "3\n1 1 2 1 1 2 1 1 1 3 "
},
{
"input": "10\n4 1 2 1 3 3 1 2 2 1",
"output": "4\n1 1 1 2 1 2 3 2 3 4 "
},
{
"input": "10\n1 2 5 1 1 1 4 1 3 2",
"output": "5\n1 1 1 2 3 4 1 5 1 2 "
},
{
"input": "20\n2 7 3 8 4 6 3 7 6 4 13 5 1 12 1 10 2 11 5 9",
"output": "2\n1 1 1 1 1 1 2 2 2 2 1 1 1 1 2 1 2 1 2 1 "
},
{
"input": "20\n1 1 1 2 3 1 5 9 5 8 4 6 7 3 1 2 2 1 3 4",
"output": "6\n1 2 3 1 1 4 1 1 2 1 1 1 1 2 5 2 3 6 3 2 "
},
{
"input": "20\n2 10 3 3 2 1 14 13 2 15 1 4 5 12 7 11 9 1 6 8",
"output": "3\n1 1 1 2 2 1 1 1 3 1 2 1 1 1 1 1 1 3 1 1 "
},
{
"input": "20\n1 7 2 3 1 1 8 1 6 1 9 11 5 10 1 4 2 3 1 2",
"output": "7\n1 1 1 1 2 3 1 4 1 5 1 1 1 1 6 1 2 2 7 3 "
},
{
"input": "30\n6 1 2 3 6 4 1 8 1 2 2 5 5 1 1 3 9 1 5 8 1 2 7 7 4 3 1 3 4 2",
"output": "8\n1 1 1 1 2 1 2 1 3 2 3 1 2 4 5 2 1 6 3 2 7 4 1 2 2 3 8 4 3 5 "
},
{
"input": "30\n2 6 2 3 3 1 4 2 1 3 3 2 1 2 1 8 1 2 4 1 1 1 5 1 4 7 1 9 1 1",
"output": "12\n1 1 2 1 2 1 1 3 2 3 4 4 3 5 4 1 5 6 2 6 7 8 1 9 3 1 10 1 11 12 "
},
{
"input": "30\n1 3 2 5 9 4 16 14 2 2 4 11 7 17 1 15 13 3 6 12 6 19 8 1 20 5 18 4 10 3",
"output": "3\n1 1 1 1 1 1 1 1 2 3 2 1 1 1 2 1 1 2 1 1 2 1 1 3 1 2 1 3 1 3 "
},
{
"input": "10\n2 2 6 3 1 4 5 3 7 7",
"output": "-1"
},
{
"input": "20\n4 6 6 4 5 4 3 2 5 7 3 2 4 1 3 1 1 4 1 7",
"output": "-1"
},
{
"input": "30\n2 8 3 3 7 4 2 9 4 3 5 6 1 5 3 5 8 1 9 6 6 7 2 7 1 1 1 10 2 1",
"output": "-1"
},
{
"input": "30\n8 7 9 6 2 3 7 1 1 5 7 2 3 1 7 4 5 6 3 9 4 9 4 2 3 1 1 2 2 10",
"output": "-1"
},
{
"input": "50\n7 1 6 5 15 3 13 7 1 1 4 2 4 3 2 1 11 9 4 2 3 7 1 1 1 14 3 14 5 2 5 4 1 8 2 2 2 2 1 1 4 1 2 3 6 12 1 1 5 1",
"output": "-1"
},
{
"input": "50\n1 1 4 1 1 1 1 1 1 3 1 1 3 2 1 1 1 1 5 2 1 1 1 1 1 3 1 1 1 1 1 1 2 1 1 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41\n1 2 1 3 4 5 6 7 8 1 9 10 2 1 11 12 13 14 1 2 15 16 17 18 19 3 20 21 22 23 24 25 3 26 27 4 28 29 30 31 32 33 34 35 36 37 38 39 40 41 "
},
{
"input": "100\n2 13 10 4 13 8 22 11 5 3 4 6 19 4 8 8 6 1 16 4 11 17 5 18 7 7 4 5 3 7 2 16 5 6 10 1 6 12 14 6 8 7 9 7 1 2 1 8 5 5 9 21 7 11 6 1 12 10 6 23 10 9 8 4 1 2 3 13 2 14 15 1 1 12 3 9 12 3 13 9 8 1 12 5 2 3 11 7 11 9 3 14 1 2 15 2 10 4 14 20",
"output": "10\n1 1 1 1 2 1 1 1 1 1 2 1 1 3 2 3 2 1 1 4 2 1 2 1 1 2 5 3 2 3 2 2 4 3 2 2 4 1 1 5 4 4 1 5 3 3 4 5 5 6 2 1 6 3 6 5 2 3 7 1 4 3 6 6 6 4 3 3 5 2 1 7 8 3 4 4 4 5 4 5 7 9 5 7 6 6 4 7 5 6 7 3 10 7 2 8 5 7 4 1 "
},
{
"input": "100\n9 6 3 28 10 2 2 11 2 1 25 3 13 5 14 13 4 14 2 16 12 27 8 1 7 9 8 19 33 23 4 1 15 6 7 12 2 8 30 4 1 31 6 1 15 5 18 3 2 24 7 3 1 20 10 8 26 22 3 3 9 6 1 10 1 5 1 3 7 6 11 10 1 16 19 5 9 4 4 4 2 18 12 21 11 5 2 32 17 29 2 4 8 1 7 5 3 2 17 1",
"output": "12\n1 1 1 1 1 1 2 1 3 1 1 2 1 1 1 2 1 2 4 1 1 1 1 2 1 2 2 1 1 1 2 3 1 2 2 2 5 3 1 3 4 1 3 5 2 2 1 3 6 1 3 4 6 1 2 4 1 1 5 6 3 4 7 3 8 3 9 7 4 5 2 4 10 2 2 4 4 4 5 6 7 2 3 1 3 5 8 1 1 1 9 7 5 11 5 6 8 10 2 12 "
},
{
"input": "100\n12 18 1 1 14 23 1 1 22 5 7 9 7 1 1 1 3 8 4 2 1 6 9 1 3 2 11 1 11 2 3 2 1 4 2 7 1 16 3 4 2 13 3 1 5 11 2 10 20 24 3 21 5 2 6 2 1 10 10 5 17 1 1 4 19 8 5 5 3 9 4 2 7 8 10 4 9 1 3 3 9 7 6 4 4 3 6 8 12 1 3 6 2 1 8 4 1 15 2 5",
"output": "20\n1 1 1 2 1 1 3 4 1 1 1 1 2 5 6 7 1 1 1 1 8 1 2 9 2 2 1 10 2 3 3 4 11 2 5 3 12 1 4 3 6 1 5 13 2 3 7 1 1 1 6 1 3 8 2 9 14 2 3 4 1 15 16 4 1 2 5 6 7 3 5 10 4 3 4 6 4 17 8 9 5 5 3 7 8 10 4 4 2 18 11 5 11 19 5 9 20 1 12 7 "
},
{
"input": "100\n10 1 13 1 5 2 5 5 9 10 3 8 4 1 3 5 6 4 1 4 9 8 1 1 1 1 8 2 3 1 1 2 5 1 1 12 6 4 5 3 1 3 18 10 1 2 3 2 6 2 3 15 1 3 5 3 9 7 1 6 11 7 7 8 6 17 11 7 6 1 4 4 1 1 3 1 2 6 7 14 4 4 5 1 11 1 4 2 8 4 2 7 16 12 1 1 2 2 1 2",
"output": "25\n1 1 1 2 1 1 2 3 1 2 1 1 1 3 2 4 1 2 4 3 2 2 5 6 7 8 3 2 3 9 10 3 5 11 12 1 2 4 6 4 13 5 1 3 14 4 6 5 3 6 7 1 15 8 7 9 3 1 16 4 1 2 3 4 5 1 2 4 6 17 5 6 18 19 10 20 7 7 5 1 7 8 8 21 3 22 9 8 5 10 9 6 1 2 23 24 10 11 25 12 "
}
] | 1,639,413,491
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 46
| 1,000
| 307,200
|
n = int(input())
m = list(map(int, input().split()))
mm = [1] * max(m)
m1 = []
for i in range(n):
m1.append(mm[m[i] - 1])
mm[m[i] - 1] += 1
for i in range(2, max(m) + 1):
if m.count(i) > m.count(i - 1):
print(-1)
break
else:
print(max(m1))
print(*m1)
|
Title: Permutations
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
A permutation is a sequence of integers from 1 to *n* of length *n* containing each number exactly once. For example, (1), (4,<=3,<=5,<=1,<=2), (3,<=2,<=1) are permutations, and (1,<=1), (4,<=3,<=1), (2,<=3,<=4) are not.
There are many tasks on permutations. Today you are going to solve one of them. Let’s imagine that somebody took several permutations (perhaps, with a different number of elements), wrote them down consecutively as one array and then shuffled the resulting array. The task is to restore the initial permutations if it is possible.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105). The next line contains the mixed array of *n* integers, divided with a single space. The numbers in the array are from 1 to 105.
Output Specification:
If this array can be split into several permutations so that every element of the array belongs to exactly one permutation, print in the first line the number of permutations. The second line should contain *n* numbers, corresponding to the elements of the given array. If the *i*-th element belongs to the first permutation, the *i*-th number should be 1, if it belongs to the second one, then its number should be 2 and so on. The order of the permutations’ numbering is free.
If several solutions are possible, print any one of them. If there’s no solution, print in the first line <=-<=1.
Demo Input:
['9\n1 2 3 1 2 1 4 2 5\n', '4\n4 3 2 1\n', '4\n1 2 2 3\n']
Demo Output:
['3\n3 1 2 1 2 2 2 3 2\n', '1\n1 1 1 1 ', '-1\n']
Note:
In the first sample test the array is split into three permutations: (2, 1), (3, 2, 1, 4, 5), (1, 2). The first permutation is formed by the second and the fourth elements of the array, the second one — by the third, the fifth, the sixth, the seventh and the ninth elements, the third one — by the first and the eigth elements. Clearly, there are other splitting variants possible.
|
```python
n = int(input())
m = list(map(int, input().split()))
mm = [1] * max(m)
m1 = []
for i in range(n):
m1.append(mm[m[i] - 1])
mm[m[i] - 1] += 1
for i in range(2, max(m) + 1):
if m.count(i) > m.count(i - 1):
print(-1)
break
else:
print(max(m1))
print(*m1)
```
| 0
|
981
|
A
|
Antipalindrome
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation",
"strings"
] | null | null |
A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not.
A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$.
Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all.
Some time ago Ann read the word $s$. What is the word she changed it into?
|
The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only.
|
If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$.
Note that there can be multiple longest substrings that are not palindromes, but their length is unique.
|
[
"mew\n",
"wuffuw\n",
"qqqqqqqq\n"
] |
[
"3\n",
"5\n",
"0\n"
] |
"mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$.
The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$.
All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
| 500
|
[
{
"input": "mew",
"output": "3"
},
{
"input": "wuffuw",
"output": "5"
},
{
"input": "qqqqqqqq",
"output": "0"
},
{
"input": "ijvji",
"output": "4"
},
{
"input": "iiiiiii",
"output": "0"
},
{
"input": "wobervhvvkihcuyjtmqhaaigvvgiaahqmtjyuchikvvhvrebow",
"output": "49"
},
{
"input": "wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww",
"output": "0"
},
{
"input": "wobervhvvkihcuyjtmqhaaigvahheoqleromusrartldojsjvy",
"output": "50"
},
{
"input": "ijvxljt",
"output": "7"
},
{
"input": "fyhcncnchyf",
"output": "10"
},
{
"input": "ffffffffffff",
"output": "0"
},
{
"input": "fyhcncfsepqj",
"output": "12"
},
{
"input": "ybejrrlbcinttnicblrrjeby",
"output": "23"
},
{
"input": "yyyyyyyyyyyyyyyyyyyyyyyyy",
"output": "0"
},
{
"input": "ybejrrlbcintahovgjddrqatv",
"output": "25"
},
{
"input": "oftmhcmclgyqaojljoaqyglcmchmtfo",
"output": "30"
},
{
"input": "oooooooooooooooooooooooooooooooo",
"output": "0"
},
{
"input": "oftmhcmclgyqaojllbotztajglsmcilv",
"output": "32"
},
{
"input": "gxandbtgpbknxvnkjaajknvxnkbpgtbdnaxg",
"output": "35"
},
{
"input": "gggggggggggggggggggggggggggggggggggg",
"output": "0"
},
{
"input": "gxandbtgpbknxvnkjaygommzqitqzjfalfkk",
"output": "36"
},
{
"input": "fcliblymyqckxvieotjooojtoeivxkcqymylbilcf",
"output": "40"
},
{
"input": "fffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "fcliblymyqckxvieotjootiqwtyznhhvuhbaixwqnsy",
"output": "43"
},
{
"input": "rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr",
"output": "0"
},
{
"input": "rajccqwqnqmshmerpvjyfepxwpxyldzpzhctqjnstxyfmlhiy",
"output": "49"
},
{
"input": "a",
"output": "0"
},
{
"input": "abca",
"output": "4"
},
{
"input": "aaaaabaaaaa",
"output": "10"
},
{
"input": "aba",
"output": "2"
},
{
"input": "asaa",
"output": "4"
},
{
"input": "aabaa",
"output": "4"
},
{
"input": "aabbaa",
"output": "5"
},
{
"input": "abcdaaa",
"output": "7"
},
{
"input": "aaholaa",
"output": "7"
},
{
"input": "abcdefghijka",
"output": "12"
},
{
"input": "aaadcba",
"output": "7"
},
{
"input": "aaaabaaaa",
"output": "8"
},
{
"input": "abaa",
"output": "4"
},
{
"input": "abcbaa",
"output": "6"
},
{
"input": "ab",
"output": "2"
},
{
"input": "l",
"output": "0"
},
{
"input": "aaaabcaaaa",
"output": "10"
},
{
"input": "abbaaaaaabba",
"output": "11"
},
{
"input": "abaaa",
"output": "5"
},
{
"input": "baa",
"output": "3"
},
{
"input": "aaaaaaabbba",
"output": "11"
},
{
"input": "ccbcc",
"output": "4"
},
{
"input": "bbbaaab",
"output": "7"
},
{
"input": "abaaaaaaaa",
"output": "10"
},
{
"input": "abaaba",
"output": "5"
},
{
"input": "aabsdfaaaa",
"output": "10"
},
{
"input": "aaaba",
"output": "5"
},
{
"input": "aaabaaa",
"output": "6"
},
{
"input": "baaabbb",
"output": "7"
},
{
"input": "ccbbabbcc",
"output": "8"
},
{
"input": "cabc",
"output": "4"
},
{
"input": "aabcd",
"output": "5"
},
{
"input": "abcdea",
"output": "6"
},
{
"input": "bbabb",
"output": "4"
},
{
"input": "aaaaabababaaaaa",
"output": "14"
},
{
"input": "bbabbb",
"output": "6"
},
{
"input": "aababd",
"output": "6"
},
{
"input": "abaaaa",
"output": "6"
},
{
"input": "aaaaaaaabbba",
"output": "12"
},
{
"input": "aabca",
"output": "5"
},
{
"input": "aaabccbaaa",
"output": "9"
},
{
"input": "aaaaaaaaaaaaaaaaaaaab",
"output": "21"
},
{
"input": "babb",
"output": "4"
},
{
"input": "abcaa",
"output": "5"
},
{
"input": "qwqq",
"output": "4"
},
{
"input": "aaaaaaaaaaabbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaa",
"output": "48"
},
{
"input": "aaab",
"output": "4"
},
{
"input": "aaaaaabaaaaa",
"output": "12"
},
{
"input": "wwuww",
"output": "4"
},
{
"input": "aaaaabcbaaaaa",
"output": "12"
},
{
"input": "aaabbbaaa",
"output": "8"
},
{
"input": "aabcbaa",
"output": "6"
},
{
"input": "abccdefccba",
"output": "11"
},
{
"input": "aabbcbbaa",
"output": "8"
},
{
"input": "aaaabbaaaa",
"output": "9"
},
{
"input": "aabcda",
"output": "6"
},
{
"input": "abbca",
"output": "5"
},
{
"input": "aaaaaabbaaa",
"output": "11"
},
{
"input": "sssssspssssss",
"output": "12"
},
{
"input": "sdnmsdcs",
"output": "8"
},
{
"input": "aaabbbccbbbaaa",
"output": "13"
},
{
"input": "cbdbdc",
"output": "6"
},
{
"input": "abb",
"output": "3"
},
{
"input": "abcdefaaaa",
"output": "10"
},
{
"input": "abbbaaa",
"output": "7"
},
{
"input": "v",
"output": "0"
},
{
"input": "abccbba",
"output": "7"
},
{
"input": "axyza",
"output": "5"
},
{
"input": "abcdefgaaaa",
"output": "11"
},
{
"input": "aaabcdaaa",
"output": "9"
},
{
"input": "aaaacaaaa",
"output": "8"
},
{
"input": "aaaaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaaaa",
"output": "42"
},
{
"input": "abbbaa",
"output": "6"
},
{
"input": "abcdee",
"output": "6"
},
{
"input": "oom",
"output": "3"
},
{
"input": "aabcaa",
"output": "6"
},
{
"input": "abba",
"output": "3"
},
{
"input": "aaca",
"output": "4"
},
{
"input": "aacbca",
"output": "6"
},
{
"input": "ababa",
"output": "4"
},
{
"input": "abcda",
"output": "5"
},
{
"input": "cccaaccc",
"output": "7"
},
{
"input": "aaabcda",
"output": "7"
},
{
"input": "aa",
"output": "0"
},
{
"input": "aabaaaa",
"output": "7"
},
{
"input": "abbaaaa",
"output": "7"
},
{
"input": "aaabcbaaa",
"output": "8"
},
{
"input": "aabba",
"output": "5"
},
{
"input": "xyxx",
"output": "4"
},
{
"input": "aaaaaaaaaaaabc",
"output": "14"
},
{
"input": "bbaaaabb",
"output": "7"
},
{
"input": "aaabaa",
"output": "6"
},
{
"input": "sssssabsssss",
"output": "12"
},
{
"input": "bbbaaaabbb",
"output": "9"
},
{
"input": "abbbbaaaa",
"output": "9"
},
{
"input": "wwufuww",
"output": "6"
},
{
"input": "oowoo",
"output": "4"
},
{
"input": "cccaccc",
"output": "6"
},
{
"input": "aaa",
"output": "0"
},
{
"input": "bbbcc",
"output": "5"
},
{
"input": "abcdef",
"output": "6"
},
{
"input": "abbba",
"output": "4"
},
{
"input": "aab",
"output": "3"
},
{
"input": "aaba",
"output": "4"
},
{
"input": "azbyaaa",
"output": "7"
},
{
"input": "oooooiooooo",
"output": "10"
},
{
"input": "aabbbbbaaaaaa",
"output": "13"
}
] | 1,529,068,692
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 133
| 93
| 102,400
|
s = input()
k = s[::-1]
if s != k:
print(len(s))
elif len(set(list(s))) == 1:
print(0)
else:
print(len(s) - 1)
|
Title: Antipalindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A string is a palindrome if it reads the same from the left to the right and from the right to the left. For example, the strings "kek", "abacaba", "r" and "papicipap" are palindromes, while the strings "abb" and "iq" are not.
A substring $s[l \ldots r]$ ($1<=\leq<=l<=\leq<=r<=\leq<=|s|$) of a string $s<==<=s_{1}s_{2} \ldots s_{|s|}$ is the string $s_{l}s_{l<=+<=1} \ldots s_{r}$.
Anna does not like palindromes, so she makes her friends call her Ann. She also changes all the words she reads in a similar way. Namely, each word $s$ is changed into its longest substring that is not a palindrome. If all the substrings of $s$ are palindromes, she skips the word at all.
Some time ago Ann read the word $s$. What is the word she changed it into?
Input Specification:
The first line contains a non-empty string $s$ with length at most $50$ characters, containing lowercase English letters only.
Output Specification:
If there is such a substring in $s$ that is not a palindrome, print the maximum length of such a substring. Otherwise print $0$.
Note that there can be multiple longest substrings that are not palindromes, but their length is unique.
Demo Input:
['mew\n', 'wuffuw\n', 'qqqqqqqq\n']
Demo Output:
['3\n', '5\n', '0\n']
Note:
"mew" is not a palindrome, so the longest substring of it that is not a palindrome, is the string "mew" itself. Thus, the answer for the first example is $3$.
The string "uffuw" is one of the longest non-palindrome substrings (of length $5$) of the string "wuffuw", so the answer for the second example is $5$.
All substrings of the string "qqqqqqqq" consist of equal characters so they are palindromes. This way, there are no non-palindrome substrings. Thus, the answer for the third example is $0$.
|
```python
s = input()
k = s[::-1]
if s != k:
print(len(s))
elif len(set(list(s))) == 1:
print(0)
else:
print(len(s) - 1)
```
| 3
|
|
938
|
B
|
Run For Your Prize
|
PROGRAMMING
| 1,100
|
[
"brute force",
"greedy"
] | null | null |
You and your friend are participating in a TV show "Run For Your Prize".
At the start of the show *n* prizes are located on a straight line. *i*-th prize is located at position *a**i*. Positions of all prizes are distinct. You start at position 1, your friend — at position 106 (and there is no prize in any of these two positions). You have to work as a team and collect all prizes in minimum possible time, in any order.
You know that it takes exactly 1 second to move from position *x* to position *x*<=+<=1 or *x*<=-<=1, both for you and your friend. You also have trained enough to instantly pick up any prize, if its position is equal to your current position (and the same is true for your friend). Carrying prizes does not affect your speed (or your friend's speed) at all.
Now you may discuss your strategy with your friend and decide who will pick up each prize. Remember that every prize must be picked up, either by you or by your friend.
What is the minimum number of seconds it will take to pick up all the prizes?
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of prizes.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (2<=≤<=*a**i*<=≤<=106<=-<=1) — the positions of the prizes. No two prizes are located at the same position. Positions are given in ascending order.
|
Print one integer — the minimum number of seconds it will take to collect all prizes.
|
[
"3\n2 3 9\n",
"2\n2 999995\n"
] |
[
"8\n",
"5\n"
] |
In the first example you take all the prizes: take the first at 1, the second at 2 and the third at 8.
In the second example you take the first prize in 1 second and your friend takes the other in 5 seconds, you do this simultaneously, so the total time is 5.
| 0
|
[
{
"input": "3\n2 3 9",
"output": "8"
},
{
"input": "2\n2 999995",
"output": "5"
},
{
"input": "1\n20",
"output": "19"
},
{
"input": "6\n2 3 500000 999997 999998 999999",
"output": "499999"
},
{
"input": "1\n999999",
"output": "1"
},
{
"input": "1\n510000",
"output": "490000"
},
{
"input": "3\n2 5 27",
"output": "26"
},
{
"input": "2\n600000 800000",
"output": "400000"
},
{
"input": "5\n2 5 6 27 29",
"output": "28"
},
{
"input": "1\n500001",
"output": "499999"
},
{
"input": "10\n3934 38497 42729 45023 51842 68393 77476 82414 91465 98055",
"output": "98054"
},
{
"input": "1\n900000",
"output": "100000"
},
{
"input": "1\n500000",
"output": "499999"
},
{
"input": "1\n999998",
"output": "2"
},
{
"input": "3\n999997 999998 999999",
"output": "3"
},
{
"input": "2\n999997 999999",
"output": "3"
},
{
"input": "2\n2 999998",
"output": "2"
},
{
"input": "2\n500000 500001",
"output": "499999"
},
{
"input": "1\n500002",
"output": "499998"
},
{
"input": "1\n700000",
"output": "300000"
},
{
"input": "2\n2 999999",
"output": "1"
},
{
"input": "2\n999998 999999",
"output": "2"
},
{
"input": "1\n999995",
"output": "5"
},
{
"input": "2\n499999 500001",
"output": "499999"
},
{
"input": "1\n499999",
"output": "499998"
},
{
"input": "2\n100 999900",
"output": "100"
},
{
"input": "2\n499999 500000",
"output": "499999"
},
{
"input": "2\n500001 999999",
"output": "499999"
},
{
"input": "3\n500000 500001 500002",
"output": "499999"
},
{
"input": "2\n2 500001",
"output": "499999"
},
{
"input": "2\n499999 999999",
"output": "499998"
},
{
"input": "2\n2 500000",
"output": "499999"
},
{
"input": "4\n2 3 4 999999",
"output": "3"
},
{
"input": "2\n100000 500001",
"output": "499999"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n800000",
"output": "200000"
},
{
"input": "1\n505050",
"output": "494950"
},
{
"input": "1\n753572",
"output": "246428"
},
{
"input": "2\n576696 760487",
"output": "423304"
},
{
"input": "10\n3 4 5 6 7 8 9 10 11 12",
"output": "11"
},
{
"input": "4\n2 3 4 5",
"output": "4"
},
{
"input": "4\n999996 999997 999998 999999",
"output": "4"
}
] | 1,637,500,117
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 48
| 156
| 7,372,800
|
n=int(input())
a=list(map(int,input().split()))
v=[0]*n
curA=1
curB=int(1e6)
mx=0
for i in range(n):
x=abs(curA-a[i])
y=abs(curB-a[i])
mx=max(mx,min(x,y))
print(mx)
|
Title: Run For Your Prize
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You and your friend are participating in a TV show "Run For Your Prize".
At the start of the show *n* prizes are located on a straight line. *i*-th prize is located at position *a**i*. Positions of all prizes are distinct. You start at position 1, your friend — at position 106 (and there is no prize in any of these two positions). You have to work as a team and collect all prizes in minimum possible time, in any order.
You know that it takes exactly 1 second to move from position *x* to position *x*<=+<=1 or *x*<=-<=1, both for you and your friend. You also have trained enough to instantly pick up any prize, if its position is equal to your current position (and the same is true for your friend). Carrying prizes does not affect your speed (or your friend's speed) at all.
Now you may discuss your strategy with your friend and decide who will pick up each prize. Remember that every prize must be picked up, either by you or by your friend.
What is the minimum number of seconds it will take to pick up all the prizes?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the number of prizes.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (2<=≤<=*a**i*<=≤<=106<=-<=1) — the positions of the prizes. No two prizes are located at the same position. Positions are given in ascending order.
Output Specification:
Print one integer — the minimum number of seconds it will take to collect all prizes.
Demo Input:
['3\n2 3 9\n', '2\n2 999995\n']
Demo Output:
['8\n', '5\n']
Note:
In the first example you take all the prizes: take the first at 1, the second at 2 and the third at 8.
In the second example you take the first prize in 1 second and your friend takes the other in 5 seconds, you do this simultaneously, so the total time is 5.
|
```python
n=int(input())
a=list(map(int,input().split()))
v=[0]*n
curA=1
curB=int(1e6)
mx=0
for i in range(n):
x=abs(curA-a[i])
y=abs(curB-a[i])
mx=max(mx,min(x,y))
print(mx)
```
| 3
|
|
39
|
J
|
Spelling Check
|
PROGRAMMING
| 1,500
|
[
"hashing",
"implementation",
"strings"
] |
J. Spelling Check
|
2
|
256
|
Petya has noticed that when he types using a keyboard, he often presses extra buttons and adds extra letters to the words. Of course, the spell-checking system underlines the words for him and he has to click every word and choose the right variant. Petya got fed up with correcting his mistakes himself, that’s why he decided to invent the function that will correct the words itself. Petya started from analyzing the case that happens to him most of the time, when all one needs is to delete one letter for the word to match a word from the dictionary. Thus, Petya faces one mini-task: he has a printed word and a word from the dictionary, and he should delete one letter from the first word to get the second one. And now the very non-trivial question that Petya faces is: which letter should he delete?
|
The input data contains two strings, consisting of lower-case Latin letters. The length of each string is from 1 to 106 symbols inclusive, the first string contains exactly 1 symbol more than the second one.
|
In the first line output the number of positions of the symbols in the first string, after the deleting of which the first string becomes identical to the second one. In the second line output space-separated positions of these symbols in increasing order. The positions are numbered starting from 1. If it is impossible to make the first string identical to the second string by deleting one symbol, output one number 0.
|
[
"abdrakadabra\nabrakadabra\n",
"aa\na\n",
"competition\ncodeforces\n"
] |
[
"1\n3\n",
"2\n1 2\n",
"0\n"
] |
none
| 0
|
[
{
"input": "abdrakadabra\nabrakadabra",
"output": "1\n3 "
},
{
"input": "aa\na",
"output": "2\n1 2 "
},
{
"input": "competition\ncodeforces",
"output": "0"
},
{
"input": "ab\na",
"output": "1\n2 "
},
{
"input": "bb\nb",
"output": "2\n1 2 "
},
{
"input": "aab\nab",
"output": "2\n1 2 "
},
{
"input": "aabb\nabb",
"output": "2\n1 2 "
},
{
"input": "babaacaacaa\nbbaacaacaa",
"output": "1\n2 "
},
{
"input": "bccaabbcccc\nbccaabcccc",
"output": "2\n6 7 "
},
{
"input": "ababcaabaaa\nabacaabaaa",
"output": "1\n4 "
},
{
"input": "cccacaccacb\ncccacaccac",
"output": "1\n11 "
},
{
"input": "aaaaaaaaaaa\naaaaaaaaaa",
"output": "11\n1 2 3 4 5 6 7 8 9 10 11 "
},
{
"input": "lcaaxcbcjca\nccaaacccca",
"output": "0"
},
{
"input": "babbbtaamba\nbabbbaabba",
"output": "0"
},
{
"input": "xdfxmcnzpch\nazvotghvtk",
"output": "0"
},
{
"input": "ki\nb",
"output": "0"
},
{
"input": "vct\nie",
"output": "0"
},
{
"input": "feee\nsnl",
"output": "0"
},
{
"input": "cbxxxxzvks\ncbxxxzvks",
"output": "4\n3 4 5 6 "
},
{
"input": "qybldcgfhdhhhhhhhhhhopqkhuczzytzluiahwbqjltgafvvoecititchjwdoljiehubngmtjckqymldhoncgtqhxnqvoagnrmur\nqybldcgfhdhhhhhhhhhopqkhuczzytzluiahwbqjltgafvvoecititchjwdoljiehubngmtjckqymldhoncgtqhxnqvoagnrmur",
"output": "10\n11 12 13 14 15 16 17 18 19 20 "
}
] | 1,680,721,526
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 15
| 2,000
| 7,168,000
|
def read_input_codeforces():
word1 = input()
word2 = input()
return word1, word2
word1, word2 = read_input_codeforces()
total_positions = 0
positions = []
for i, letter in enumerate(word1):
if word1[0:i] + word1[i+1:] == word2:
positions.append(i+1)
total_positions += 1
print(total_positions)
for position in positions:
print(str(position), end=' ')
|
Title: Spelling Check
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya has noticed that when he types using a keyboard, he often presses extra buttons and adds extra letters to the words. Of course, the spell-checking system underlines the words for him and he has to click every word and choose the right variant. Petya got fed up with correcting his mistakes himself, that’s why he decided to invent the function that will correct the words itself. Petya started from analyzing the case that happens to him most of the time, when all one needs is to delete one letter for the word to match a word from the dictionary. Thus, Petya faces one mini-task: he has a printed word and a word from the dictionary, and he should delete one letter from the first word to get the second one. And now the very non-trivial question that Petya faces is: which letter should he delete?
Input Specification:
The input data contains two strings, consisting of lower-case Latin letters. The length of each string is from 1 to 106 symbols inclusive, the first string contains exactly 1 symbol more than the second one.
Output Specification:
In the first line output the number of positions of the symbols in the first string, after the deleting of which the first string becomes identical to the second one. In the second line output space-separated positions of these symbols in increasing order. The positions are numbered starting from 1. If it is impossible to make the first string identical to the second string by deleting one symbol, output one number 0.
Demo Input:
['abdrakadabra\nabrakadabra\n', 'aa\na\n', 'competition\ncodeforces\n']
Demo Output:
['1\n3\n', '2\n1 2\n', '0\n']
Note:
none
|
```python
def read_input_codeforces():
word1 = input()
word2 = input()
return word1, word2
word1, word2 = read_input_codeforces()
total_positions = 0
positions = []
for i, letter in enumerate(word1):
if word1[0:i] + word1[i+1:] == word2:
positions.append(i+1)
total_positions += 1
print(total_positions)
for position in positions:
print(str(position), end=' ')
```
| 0
|
754
|
E
|
Dasha and cyclic table
|
PROGRAMMING
| 2,600
|
[
"bitmasks",
"brute force",
"fft",
"strings",
"trees"
] | null | null |
Dasha is fond of challenging puzzles: Rubik's Cube 3<=×<=3<=×<=3, 4<=×<=4<=×<=4, 5<=×<=5<=×<=5 and so on. This time she has a cyclic table of size *n*<=×<=*m*, and each cell of the table contains a lowercase English letter. Each cell has coordinates (*i*,<=*j*) (0<=≤<=*i*<=<<=*n*, 0<=≤<=*j*<=<<=*m*). The table is cyclic means that to the right of cell (*i*,<=*j*) there is the cell , and to the down there is the cell .
Dasha has a pattern as well. A pattern is a non-cyclic table of size *r*<=×<=*c*. Each cell is either a lowercase English letter or a question mark. Each cell has coordinates (*i*,<=*j*) (0<=≤<=*i*<=<<=*r*, 0<=≤<=*j*<=<<=*c*).
The goal of the puzzle is to find all the appearance positions of the pattern in the cyclic table.
We say that the cell (*i*,<=*j*) of cyclic table is an appearance position, if for every pair (*x*,<=*y*) such that 0<=≤<=*x*<=<<=*r* and 0<=≤<=*y*<=<<=*c* one of the following conditions holds:
- There is a question mark in the cell (*x*,<=*y*) of the pattern, or - The cell of the cyclic table equals to the cell (*x*,<=*y*) of the pattern.
Dasha solved this puzzle in no time, as well as all the others she ever tried. Can you solve it?.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=400) — the cyclic table sizes.
Each of the next *n* lines contains a string of *m* lowercase English characters — the description of the cyclic table.
The next line contains two integers *r* and *c* (1<=≤<=*r*,<=*c*<=≤<=400) — the sizes of the pattern.
Each of the next *r* lines contains a string of *c* lowercase English letter and/or characters '?' — the description of the pattern.
|
Print *n* lines. Each of the *n* lines should contain *m* characters. Each of the characters should equal '0' or '1'.
The *j*-th character of the *i*-th (0-indexed) line should be equal to '1', in case the cell (*i*,<=*j*) is an appearance position, otherwise it should be equal to '0'.
|
[
"5 7\nqcezchs\nhhedywq\nwikywqy\nqckrqzt\nbqexcxz\n3 2\n??\nyw\n?q\n",
"10 10\nfwtoayylhw\nyyaryyjawr\nywrdzwhscy\nhnsyyxiphn\nbnjwzyyjvo\nkkjgseenwn\ngvmiflpcsy\nlxvkwrobwu\nwyybbcocyy\nyysijsvqry\n2 2\n??\nyy\n",
"8 6\nibrgxl\nxqdcsg\nokbcgi\ntvpetc\nxgxxig\nigghzo\nlmlaza\ngpswzv\n1 4\ngx??\n"
] |
[
"0000100\n0001001\n0000000\n0000000\n0000000\n",
"1000100000\n0000000001\n0001000000\n0000010000\n0000000000\n0000000000\n0000000000\n0100000010\n1000000001\n0000010000\n",
"000100\n000001\n000000\n000000\n010001\n000000\n000000\n000000\n"
] |
none
| 2,500
|
[] | 1,485,279,876
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 5
| 6,000
| 5,427,200
|
n, m = map(int, input().split())
lines = list()
for i in range(n):
lines.append(input())
r, c = map(int, input().split())
table = list()
for i in range(r):
table.append(input())
ansTable = [[0] * m for i in range(n)]
for i in range(n):
for j in range(m):
ans = True
for q in range(r):
for p in range(c):
if lines[(i + q) % n][(j + p) % m] == table[q][p] or table[q][p] == '?':
pass
else:
ans = False
if ans:
ansTable[i][j] = 1
for elem in ansTable:
print(*elem, sep='')
|
Title: Dasha and cyclic table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dasha is fond of challenging puzzles: Rubik's Cube 3<=×<=3<=×<=3, 4<=×<=4<=×<=4, 5<=×<=5<=×<=5 and so on. This time she has a cyclic table of size *n*<=×<=*m*, and each cell of the table contains a lowercase English letter. Each cell has coordinates (*i*,<=*j*) (0<=≤<=*i*<=<<=*n*, 0<=≤<=*j*<=<<=*m*). The table is cyclic means that to the right of cell (*i*,<=*j*) there is the cell , and to the down there is the cell .
Dasha has a pattern as well. A pattern is a non-cyclic table of size *r*<=×<=*c*. Each cell is either a lowercase English letter or a question mark. Each cell has coordinates (*i*,<=*j*) (0<=≤<=*i*<=<<=*r*, 0<=≤<=*j*<=<<=*c*).
The goal of the puzzle is to find all the appearance positions of the pattern in the cyclic table.
We say that the cell (*i*,<=*j*) of cyclic table is an appearance position, if for every pair (*x*,<=*y*) such that 0<=≤<=*x*<=<<=*r* and 0<=≤<=*y*<=<<=*c* one of the following conditions holds:
- There is a question mark in the cell (*x*,<=*y*) of the pattern, or - The cell of the cyclic table equals to the cell (*x*,<=*y*) of the pattern.
Dasha solved this puzzle in no time, as well as all the others she ever tried. Can you solve it?.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=400) — the cyclic table sizes.
Each of the next *n* lines contains a string of *m* lowercase English characters — the description of the cyclic table.
The next line contains two integers *r* and *c* (1<=≤<=*r*,<=*c*<=≤<=400) — the sizes of the pattern.
Each of the next *r* lines contains a string of *c* lowercase English letter and/or characters '?' — the description of the pattern.
Output Specification:
Print *n* lines. Each of the *n* lines should contain *m* characters. Each of the characters should equal '0' or '1'.
The *j*-th character of the *i*-th (0-indexed) line should be equal to '1', in case the cell (*i*,<=*j*) is an appearance position, otherwise it should be equal to '0'.
Demo Input:
['5 7\nqcezchs\nhhedywq\nwikywqy\nqckrqzt\nbqexcxz\n3 2\n??\nyw\n?q\n', '10 10\nfwtoayylhw\nyyaryyjawr\nywrdzwhscy\nhnsyyxiphn\nbnjwzyyjvo\nkkjgseenwn\ngvmiflpcsy\nlxvkwrobwu\nwyybbcocyy\nyysijsvqry\n2 2\n??\nyy\n', '8 6\nibrgxl\nxqdcsg\nokbcgi\ntvpetc\nxgxxig\nigghzo\nlmlaza\ngpswzv\n1 4\ngx??\n']
Demo Output:
['0000100\n0001001\n0000000\n0000000\n0000000\n', '1000100000\n0000000001\n0001000000\n0000010000\n0000000000\n0000000000\n0000000000\n0100000010\n1000000001\n0000010000\n', '000100\n000001\n000000\n000000\n010001\n000000\n000000\n000000\n']
Note:
none
|
```python
n, m = map(int, input().split())
lines = list()
for i in range(n):
lines.append(input())
r, c = map(int, input().split())
table = list()
for i in range(r):
table.append(input())
ansTable = [[0] * m for i in range(n)]
for i in range(n):
for j in range(m):
ans = True
for q in range(r):
for p in range(c):
if lines[(i + q) % n][(j + p) % m] == table[q][p] or table[q][p] == '?':
pass
else:
ans = False
if ans:
ansTable[i][j] = 1
for elem in ansTable:
print(*elem, sep='')
```
| 0
|
|
126
|
B
|
Password
|
PROGRAMMING
| 1,700
|
[
"binary search",
"dp",
"hashing",
"string suffix structures",
"strings"
] | null | null |
Asterix, Obelix and their temporary buddies Suffix and Prefix has finally found the Harmony temple. However, its doors were firmly locked and even Obelix had no luck opening them.
A little later they found a string *s*, carved on a rock below the temple's gates. Asterix supposed that that's the password that opens the temple and read the string aloud. However, nothing happened. Then Asterix supposed that a password is some substring *t* of the string *s*.
Prefix supposed that the substring *t* is the beginning of the string *s*; Suffix supposed that the substring *t* should be the end of the string *s*; and Obelix supposed that *t* should be located somewhere inside the string *s*, that is, *t* is neither its beginning, nor its end.
Asterix chose the substring *t* so as to please all his companions. Besides, from all acceptable variants Asterix chose the longest one (as Asterix loves long strings). When Asterix read the substring *t* aloud, the temple doors opened.
You know the string *s*. Find the substring *t* or determine that such substring does not exist and all that's been written above is just a nice legend.
|
You are given the string *s* whose length can vary from 1 to 106 (inclusive), consisting of small Latin letters.
|
Print the string *t*. If a suitable *t* string does not exist, then print "Just a legend" without the quotes.
|
[
"fixprefixsuffix\n",
"abcdabc\n"
] |
[
"fix",
"Just a legend"
] |
none
| 1,000
|
[
{
"input": "fixprefixsuffix",
"output": "fix"
},
{
"input": "abcdabc",
"output": "Just a legend"
},
{
"input": "qwertyqwertyqwerty",
"output": "qwerty"
},
{
"input": "papapapap",
"output": "papap"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaa"
},
{
"input": "ghbdtn",
"output": "Just a legend"
},
{
"input": "a",
"output": "Just a legend"
},
{
"input": "aa",
"output": "Just a legend"
},
{
"input": "ab",
"output": "Just a legend"
},
{
"input": "aaa",
"output": "a"
},
{
"input": "aba",
"output": "Just a legend"
},
{
"input": "aab",
"output": "Just a legend"
},
{
"input": "abb",
"output": "Just a legend"
},
{
"input": "abc",
"output": "Just a legend"
},
{
"input": "aaabaabaaaaab",
"output": "Just a legend"
},
{
"input": "aabaaabaaaaab",
"output": "aab"
},
{
"input": "aaabaaaabab",
"output": "Just a legend"
},
{
"input": "abcabcabcabcabc",
"output": "abcabcabc"
},
{
"input": "aaaaabaaaa",
"output": "aaaa"
},
{
"input": "aaaabaaaaaaa",
"output": "aaaa"
},
{
"input": "ghghghgxghghghg",
"output": "ghghg"
},
{
"input": "kincenvizh",
"output": "Just a legend"
},
{
"input": "amcksgurlgqzqizdauqminfzshiweejkevbazyzylrrghumnvqeqqdedyopgtvxakqwpvxntxgrkrcxabhrgoxngrwrxrvcguuyw",
"output": "Just a legend"
},
{
"input": "kwuaizneqxfflhmyruotjlkqksinoanvkyvqptkkntnpjdyzicceelgooajdgpkneuhyvhdtmasiglplajxolxovlhkwuaizneqx",
"output": "Just a legend"
},
{
"input": "nfbdzgdlbjhrlvfryyjbvtsmzacxglcvukmyexdgpuiwvqbnfbdzgdlbjhrlvfryyjbtuomcwbwvlhefnfbdzgdlbjhrlvfryyjb",
"output": "nfbdzgdlbjhrlvfryyjb"
},
{
"input": "btbdpnzdenxueteteytvkwnegodyhmdwhmrmbftrifytzudumzlacwytsuzefqfpjesdblxhpcsidgksisjdmhyxmmugrjmtfcgxmcgpmvbxbyszdugvmoyjeeqsywcvuqskcjotyhvdijyslgfvyujxthngnonasgnbzzygyikheelirdfsvuicbiazfdeqecbtbdpnzdenxueteteytvkwnegodyhmdwhmrmbftrifytzudumzlacwytsuzefqfpjesdblxhpcsidgksisjdmhyxmmugrjmtfcgxmcgpccdtdteohtjjuicfjfcbzpynlqhecyqqrjpmexgfqywnfmusldgzvgnzdmuuujtkdfnlytzgstquwqpuccxbtbdpnzdenxueteteytvkwnegodyhmdwhmrmbftrifytzudumzlacwytsuzefqfpjesdblxhpcsidgksisjdmhyxmmugrjmtfcgxmcgp",
"output": "btbdpnzdenxueteteytvkwnegodyhmdwhmrmbftrifytzudumzlacwytsuzefqfpjesdblxhpcsidgksisjdmhyxmmugrjmtfcgxmcgp"
},
{
"input": "abcazabca",
"output": "a"
}
] | 1,679,996,008
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
ch=input()
L=[0 * len(ch) for _ in range(len(ch))]
p = -1
L[0] = p
for i in range(1, len(ch)):
while p != -1 and ch[i] != ch[p+1]:
p = L[p]
if ch[i] == ch[p+1]:
p += 1
L[i] = p
else:
L[i] = -1
max = L[len(ch) - 1]
ans = L[max] if L[max] != -1 else max
if ans == -1:
print("Just a legend")
else:
print(ch[:ans+1])
|
Title: Password
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Asterix, Obelix and their temporary buddies Suffix and Prefix has finally found the Harmony temple. However, its doors were firmly locked and even Obelix had no luck opening them.
A little later they found a string *s*, carved on a rock below the temple's gates. Asterix supposed that that's the password that opens the temple and read the string aloud. However, nothing happened. Then Asterix supposed that a password is some substring *t* of the string *s*.
Prefix supposed that the substring *t* is the beginning of the string *s*; Suffix supposed that the substring *t* should be the end of the string *s*; and Obelix supposed that *t* should be located somewhere inside the string *s*, that is, *t* is neither its beginning, nor its end.
Asterix chose the substring *t* so as to please all his companions. Besides, from all acceptable variants Asterix chose the longest one (as Asterix loves long strings). When Asterix read the substring *t* aloud, the temple doors opened.
You know the string *s*. Find the substring *t* or determine that such substring does not exist and all that's been written above is just a nice legend.
Input Specification:
You are given the string *s* whose length can vary from 1 to 106 (inclusive), consisting of small Latin letters.
Output Specification:
Print the string *t*. If a suitable *t* string does not exist, then print "Just a legend" without the quotes.
Demo Input:
['fixprefixsuffix\n', 'abcdabc\n']
Demo Output:
['fix', 'Just a legend']
Note:
none
|
```python
ch=input()
L=[0 * len(ch) for _ in range(len(ch))]
p = -1
L[0] = p
for i in range(1, len(ch)):
while p != -1 and ch[i] != ch[p+1]:
p = L[p]
if ch[i] == ch[p+1]:
p += 1
L[i] = p
else:
L[i] = -1
max = L[len(ch) - 1]
ans = L[max] if L[max] != -1 else max
if ans == -1:
print("Just a legend")
else:
print(ch[:ans+1])
```
| 0
|
|
439
|
A
|
Devu, the Singer and Churu, the Joker
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
|
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
|
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
|
[
"3 30\n2 2 1\n",
"3 20\n2 1 1\n"
] |
[
"5\n",
"-1\n"
] |
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
| 500
|
[
{
"input": "3 30\n2 2 1",
"output": "5"
},
{
"input": "3 20\n2 1 1",
"output": "-1"
},
{
"input": "50 10000\n5 4 10 9 9 6 7 7 7 3 3 7 7 4 7 4 10 10 1 7 10 3 1 4 5 7 2 10 10 10 2 3 4 7 6 1 8 4 7 3 8 8 4 10 1 1 9 2 6 1",
"output": "1943"
},
{
"input": "50 10000\n4 7 15 9 11 12 20 9 14 14 10 13 6 13 14 17 6 8 20 12 10 15 13 17 5 12 13 11 7 5 5 2 3 15 13 7 14 14 19 2 13 14 5 15 3 19 15 16 4 1",
"output": "1891"
},
{
"input": "100 9000\n5 2 3 1 1 3 4 9 9 6 7 10 10 10 2 10 6 8 8 6 7 9 9 5 6 2 1 10 10 9 4 5 9 2 4 3 8 5 6 1 1 5 3 6 2 6 6 6 5 8 3 6 7 3 1 10 9 1 8 3 10 9 5 6 3 4 1 1 10 10 2 3 4 8 10 10 5 1 5 3 6 8 10 6 10 2 1 8 10 1 7 6 9 10 5 2 3 5 3 2",
"output": "1688"
},
{
"input": "100 8007\n5 19 14 18 9 6 15 8 1 14 11 20 3 17 7 12 2 6 3 17 7 20 1 14 20 17 2 10 13 7 18 18 9 10 16 8 1 11 11 9 13 18 9 20 12 12 7 15 12 17 11 5 11 15 9 2 15 1 18 3 18 16 15 4 10 5 18 13 13 12 3 8 17 2 12 2 13 3 1 13 2 4 9 10 18 10 14 4 4 17 12 19 2 9 6 5 5 20 18 12",
"output": "1391"
},
{
"input": "39 2412\n1 1 1 1 1 1 26 1 1 1 99 1 1 1 1 1 1 1 1 1 1 88 7 1 1 1 1 76 1 1 1 93 40 1 13 1 68 1 32",
"output": "368"
},
{
"input": "39 2617\n47 1 1 1 63 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 70 1 99 63 1 1 1 1 1 1 1 1 64 1 1",
"output": "435"
},
{
"input": "39 3681\n83 77 1 94 85 47 1 98 29 16 1 1 1 71 96 85 31 97 96 93 40 50 98 1 60 51 1 96 100 72 1 1 1 89 1 93 1 92 100",
"output": "326"
},
{
"input": "45 894\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 99 3 1 1",
"output": "139"
},
{
"input": "45 4534\n1 99 65 99 4 46 54 80 51 30 96 1 28 30 44 70 78 1 1 100 1 62 1 1 1 85 1 1 1 61 1 46 75 1 61 77 97 26 67 1 1 63 81 85 86",
"output": "514"
},
{
"input": "72 3538\n52 1 8 1 1 1 7 1 1 1 1 48 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 40 1 1 38 1 1 1 1 1 1 1 1 1 1 1 35 1 93 79 1 1 1 1 1 1 1 1 1 51 1 1 1 1 1 1 1 1 1 1 1 1 96 1",
"output": "586"
},
{
"input": "81 2200\n1 59 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 93 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 50 1 1 1 1 1 1 1 1 1 1 1",
"output": "384"
},
{
"input": "81 2577\n85 91 1 1 2 1 1 100 1 80 1 1 17 86 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 37 1 66 24 1 1 96 49 1 66 1 44 1 1 1 1 98 1 1 1 1 35 1 37 3 35 1 1 87 64 1 24 1 58 1 1 42 83 5 1 1 1 1 1 95 1 94 1 50 1 1",
"output": "174"
},
{
"input": "81 4131\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 16 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "807"
},
{
"input": "81 6315\n1 1 67 100 1 99 36 1 92 5 1 96 42 12 1 57 91 1 1 66 41 30 74 95 1 37 1 39 91 69 1 52 77 47 65 1 1 93 96 74 90 35 85 76 71 92 92 1 1 67 92 74 1 1 86 76 35 1 56 16 27 57 37 95 1 40 20 100 51 1 80 60 45 79 95 1 46 1 25 100 96",
"output": "490"
},
{
"input": "96 1688\n1 1 1 1 1 1 1 1 1 1 1 1 1 2 1 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 25 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 71 1 1 1 30 1 1 1",
"output": "284"
},
{
"input": "96 8889\n1 1 18 1 1 1 1 1 1 1 1 1 99 1 1 1 1 88 1 45 1 1 1 1 1 1 1 1 1 1 1 1 1 1 96 1 1 1 1 21 1 1 1 1 1 1 1 73 1 1 1 1 1 10 1 1 1 1 1 1 1 46 43 1 1 1 1 1 98 1 1 1 1 1 1 6 1 1 1 1 1 74 1 25 1 55 1 1 1 13 1 1 54 1 1 1",
"output": "1589"
},
{
"input": "10 100\n1 1 1 1 1 1 1 1 1 1",
"output": "18"
},
{
"input": "100 10000\n54 46 72 94 79 83 91 54 73 3 24 55 54 31 28 20 19 6 25 19 47 23 1 70 15 87 51 39 54 77 55 5 60 3 15 99 56 88 22 78 79 21 38 27 28 86 7 88 12 59 55 70 25 1 70 49 1 45 69 72 50 17 4 56 8 100 90 34 35 20 61 76 88 79 4 74 65 68 75 26 40 72 59 94 10 67 96 85 29 90 47 24 44 1 66 93 55 36 1 99",
"output": "1017"
},
{
"input": "100 6000\n41 31 23 17 24 78 26 96 93 48 46 2 49 33 35 9 73 100 34 48 83 36 33 69 43 24 3 74 8 81 27 33 94 38 77 9 76 90 62 90 21 67 22 22 12 2 17 27 61 18 72 85 59 65 71 38 90 75 74 66 60 47 58 50 90 95 75 10 5 100 97 29 83 88 65 26 93 90 22 98 36 55 70 38 50 92 88 72 99 96 25 14 74 16 25 92 67 94 77 96",
"output": "-1"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 6\n1",
"output": "1"
},
{
"input": "1 5\n1",
"output": "0"
},
{
"input": "1 3\n4",
"output": "-1"
},
{
"input": "3 24\n2 1 2",
"output": "-1"
}
] | 1,631,779,560
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 26
| 77
| 6,963,200
|
nd = input().split()
n = int(nd[0])
d = int(nd[1])
arr = [int(x) for x in input().split()]
min = sum(arr) + 10*(n-1)
if d < min:
print(-1)
else:
numberofjoke = (n-1)*2
add = (d-min)//5
numberofjoke += add
print(numberofjoke)
|
Title: Devu, the Singer and Churu, the Joker
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a renowned classical singer. He is invited to many big functions/festivals. Recently he was invited to "All World Classical Singing Festival". Other than Devu, comedian Churu was also invited.
Devu has provided organizers a list of the songs and required time for singing them. He will sing *n* songs, *i**th* song will take *t**i* minutes exactly.
The Comedian, Churu will crack jokes. All his jokes are of 5 minutes exactly.
People have mainly come to listen Devu. But you know that he needs rest of 10 minutes after each song. On the other hand, Churu being a very active person, doesn't need any rest.
You as one of the organizers should make an optimal sсhedule for the event. For some reasons you must follow the conditions:
- The duration of the event must be no more than *d* minutes; - Devu must complete all his songs; - With satisfying the two previous conditions the number of jokes cracked by Churu should be as many as possible.
If it is not possible to find a way to conduct all the songs of the Devu, output -1. Otherwise find out maximum number of jokes that Churu can crack in the grand event.
Input Specification:
The first line contains two space separated integers *n*, *d* (1<=≤<=*n*<=≤<=100; 1<=≤<=*d*<=≤<=10000). The second line contains *n* space-separated integers: *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=100).
Output Specification:
If there is no way to conduct all the songs of Devu, output -1. Otherwise output the maximum number of jokes that Churu can crack in the grand event.
Demo Input:
['3 30\n2 2 1\n', '3 20\n2 1 1\n']
Demo Output:
['5\n', '-1\n']
Note:
Consider the first example. The duration of the event is 30 minutes. There could be maximum 5 jokes in the following way:
- First Churu cracks a joke in 5 minutes. - Then Devu performs the first song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now Devu performs second song for 2 minutes. - Then Churu cracks 2 jokes in 10 minutes. - Now finally Devu will perform his last song in 1 minutes.
Total time spent is 5 + 2 + 10 + 2 + 10 + 1 = 30 minutes.
Consider the second example. There is no way of organizing Devu's all songs. Hence the answer is -1.
|
```python
nd = input().split()
n = int(nd[0])
d = int(nd[1])
arr = [int(x) for x in input().split()]
min = sum(arr) + 10*(n-1)
if d < min:
print(-1)
else:
numberofjoke = (n-1)*2
add = (d-min)//5
numberofjoke += add
print(numberofjoke)
```
| 3
|
|
707
|
A
|
Brain's Photos
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead.
As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such).
Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour!
As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white.
Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors:
- 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black)
The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
|
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively.
Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
|
Print the "#Black&White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
|
[
"2 2\nC M\nY Y\n",
"3 2\nW W\nW W\nB B\n",
"1 1\nW\n"
] |
[
"#Color",
"#Black&White",
"#Black&White"
] |
none
| 500
|
[
{
"input": "2 2\nC M\nY Y",
"output": "#Color"
},
{
"input": "3 2\nW W\nW W\nB B",
"output": "#Black&White"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "2 3\nW W W\nB G Y",
"output": "#Color"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "5 5\nW G B Y M\nG B Y M C\nB Y M C W\nY M C W G\nM C W G B",
"output": "#Color"
},
{
"input": "1 6\nC M Y W G B",
"output": "#Color"
},
{
"input": "1 3\nW G B",
"output": "#Black&White"
},
{
"input": "1 1\nW",
"output": "#Black&White"
},
{
"input": "5 5\nW G B W G\nG B W G B\nB W G B W\nW G B W G\nG B W G B",
"output": "#Black&White"
},
{
"input": "2 3\nW W W\nB G C",
"output": "#Color"
},
{
"input": "2 3\nW W W\nB G M",
"output": "#Color"
},
{
"input": "3 3\nC B W\nB Y M\nB B W",
"output": "#Color"
},
{
"input": "1 3\nW C W",
"output": "#Color"
},
{
"input": "3 3\nB W B\nB C W\nB W W",
"output": "#Color"
},
{
"input": "1 2\nW Y",
"output": "#Color"
},
{
"input": "1 1\nG",
"output": "#Black&White"
},
{
"input": "1 3\nB G W",
"output": "#Black&White"
},
{
"input": "2 2\nW W\nB C",
"output": "#Color"
},
{
"input": "1 1\nM",
"output": "#Color"
},
{
"input": "1 2\nW C",
"output": "#Color"
},
{
"input": "2 3\nW W M\nW W M",
"output": "#Color"
},
{
"input": "3 2\nW W\nW W\nB C",
"output": "#Color"
},
{
"input": "2 3\nW W C\nW W W",
"output": "#Color"
},
{
"input": "1 3\nG G G",
"output": "#Black&White"
},
{
"input": "1 1\nC",
"output": "#Color"
},
{
"input": "1 2\nC W",
"output": "#Color"
},
{
"input": "1 3\nW W C",
"output": "#Color"
},
{
"input": "2 2\nW B\nB G",
"output": "#Black&White"
},
{
"input": "2 2\nB B\nY Y",
"output": "#Color"
},
{
"input": "2 2\nG G\nC C",
"output": "#Color"
},
{
"input": "1 2\nB C",
"output": "#Color"
},
{
"input": "1 4\nG G G C",
"output": "#Color"
},
{
"input": "1 1\nB",
"output": "#Black&White"
},
{
"input": "2 1\nY\nB",
"output": "#Color"
}
] | 1,681,922,128
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <iostream>
#include <string>
#include<algorithm>
#include <iomanip>
using namespace std;
int main()
{
int row,col;
cin>>row>>col;
int flag = 0;
for(int i = 1;i<=row;i++){
for(int j = 1;j<=col;j++){
char a;
cin>>a;
if(a=='C'||a=='M'||a=='Y'){
flag=1;
break;
}
}
if(flag==1){
break;
}
}
if(flag==1){
cout<<"#Color"<<endl;
}
else{
cout<<"#Black&White"<<endl;
}
return 0;
}
|
Title: Brain's Photos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Small, but very brave, mouse Brain was not accepted to summer school of young villains. He was upset and decided to postpone his plans of taking over the world, but to become a photographer instead.
As you may know, the coolest photos are on the film (because you can specify the hashtag #film for such).
Brain took a lot of colourful pictures on colored and black-and-white film. Then he developed and translated it into a digital form. But now, color and black-and-white photos are in one folder, and to sort them, one needs to spend more than one hour!
As soon as Brain is a photographer not programmer now, he asks you to help him determine for a single photo whether it is colored or black-and-white.
Photo can be represented as a matrix sized *n*<=×<=*m*, and each element of the matrix stores a symbol indicating corresponding pixel color. There are only 6 colors:
- 'C' (cyan)- 'M' (magenta)- 'Y' (yellow)- 'W' (white)- 'G' (grey)- 'B' (black)
The photo is considered black-and-white if it has only white, black and grey pixels in it. If there are any of cyan, magenta or yellow pixels in the photo then it is considered colored.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of photo pixel matrix rows and columns respectively.
Then *n* lines describing matrix rows follow. Each of them contains *m* space-separated characters describing colors of pixels in a row. Each character in the line is one of the 'C', 'M', 'Y', 'W', 'G' or 'B'.
Output Specification:
Print the "#Black&White" (without quotes), if the photo is black-and-white and "#Color" (without quotes), if it is colored, in the only line.
Demo Input:
['2 2\nC M\nY Y\n', '3 2\nW W\nW W\nB B\n', '1 1\nW\n']
Demo Output:
['#Color', '#Black&White', '#Black&White']
Note:
none
|
```python
#include <iostream>
#include <string>
#include<algorithm>
#include <iomanip>
using namespace std;
int main()
{
int row,col;
cin>>row>>col;
int flag = 0;
for(int i = 1;i<=row;i++){
for(int j = 1;j<=col;j++){
char a;
cin>>a;
if(a=='C'||a=='M'||a=='Y'){
flag=1;
break;
}
}
if(flag==1){
break;
}
}
if(flag==1){
cout<<"#Color"<<endl;
}
else{
cout<<"#Black&White"<<endl;
}
return 0;
}
```
| -1
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,664,228,575
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 46
| 0
|
s=input()
h="hello"
b=0
x=0
for i in range(len(s)):
if (s[i]==h[b]):
b+=1
x+=1
if (x == 5 ):
break
if (x == 5):
print("YES")
else:print("NO")
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
s=input()
h="hello"
b=0
x=0
for i in range(len(s)):
if (s[i]==h[b]):
b+=1
x+=1
if (x == 5 ):
break
if (x == 5):
print("YES")
else:print("NO")
```
| 3.977
|
1,004
|
A
|
Sonya and Hotels
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
|
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
|
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
|
[
"4 3\n-3 2 9 16\n",
"5 2\n4 8 11 18 19\n"
] |
[
"6\n",
"5\n"
] |
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
| 500
|
[
{
"input": "4 3\n-3 2 9 16",
"output": "6"
},
{
"input": "5 2\n4 8 11 18 19",
"output": "5"
},
{
"input": "10 10\n-67 -59 -49 -38 -8 20 41 59 74 83",
"output": "8"
},
{
"input": "10 10\n0 20 48 58 81 95 111 137 147 159",
"output": "9"
},
{
"input": "100 1\n0 1 2 3 4 5 7 8 10 11 12 13 14 15 16 17 19 21 22 23 24 25 26 27 28 30 32 33 36 39 40 41 42 46 48 53 54 55 59 60 61 63 65 68 70 71 74 75 76 79 80 81 82 84 88 89 90 91 93 94 96 97 98 100 101 102 105 106 107 108 109 110 111 113 114 115 116 117 118 120 121 122 125 126 128 131 132 133 134 135 137 138 139 140 143 144 146 147 148 149",
"output": "47"
},
{
"input": "1 1000000000\n-1000000000",
"output": "2"
},
{
"input": "2 1000000000\n-1000000000 1000000000",
"output": "3"
},
{
"input": "100 2\n1 3 5 6 8 9 12 13 14 17 18 21 22 23 24 25 26 27 29 30 34 35 36 39 41 44 46 48 52 53 55 56 57 59 61 63 64 66 68 69 70 71 72 73 75 76 77 79 80 81 82 87 88 91 92 93 94 95 96 97 99 100 102 103 104 106 109 110 111 112 113 114 115 117 118 119 120 122 124 125 127 128 129 130 131 132 133 134 136 137 139 140 141 142 143 145 146 148 149 150",
"output": "6"
},
{
"input": "100 3\n0 1 3 6 7 8 9 10 13 14 16 17 18 20 21 22 24 26 27 30 33 34 35 36 37 39 42 43 44 45 46 48 53 54 55 56 57 58 61 63 64 65 67 69 70 72 73 76 77 78 79 81 82 83 85 86 87 88 90 92 93 95 96 97 98 99 100 101 104 105 108 109 110 113 114 115 116 118 120 121 123 124 125 128 130 131 132 133 134 135 136 137 139 140 141 142 146 147 148 150",
"output": "2"
},
{
"input": "1 1000000000\n1000000000",
"output": "2"
},
{
"input": "10 2\n-93 -62 -53 -42 -38 11 57 58 87 94",
"output": "17"
},
{
"input": "2 500000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "100 10\n-489 -476 -445 -432 -430 -421 -420 -418 -412 -411 -404 -383 -356 -300 -295 -293 -287 -276 -265 -263 -258 -251 -249 -246 -220 -219 -205 -186 -166 -157 -143 -137 -136 -130 -103 -86 -80 -69 -67 -55 -43 -41 -40 -26 -19 -9 16 29 41 42 54 76 84 97 98 99 101 115 134 151 157 167 169 185 197 204 208 226 227 232 234 249 259 266 281 282 293 298 300 306 308 313 319 328 331 340 341 344 356 362 366 380 390 399 409 411 419 444 455 498",
"output": "23"
},
{
"input": "1 1000000000\n999999999",
"output": "2"
},
{
"input": "1 1\n-5",
"output": "2"
},
{
"input": "2 1\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 2\n1",
"output": "2"
},
{
"input": "4 5\n0 20 40 60",
"output": "8"
},
{
"input": "1 1\n-10",
"output": "2"
},
{
"input": "1 1\n-1000000000",
"output": "2"
},
{
"input": "1 1000000000\n0",
"output": "2"
},
{
"input": "1 2\n-10",
"output": "2"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "1 5\n-100",
"output": "2"
},
{
"input": "2 1000000000\n999999999 1000000000",
"output": "2"
},
{
"input": "2 2\n0 5",
"output": "4"
},
{
"input": "1 2\n-5",
"output": "2"
},
{
"input": "1 1\n1",
"output": "2"
},
{
"input": "1 5\n-20",
"output": "2"
},
{
"input": "2 100000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 1000000000\n147483641",
"output": "2"
},
{
"input": "3 3\n1 8 9",
"output": "4"
},
{
"input": "2 1\n1 1000000000",
"output": "4"
},
{
"input": "1 2\n-4",
"output": "2"
},
{
"input": "2 1\n-1000000000 -1",
"output": "4"
}
] | 1,532,767,837
| 637
|
Python 3
|
OK
|
TESTS
| 45
| 124
| 0
|
# cook your dish here
n,d=input().split()
n=int(n)
d=int(d)
a=list(map(int,input().split()))
b=[]
b.append(a[0]-d)
for i in range(len(a)):
if i!=0:
if a[i]-2*d>=a[i-1]:
b.append(a[i]-d)
if i!=len(a)-1:
if a[i]+2*d<=a[i+1]:
b.append(a[i]+d)
b.append(a[len(a)-1]+d)
ans=1
#print(b)
for i in range(1,len(b)):
if b[i]!=b[i-1]:
ans+=1
print(ans)
|
Title: Sonya and Hotels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
Input Specification:
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
Output Specification:
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
Demo Input:
['4 3\n-3 2 9 16\n', '5 2\n4 8 11 18 19\n']
Demo Output:
['6\n', '5\n']
Note:
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$.
|
```python
# cook your dish here
n,d=input().split()
n=int(n)
d=int(d)
a=list(map(int,input().split()))
b=[]
b.append(a[0]-d)
for i in range(len(a)):
if i!=0:
if a[i]-2*d>=a[i-1]:
b.append(a[i]-d)
if i!=len(a)-1:
if a[i]+2*d<=a[i+1]:
b.append(a[i]+d)
b.append(a[len(a)-1]+d)
ans=1
#print(b)
for i in range(1,len(b)):
if b[i]!=b[i-1]:
ans+=1
print(ans)
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,582,025,274
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 81
| 248
| 307,200
|
a,b,c=0,0,0
for q in range(int(input())):
x,y,z=map(int,input().split())
a+=x
b+=y
c+=z
if a==0 and b==0 and c==0:print("YES")
else:print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
a,b,c=0,0,0
for q in range(int(input())):
x,y,z=map(int,input().split())
a+=x
b+=y
c+=z
if a==0 and b==0 and c==0:print("YES")
else:print("NO")
```
| 3.937428
|
405
|
A
|
Gravity Flip
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation",
"sortings"
] | null | null |
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity.
There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange.
Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
|
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
|
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
|
[
"4\n3 2 1 2\n",
"3\n2 3 8\n"
] |
[
"1 2 2 3 \n",
"2 3 8 \n"
] |
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column.
In the second example case the gravity switch does not change the heights of the columns.
| 500
|
[
{
"input": "4\n3 2 1 2",
"output": "1 2 2 3 "
},
{
"input": "3\n2 3 8",
"output": "2 3 8 "
},
{
"input": "5\n2 1 2 1 2",
"output": "1 1 2 2 2 "
},
{
"input": "1\n1",
"output": "1 "
},
{
"input": "2\n4 3",
"output": "3 4 "
},
{
"input": "6\n100 40 60 20 1 80",
"output": "1 20 40 60 80 100 "
},
{
"input": "10\n10 8 6 7 5 3 4 2 9 1",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "100\n82 51 81 14 37 17 78 92 64 15 8 86 89 8 87 77 66 10 15 12 100 25 92 47 21 78 20 63 13 49 41 36 41 79 16 87 87 69 3 76 80 60 100 49 70 59 72 8 38 71 45 97 71 14 76 54 81 4 59 46 39 29 92 3 49 22 53 99 59 52 74 31 92 43 42 23 44 9 82 47 7 40 12 9 3 55 37 85 46 22 84 52 98 41 21 77 63 17 62 91",
"output": "3 3 3 4 7 8 8 8 9 9 10 12 12 13 14 14 15 15 16 17 17 20 21 21 22 22 23 25 29 31 36 37 37 38 39 40 41 41 41 42 43 44 45 46 46 47 47 49 49 49 51 52 52 53 54 55 59 59 59 60 62 63 63 64 66 69 70 71 71 72 74 76 76 77 77 78 78 79 80 81 81 82 82 84 85 86 87 87 87 89 91 92 92 92 92 97 98 99 100 100 "
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 "
},
{
"input": "10\n1 9 7 6 2 4 7 8 1 3",
"output": "1 1 2 3 4 6 7 7 8 9 "
},
{
"input": "20\n53 32 64 20 41 97 50 20 66 68 22 60 74 61 97 54 80 30 72 59",
"output": "20 20 22 30 32 41 50 53 54 59 60 61 64 66 68 72 74 80 97 97 "
},
{
"input": "30\n7 17 4 18 16 12 14 10 1 13 2 16 13 17 8 16 13 14 9 17 17 5 13 5 1 7 6 20 18 12",
"output": "1 1 2 4 5 5 6 7 7 8 9 10 12 12 13 13 13 13 14 14 16 16 16 17 17 17 17 18 18 20 "
},
{
"input": "40\n22 58 68 58 48 53 52 1 16 78 75 17 63 15 36 32 78 75 49 14 42 46 66 54 49 82 40 43 46 55 12 73 5 45 61 60 1 11 31 84",
"output": "1 1 5 11 12 14 15 16 17 22 31 32 36 40 42 43 45 46 46 48 49 49 52 53 54 55 58 58 60 61 63 66 68 73 75 75 78 78 82 84 "
},
{
"input": "70\n1 3 3 1 3 3 1 1 1 3 3 2 3 3 1 1 1 2 3 1 3 2 3 3 3 2 2 3 1 3 3 2 1 1 2 1 2 1 2 2 1 1 1 3 3 2 3 2 3 2 3 3 2 2 2 3 2 3 3 3 1 1 3 3 1 1 1 1 3 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "90\n17 75 51 30 100 5 50 95 51 73 66 5 7 76 43 49 23 55 3 24 95 79 10 11 44 93 17 99 53 66 82 66 63 76 19 4 51 71 75 43 27 5 24 19 48 7 91 15 55 21 7 6 27 10 2 91 64 58 18 21 16 71 90 88 21 20 6 6 95 85 11 7 40 65 52 49 92 98 46 88 17 48 85 96 77 46 100 34 67 52",
"output": "2 3 4 5 5 5 6 6 6 7 7 7 7 10 10 11 11 15 16 17 17 17 18 19 19 20 21 21 21 23 24 24 27 27 30 34 40 43 43 44 46 46 48 48 49 49 50 51 51 51 52 52 53 55 55 58 63 64 65 66 66 66 67 71 71 73 75 75 76 76 77 79 82 85 85 88 88 90 91 91 92 93 95 95 95 96 98 99 100 100 "
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 "
},
{
"input": "100\n1 1 1 1 2 1 1 1 1 1 2 2 1 1 2 1 2 1 1 1 2 1 1 2 1 2 1 1 2 2 2 1 1 2 1 1 1 2 2 2 1 1 1 2 1 2 2 1 2 1 1 2 2 1 2 1 2 1 2 2 1 1 1 2 1 1 2 1 2 1 2 2 2 1 2 1 2 2 2 1 2 2 1 1 1 1 2 2 2 2 2 2 2 1 1 1 2 1 2 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "100\n2 1 1 1 3 2 3 3 2 3 3 1 3 3 1 3 3 1 1 1 2 3 1 2 3 1 2 3 3 1 3 1 1 2 3 2 3 3 2 3 3 1 2 2 1 2 3 2 3 2 2 1 1 3 1 3 2 1 3 1 3 1 3 1 1 3 3 3 2 3 2 2 2 2 1 3 3 3 1 2 1 2 3 2 1 3 1 3 2 1 3 1 2 1 2 3 1 3 2 3",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 "
},
{
"input": "100\n7 4 5 5 10 10 5 8 5 7 4 5 4 6 8 8 2 6 3 3 10 7 10 8 6 2 7 3 9 7 7 2 4 5 2 4 9 5 10 1 10 5 10 4 1 3 4 2 6 9 9 9 10 6 2 5 6 1 8 10 4 10 3 4 10 5 5 4 10 4 5 3 7 10 2 7 3 6 9 6 1 6 5 5 4 6 6 4 4 1 5 1 6 6 6 8 8 6 2 6",
"output": "1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 10 10 10 10 "
},
{
"input": "100\n12 10 5 11 13 12 14 13 7 15 15 12 13 19 12 18 14 10 10 3 1 10 16 11 19 8 10 15 5 10 12 16 11 13 11 15 14 12 16 8 11 8 15 2 18 2 14 13 15 20 8 8 4 12 14 7 10 3 9 1 7 19 6 7 2 14 8 20 7 17 18 20 3 18 18 9 6 10 4 1 4 19 9 13 3 3 12 11 11 20 8 2 13 6 7 12 1 4 17 3",
"output": "1 1 1 1 2 2 2 2 3 3 3 3 3 3 4 4 4 4 5 5 6 6 6 7 7 7 7 7 7 8 8 8 8 8 8 8 9 9 9 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12 12 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17 18 18 18 18 18 19 19 19 19 20 20 20 20 "
},
{
"input": "100\n5 13 1 40 30 10 23 32 33 12 6 4 15 29 31 17 23 5 36 31 32 38 24 11 34 39 19 21 6 19 31 35 1 15 6 29 22 15 17 15 1 17 2 34 20 8 27 2 29 26 13 9 22 27 27 3 20 40 4 40 33 29 36 30 35 16 19 28 26 11 36 24 29 5 40 10 38 34 33 23 34 39 31 7 10 31 22 6 36 24 14 31 34 23 2 4 26 16 2 32",
"output": "1 1 1 2 2 2 2 3 4 4 4 5 5 5 6 6 6 6 7 8 9 10 10 10 11 11 12 13 13 14 15 15 15 15 16 16 17 17 17 19 19 19 20 20 21 22 22 22 23 23 23 23 24 24 24 26 26 26 27 27 27 28 29 29 29 29 29 30 30 31 31 31 31 31 31 32 32 32 33 33 33 34 34 34 34 34 35 35 36 36 36 36 38 38 39 39 40 40 40 40 "
},
{
"input": "100\n72 44 34 74 9 60 26 37 55 77 74 69 28 66 54 55 8 36 57 31 31 48 32 66 40 70 77 43 64 28 37 10 21 58 51 32 60 28 51 52 28 35 7 33 1 68 38 70 57 71 8 20 42 57 59 4 58 10 17 47 22 48 16 3 76 67 32 37 64 47 33 41 75 69 2 76 39 9 27 75 20 21 52 25 71 21 11 29 38 10 3 1 45 55 63 36 27 7 59 41",
"output": "1 1 2 3 3 4 7 7 8 8 9 9 10 10 10 11 16 17 20 20 21 21 21 22 25 26 27 27 28 28 28 28 29 31 31 32 32 32 33 33 34 35 36 36 37 37 37 38 38 39 40 41 41 42 43 44 45 47 47 48 48 51 51 52 52 54 55 55 55 57 57 57 58 58 59 59 60 60 63 64 64 66 66 67 68 69 69 70 70 71 71 72 74 74 75 75 76 76 77 77 "
},
{
"input": "100\n75 18 61 10 56 53 42 57 79 80 31 2 50 45 54 99 84 52 71 21 86 3 19 98 14 37 40 62 63 68 5 10 87 8 81 85 52 52 57 94 2 7 56 96 19 76 1 13 81 6 80 47 22 59 99 32 9 5 36 88 98 91 70 70 12 93 12 22 85 1 97 48 94 16 84 84 51 34 62 7 68 51 30 2 37 82 4 7 27 1 80 9 61 16 59 55 12 96 94 82",
"output": "1 1 1 2 2 2 3 4 5 5 6 7 7 7 8 9 9 10 10 12 12 12 13 14 16 16 18 19 19 21 22 22 27 30 31 32 34 36 37 37 40 42 45 47 48 50 51 51 52 52 52 53 54 55 56 56 57 57 59 59 61 61 62 62 63 68 68 70 70 71 75 76 79 80 80 80 81 81 82 82 84 84 84 85 85 86 87 88 91 93 94 94 94 96 96 97 98 98 99 99 "
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100\n50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50",
"output": "50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 50 "
},
{
"input": "49\n1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97",
"output": "1 3 5 7 9 11 13 15 17 19 21 23 25 27 29 31 33 35 37 39 41 43 45 47 49 51 53 55 57 59 61 63 65 67 69 71 73 75 77 79 81 83 85 87 89 91 93 95 97 "
},
{
"input": "30\n1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88",
"output": "1 4 7 10 13 16 19 22 25 28 31 34 37 40 43 46 49 52 55 58 61 64 67 70 73 76 79 82 85 88 "
},
{
"input": "100\n100 51 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 51 100 "
},
{
"input": "10\n100 90 80 70 60 50 40 30 20 10",
"output": "10 20 30 40 50 60 70 80 90 100 "
},
{
"input": "1\n10",
"output": "10 "
}
] | 1,699,090,364
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
nint (input())
x= list(map (int, input ().split()))[:n]
x.sort()
print(x, sep-" "))
|
Title: Gravity Flip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Chris is bored during his physics lessons (too easy), so he has built a toy box to keep himself occupied. The box is special, since it has the ability to change gravity.
There are *n* columns of toy cubes in the box arranged in a line. The *i*-th column contains *a**i* cubes. At first, the gravity in the box is pulling the cubes downwards. When Chris switches the gravity, it begins to pull all the cubes to the right side of the box. The figure shows the initial and final configurations of the cubes in the box: the cubes that have changed their position are highlighted with orange.
Given the initial configuration of the toy cubes in the box, find the amounts of cubes in each of the *n* columns after the gravity switch!
Input Specification:
The first line of input contains an integer *n* (1<=≤<=*n*<=≤<=100), the number of the columns in the box. The next line contains *n* space-separated integer numbers. The *i*-th number *a**i* (1<=≤<=*a**i*<=≤<=100) denotes the number of cubes in the *i*-th column.
Output Specification:
Output *n* integer numbers separated by spaces, where the *i*-th number is the amount of cubes in the *i*-th column after the gravity switch.
Demo Input:
['4\n3 2 1 2\n', '3\n2 3 8\n']
Demo Output:
['1 2 2 3 \n', '2 3 8 \n']
Note:
The first example case is shown on the figure. The top cube of the first column falls to the top of the last column; the top cube of the second column falls to the top of the third column; the middle cube of the first column falls to the top of the second column.
In the second example case the gravity switch does not change the heights of the columns.
|
```python
nint (input())
x= list(map (int, input ().split()))[:n]
x.sort()
print(x, sep-" "))
```
| -1
|
|
390
|
C
|
Inna and Candy Boxes
|
PROGRAMMING
| 0
|
[
"data structures"
] | null | null |
Inna loves sweets very much. She has *n* closed present boxes lines up in a row in front of her. Each of these boxes contains either a candy (Dima's work) or nothing (Sereja's work). Let's assume that the boxes are numbered from 1 to *n*, from left to right.
As the boxes are closed, Inna doesn't know which boxes contain candies and which boxes contain nothing. Inna chose number *k* and asked *w* questions to Dima to find that out. Each question is characterised by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*; *r*<=-<=*l*<=+<=1 is divisible by *k*), the *i*-th question is: "Dima, is that true that among the boxes with numbers from *l**i* to *r**i*, inclusive, the candies lie only in boxes with numbers *l**i*<=+<=*k*<=-<=1, *l**i*<=+<=2*k*<=-<=1, *l**i*<=+<=3*k*<=-<=1, ..., *r**i*?"
Dima hates to say "no" to Inna. That's why he wonders, what number of actions he will have to make for each question to make the answer to the question positive. In one action, Dima can either secretly take the candy from any box or put a candy to any box (Dima has infinitely many candies). Help Dima count the number of actions for each Inna's question.
Please note that Dima doesn't change the array during Inna's questions. That's why when you calculate the number of operations for the current question, please assume that the sequence of boxes didn't change.
|
The first line of the input contains three integers *n*, *k* and *w* (1<=≤<=*k*<=≤<=*min*(*n*,<=10),<=1<=≤<=*n*,<=*w*<=≤<=105). The second line contains *n* characters. If the *i*-th box contains a candy, the *i*-th character of the line equals 1, otherwise it equals 0.
Each of the following *w* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th question. It is guaranteed that *r**i*<=-<=*l**i*<=+<=1 is divisible by *k*.
|
For each question, print a single number on a single line — the minimum number of operations Dima needs to make the answer to the question positive.
|
[
"10 3 3\n1010100011\n1 3\n1 6\n4 9\n"
] |
[
"1\n3\n2\n"
] |
For the first question, you need to take a candy from the first box to make the answer positive. So the answer is 1.
For the second question, you need to take a candy from the first box, take a candy from the fifth box and put a candy to the sixth box. The answer is 3.
For the third question, you need to take a candy from the fifth box and put it to the sixth box. The answer is 2.
| 1,500
|
[] | 1,569,736,087
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7
| 1,000
| 1,331,200
|
inps=[int(a) for a in input().split()][:3]
n,k,w=inps[0],inps[1],inps[2]
ls=[0]
char=str(input())
for i in range(w):
ls.append([int(a) for a in input().split()])
for i in range(1,len(ls)):
ls1=ls[i]
ctr=0
for j in range(ls1[0]-1,ls1[1]):
if (j+1)%k==0 and char[j]!='1':
ctr+=1
if (j+1)%k!=0 and char[j]=='1':
ctr+=1
print(ctr)
|
Title: Inna and Candy Boxes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Inna loves sweets very much. She has *n* closed present boxes lines up in a row in front of her. Each of these boxes contains either a candy (Dima's work) or nothing (Sereja's work). Let's assume that the boxes are numbered from 1 to *n*, from left to right.
As the boxes are closed, Inna doesn't know which boxes contain candies and which boxes contain nothing. Inna chose number *k* and asked *w* questions to Dima to find that out. Each question is characterised by two integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*; *r*<=-<=*l*<=+<=1 is divisible by *k*), the *i*-th question is: "Dima, is that true that among the boxes with numbers from *l**i* to *r**i*, inclusive, the candies lie only in boxes with numbers *l**i*<=+<=*k*<=-<=1, *l**i*<=+<=2*k*<=-<=1, *l**i*<=+<=3*k*<=-<=1, ..., *r**i*?"
Dima hates to say "no" to Inna. That's why he wonders, what number of actions he will have to make for each question to make the answer to the question positive. In one action, Dima can either secretly take the candy from any box or put a candy to any box (Dima has infinitely many candies). Help Dima count the number of actions for each Inna's question.
Please note that Dima doesn't change the array during Inna's questions. That's why when you calculate the number of operations for the current question, please assume that the sequence of boxes didn't change.
Input Specification:
The first line of the input contains three integers *n*, *k* and *w* (1<=≤<=*k*<=≤<=*min*(*n*,<=10),<=1<=≤<=*n*,<=*w*<=≤<=105). The second line contains *n* characters. If the *i*-th box contains a candy, the *i*-th character of the line equals 1, otherwise it equals 0.
Each of the following *w* lines contains two integers *l**i* and *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*n*) — the description of the *i*-th question. It is guaranteed that *r**i*<=-<=*l**i*<=+<=1 is divisible by *k*.
Output Specification:
For each question, print a single number on a single line — the minimum number of operations Dima needs to make the answer to the question positive.
Demo Input:
['10 3 3\n1010100011\n1 3\n1 6\n4 9\n']
Demo Output:
['1\n3\n2\n']
Note:
For the first question, you need to take a candy from the first box to make the answer positive. So the answer is 1.
For the second question, you need to take a candy from the first box, take a candy from the fifth box and put a candy to the sixth box. The answer is 3.
For the third question, you need to take a candy from the fifth box and put it to the sixth box. The answer is 2.
|
```python
inps=[int(a) for a in input().split()][:3]
n,k,w=inps[0],inps[1],inps[2]
ls=[0]
char=str(input())
for i in range(w):
ls.append([int(a) for a in input().split()])
for i in range(1,len(ls)):
ls1=ls[i]
ctr=0
for j in range(ls1[0]-1,ls1[1]):
if (j+1)%k==0 and char[j]!='1':
ctr+=1
if (j+1)%k!=0 and char[j]=='1':
ctr+=1
print(ctr)
```
| 0
|
|
445
|
A
|
DZY Loves Chessboard
|
PROGRAMMING
| 1,200
|
[
"dfs and similar",
"implementation"
] | null | null |
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
|
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
|
[
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] |
[
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] |
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
| 500
|
[
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,598,937,701
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 108
| 307,200
|
N,M=map(int,input().split())
X=[]
for i in range(N):
x=input()
X.append(x)
ans=[]
res=[]
for i in range(N):
if i%2==0:
flag=1
else:
flag=0
for j in range(M):
if X[i][j]=='.':
if flag==1:
res.append('W')
else:
res.append('B')
else:
res.append('-')
if flag==0:
flag=1
else:
flag=0
ans.append(res)
res=[]
for i in ans:
print(*i)
|
Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
|
```python
N,M=map(int,input().split())
X=[]
for i in range(N):
x=input()
X.append(x)
ans=[]
res=[]
for i in range(N):
if i%2==0:
flag=1
else:
flag=0
for j in range(M):
if X[i][j]=='.':
if flag==1:
res.append('W')
else:
res.append('B')
else:
res.append('-')
if flag==0:
flag=1
else:
flag=0
ans.append(res)
res=[]
for i in ans:
print(*i)
```
| 0
|
|
805
|
B
|
3-palindrome
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000
|
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,640,420,115
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 93
| 1,740,800
|
n=int(input())
s='aabb'*n
print(s[:n])
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
n=int(input())
s='aabb'*n
print(s[:n])
```
| 3
|
|
143
|
B
|
Help Kingdom of Far Far Away 2
|
PROGRAMMING
| 1,200
|
[
"implementation",
"strings"
] | null | null |
For some time the program of rounding numbers that had been developed by the Codeforces participants during one of the previous rounds, helped the citizens of Far Far Away to convert numbers into a more easily readable format. However, as time went by, the economy of the Far Far Away developed and the scale of operations grew. So the King ordered to found the Bank of Far Far Away and very soon even the rounding didn't help to quickly determine even the order of the numbers involved in operations. Besides, rounding a number to an integer wasn't very convenient as a bank needed to operate with all numbers with accuracy of up to 0.01, and not up to an integer.
The King issued yet another order: to introduce financial format to represent numbers denoting amounts of money. The formal rules of storing a number in the financial format are as follows:
- A number contains the integer part and the fractional part. The two parts are separated with a character "." (decimal point). - To make digits in the integer part of a number easier to read, they are split into groups of three digits, starting from the least significant ones. The groups are separated with the character "," (comma). For example, if the integer part of a number equals 12345678, then it will be stored in the financial format as 12,345,678 - In the financial format a number's fractional part should contain exactly two digits. So, if the initial number (the number that is converted into the financial format) contains less than two digits in the fractional part (or contains no digits at all), it is complemented with zeros until its length equals 2. If the fractional part contains more than two digits, the extra digits are simply discarded (they are not rounded: see sample tests). - When a number is stored in the financial format, the minus sign is not written. Instead, if the initial number had the minus sign, the result is written in round brackets. - Please keep in mind that the bank of Far Far Away operates using an exotic foreign currency — snakes ($), that's why right before the number in the financial format we should put the sign "$". If the number should be written in the brackets, then the snake sign should also be inside the brackets.
For example, by the above given rules number 2012 will be stored in the financial format as "$2,012.00" and number -12345678.9 will be stored as "($12,345,678.90)".
The merchants of Far Far Away visited you again and expressed much hope that you supply them with the program that can convert arbitrary numbers to the financial format. Can you help them?
|
The input contains a number that needs to be converted into financial format. The number's notation length does not exceed 100 characters, including (possible) signs "-" (minus) and "." (decimal point). The number's notation is correct, that is:
- The number's notation only contains characters from the set {"0" – "9", "-", "."}. - The decimal point (if it is present) is unique and is preceded and followed by a non-zero quantity on decimal digits - A number cannot start with digit 0, except for a case when its whole integer part equals zero (in this case the integer parts is guaranteed to be a single zero: "0"). - The minus sign (if it is present) is unique and stands in the very beginning of the number's notation - If a number is identically equal to 0 (that is, if it is written as, for example, "0" or "0.000"), than it is not preceded by the minus sign. - The input data contains no spaces. - The number's notation contains at least one decimal digit.
|
Print the number given in the input in the financial format by the rules described in the problem statement.
|
[
"2012\n",
"0.000\n",
"-0.00987654321\n",
"-12345678.9\n"
] |
[
"$2,012.00",
"$0.00",
"($0.00)",
"($12,345,678.90)"
] |
Pay attention to the second and third sample tests. They show that the sign of a number in the financial format (and consequently, the presence or absence of brackets) is determined solely by the sign of the initial number. It does not depend on the sign of the number you got after translating the number to the financial format.
| 1,000
|
[
{
"input": "2012",
"output": "$2,012.00"
},
{
"input": "0.000",
"output": "$0.00"
},
{
"input": "-0.00987654321",
"output": "($0.00)"
},
{
"input": "-12345678.9",
"output": "($12,345,678.90)"
},
{
"input": "0.99999999999999999999",
"output": "$0.99"
},
{
"input": "-999999999.9999999999",
"output": "($999,999,999.99)"
},
{
"input": "4.30",
"output": "$4.30"
},
{
"input": "-3136",
"output": "($3,136.00)"
},
{
"input": "47.849",
"output": "$47.84"
},
{
"input": "0",
"output": "$0.00"
},
{
"input": "-1",
"output": "($1.00)"
},
{
"input": "5.3944",
"output": "$5.39"
},
{
"input": "-359789",
"output": "($359,789.00)"
},
{
"input": "-999999",
"output": "($999,999.00)"
},
{
"input": "50117.75",
"output": "$50,117.75"
},
{
"input": "-2717.859",
"output": "($2,717.85)"
},
{
"input": "446900763",
"output": "$446,900,763.00"
},
{
"input": "-92.04295",
"output": "($92.04)"
},
{
"input": "1000000000",
"output": "$1,000,000,000.00"
},
{
"input": "-4097961.5",
"output": "($4,097,961.50)"
},
{
"input": "-83348637.91",
"output": "($83,348,637.91)"
},
{
"input": "741968647.01",
"output": "$741,968,647.01"
},
{
"input": "8590210736.2",
"output": "$8,590,210,736.20"
},
{
"input": "-337322633.10",
"output": "($337,322,633.10)"
},
{
"input": "-9389724657.706",
"output": "($9,389,724,657.70)"
},
{
"input": "-337807291537795",
"output": "($337,807,291,537,795.00)"
},
{
"input": "-1000000000000000",
"output": "($1,000,000,000,000,000.00)"
},
{
"input": "1000000000000000000",
"output": "$1,000,000,000,000,000,000.00"
},
{
"input": "64852365412711705.4",
"output": "$64,852,365,412,711,705.40"
},
{
"input": "-14193044875680849641.0",
"output": "($14,193,044,875,680,849,641.00)"
},
{
"input": "-9087207850675188568.44",
"output": "($9,087,207,850,675,188,568.44)"
},
{
"input": "-999999999999999999999999",
"output": "($999,999,999,999,999,999,999,999.00)"
},
{
"input": "95464737206897655595566.87",
"output": "$95,464,737,206,897,655,595,566.87"
},
{
"input": "20486447414118.916680683147",
"output": "$20,486,447,414,118.91"
},
{
"input": "-195688513344900667321324887161",
"output": "($195,688,513,344,900,667,321,324,887,161.00)"
},
{
"input": "-467854663215578391335472070.522",
"output": "($467,854,663,215,578,391,335,472,070.52)"
},
{
"input": "-9946519009668593136622791780335166786329.966",
"output": "($9,946,519,009,668,593,136,622,791,780,335,166,786,329.96)"
},
{
"input": "-39243277445578948100023610303161362.21742597518",
"output": "($39,243,277,445,578,948,100,023,610,303,161,362.21)"
},
{
"input": "-999999999999999999999999999999999999999999999999",
"output": "($999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999.00)"
},
{
"input": "-1120451303595201012675538441508298946450567446.2",
"output": "($1,120,451,303,595,201,012,675,538,441,508,298,946,450,567,446.20)"
},
{
"input": "-667416497168265603150839581334265910632362977345",
"output": "($667,416,497,168,265,603,150,839,581,334,265,910,632,362,977,345.00)"
},
{
"input": "-5896634442314348289084387258044853039981310264175",
"output": "($5,896,634,442,314,348,289,084,387,258,044,853,039,981,310,264,175.00)"
},
{
"input": "645862132625704263852654466816044056725411814537812.8",
"output": "$645,862,132,625,704,263,852,654,466,816,044,056,725,411,814,537,812.80"
},
{
"input": "20302284249108248013254029284738266163210459601273.434",
"output": "$20,302,284,249,108,248,013,254,029,284,738,266,163,210,459,601,273.43"
},
{
"input": "-335585948391999514421347454725980775593710083728376.235",
"output": "($335,585,948,391,999,514,421,347,454,725,980,775,593,710,083,728,376.23)"
},
{
"input": "8069847002922332743537016743686274581681180388843128677728",
"output": "$8,069,847,002,922,332,743,537,016,743,686,274,581,681,180,388,843,128,677,728.00"
},
{
"input": "-1000000000000000000000000000000000000000000000000000000000",
"output": "($1,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000.00)"
},
{
"input": "-9426928046528138766008648709237083850143959438752.99576081",
"output": "($9,426,928,046,528,138,766,008,648,709,237,083,850,143,959,438,752.99)"
},
{
"input": "7847469828916401598273845389736502122924911071339770925.278",
"output": "$7,847,469,828,916,401,598,273,845,389,736,502,122,924,911,071,339,770,925.27"
},
{
"input": "6612569248276041501392573128342394934.339553169499895358359857",
"output": "$6,612,569,248,276,041,501,392,573,128,342,394,934.33"
},
{
"input": "-78441689173753107674674252785635804718172761356557153691194.62",
"output": "($78,441,689,173,753,107,674,674,252,785,635,804,718,172,761,356,557,153,691,194.62)"
},
{
"input": "-26420799441242046176813573049397911227605022448441841.79118151",
"output": "($26,420,799,441,242,046,176,813,573,049,397,911,227,605,022,448,441,841.79)"
},
{
"input": "1000000000000000000000000000000000000000000000000000000000000000",
"output": "$1,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000.00"
},
{
"input": "-440176280332493569864975483046616452663067706833582934195268991",
"output": "($440,176,280,332,493,569,864,975,483,046,616,452,663,067,706,833,582,934,195,268,991.00)"
},
{
"input": "45068840874548394281603568826222223550419177965629777875090709223",
"output": "$45,068,840,874,548,394,281,603,568,826,222,223,550,419,177,965,629,777,875,090,709,223.00"
},
{
"input": "694057847299426980275391007402296515925594191675094941155586653678",
"output": "$694,057,847,299,426,980,275,391,007,402,296,515,925,594,191,675,094,941,155,586,653,678.00"
},
{
"input": "-957970608566623530128907769981235852029999876705137521027635757.983",
"output": "($957,970,608,566,623,530,128,907,769,981,235,852,029,999,876,705,137,521,027,635,757.98)"
},
{
"input": "-999999999999999999999999999999999999999999999999999999999999999999999999",
"output": "($999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999.00)"
},
{
"input": "-31237099946005389291000524337411657445033712616943108265479899943319776753",
"output": "($31,237,099,946,005,389,291,000,524,337,411,657,445,033,712,616,943,108,265,479,899,943,319,776,753.00)"
},
{
"input": "129213728483376896322034359636257815625283844448760915618261775174758145181.4",
"output": "$129,213,728,483,376,896,322,034,359,636,257,815,625,283,844,448,760,915,618,261,775,174,758,145,181.40"
},
{
"input": "42436883801797921017002508329344377731225676938894736357215113693696441876.74",
"output": "$42,436,883,801,797,921,017,002,508,329,344,377,731,225,676,938,894,736,357,215,113,693,696,441,876.74"
},
{
"input": "-412877493852539226130846658848085431323015500045621801.186290244529330637919069841",
"output": "($412,877,493,852,539,226,130,846,658,848,085,431,323,015,500,045,621,801.18)"
},
{
"input": "-574893403412500337461904214575009975847859132644288548328404148513112616299380872537.0",
"output": "($574,893,403,412,500,337,461,904,214,575,009,975,847,859,132,644,288,548,328,404,148,513,112,616,299,380,872,537.00)"
},
{
"input": "5533548446182725508036320768515297517684533355269108005785922527441026147032711096226.86",
"output": "$5,533,548,446,182,725,508,036,320,768,515,297,517,684,533,355,269,108,005,785,922,527,441,026,147,032,711,096,226.86"
},
{
"input": "-388992510982960799226860251113727086.40151448032429506491841194161722800219231951466273",
"output": "($388,992,510,982,960,799,226,860,251,113,727,086.40)"
},
{
"input": "-1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "($1,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000.00)"
},
{
"input": "-5918197227517459215086434488069169077399840893456742554562785165395986123057440893145094.766",
"output": "($5,918,197,227,517,459,215,086,434,488,069,169,077,399,840,893,456,742,554,562,785,165,395,986,123,057,440,893,145,094.76)"
},
{
"input": "6478564388953796549388720554132845507729109849868298957775985580270942075809511904097608680.2",
"output": "$6,478,564,388,953,796,549,388,720,554,132,845,507,729,109,849,868,298,957,775,985,580,270,942,075,809,511,904,097,608,680.20"
},
{
"input": "-6608605342368730994322893748034318039589361759849416904183711274389684094202666590051634245034124",
"output": "($6,608,605,342,368,730,994,322,893,748,034,318,039,589,361,759,849,416,904,183,711,274,389,684,094,202,666,590,051,634,245,034,124.00)"
},
{
"input": "96923618713643049034901616201059739110612607940570171931128836281408507843006798661841666493086.61",
"output": "$96,923,618,713,643,049,034,901,616,201,059,739,110,612,607,940,570,171,931,128,836,281,408,507,843,006,798,661,841,666,493,086.61"
},
{
"input": "-517546026888198271507158769760866655703910236108772942356185789408213495267854245076096353651979.8",
"output": "($517,546,026,888,198,271,507,158,769,760,866,655,703,910,236,108,772,942,356,185,789,408,213,495,267,854,245,076,096,353,651,979.80)"
},
{
"input": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999",
"output": "$9,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999.00"
},
{
"input": "-999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999",
"output": "($999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999,999.00)"
},
{
"input": "-815237564329654906966710129877160169011275185850610159260306644937525319275278007248384181194947.28",
"output": "($815,237,564,329,654,906,966,710,129,877,160,169,011,275,185,850,610,159,260,306,644,937,525,319,275,278,007,248,384,181,194,947.28)"
},
{
"input": "1609444903206838610558177906619581955157825950595724445549624361368550861446891019160980179056621441",
"output": "$1,609,444,903,206,838,610,558,177,906,619,581,955,157,825,950,595,724,445,549,624,361,368,550,861,446,891,019,160,980,179,056,621,441.00"
},
{
"input": "-35537407322675227867508928547215513270324784786663652634725025510744878530809034357724640012675.565",
"output": "($35,537,407,322,675,227,867,508,928,547,215,513,270,324,784,786,663,652,634,725,025,510,744,878,530,809,034,357,724,640,012,675.56)"
},
{
"input": "-1925998064032579186735317615389112142155311850475835576562145669565982488184005786899836428580775.0",
"output": "($1,925,998,064,032,579,186,735,317,615,389,112,142,155,311,850,475,835,576,562,145,669,565,982,488,184,005,786,899,836,428,580,775.00)"
},
{
"input": "-151277365498121078756232179307020255183838049147325207397719920725067524511168597227357027671262974",
"output": "($151,277,365,498,121,078,756,232,179,307,020,255,183,838,049,147,325,207,397,719,920,725,067,524,511,168,597,227,357,027,671,262,974.00)"
},
{
"input": "-94567610568172711079874848395505663034158058453541356405687412896214661991252184312404537628616.980",
"output": "($94,567,610,568,172,711,079,874,848,395,505,663,034,158,058,453,541,356,405,687,412,896,214,661,991,252,184,312,404,537,628,616.98)"
},
{
"input": "5552014028917125934664874618128879449020166415278427980290619767043458191075263555779358121.76899621",
"output": "$5,552,014,028,917,125,934,664,874,618,128,879,449,020,166,415,278,427,980,290,619,767,043,458,191,075,263,555,779,358,121.76"
},
{
"input": "2550200914539395142436748539585175024948346405871252468705518320188561734542212313710731590053887.14",
"output": "$2,550,200,914,539,395,142,436,748,539,585,175,024,948,346,405,871,252,468,705,518,320,188,561,734,542,212,313,710,731,590,053,887.14"
},
{
"input": "169111053680418810505586659748530205695340474893994150913915241455549545588046718243429009096899.721",
"output": "$169,111,053,680,418,810,505,586,659,748,530,205,695,340,474,893,994,150,913,915,241,455,549,545,588,046,718,243,429,009,096,899.72"
},
{
"input": "-8302081723264231257651127829066891591565707300162037272443063737275775635240827533455570038921755.8",
"output": "($8,302,081,723,264,231,257,651,127,829,066,891,591,565,707,300,162,037,272,443,063,737,275,775,635,240,827,533,455,570,038,921,755.80)"
},
{
"input": "-292248618257633380305171416004365379539463749949334547640267733391588708052597413502241817581110.84",
"output": "($292,248,618,257,633,380,305,171,416,004,365,379,539,463,749,949,334,547,640,267,733,391,588,708,052,597,413,502,241,817,581,110.84)"
},
{
"input": "8087188987747615879025660857396187057475326352182448073610839965896456538717186544887072170343027939",
"output": "$8,087,188,987,747,615,879,025,660,857,396,187,057,475,326,352,182,448,073,610,839,965,896,456,538,717,186,544,887,072,170,343,027,939.00"
},
{
"input": "762519263820550209316662292240308083373767394981759714.037848496865152996658249820591156785758954539",
"output": "$762,519,263,820,550,209,316,662,292,240,308,083,373,767,394,981,759,714.03"
},
{
"input": "-81065814290895584254457019744497055053248932892817738718849487679519028041818854925725440291395.398",
"output": "($81,065,814,290,895,584,254,457,019,744,497,055,053,248,932,892,817,738,718,849,487,679,519,028,041,818,854,925,725,440,291,395.39)"
},
{
"input": "-32941712101597478543219921523193493949615291911649974076128866311848385268672190709108207764990.550",
"output": "($32,941,712,101,597,478,543,219,921,523,193,493,949,615,291,911,649,974,076,128,866,311,848,385,268,672,190,709,108,207,764,990.55)"
},
{
"input": "2089113443991831781611590658416581830404242017.85102926202385542583311855337073083712400492547136479",
"output": "$2,089,113,443,991,831,781,611,590,658,416,581,830,404,242,017.85"
},
{
"input": "-93446155923266881322196606839694485100712773936897171033382798807975023881552872455711005123932.747",
"output": "($93,446,155,923,266,881,322,196,606,839,694,485,100,712,773,936,897,171,033,382,798,807,975,023,881,552,872,455,711,005,123,932.74)"
},
{
"input": "960516596871944593730108478032758053821336372808735358607440437077013969634756697387966042842288.508",
"output": "$960,516,596,871,944,593,730,108,478,032,758,053,821,336,372,808,735,358,607,440,437,077,013,969,634,756,697,387,966,042,842,288.50"
},
{
"input": "7542946645993289345871768107036410651745989844030221776852993379463784193885567707317993804499615689",
"output": "$7,542,946,645,993,289,345,871,768,107,036,410,651,745,989,844,030,221,776,852,993,379,463,784,193,885,567,707,317,993,804,499,615,689.00"
},
{
"input": "-62833497045916718064314002220718776776624697240820362462669558147156815011509869423334004968891.075",
"output": "($62,833,497,045,916,718,064,314,002,220,718,776,776,624,697,240,820,362,462,669,558,147,156,815,011,509,869,423,334,004,968,891.07)"
},
{
"input": "369983878656471317107141313973936685655559201630341263457253892446495.822347697919107135036916507458",
"output": "$369,983,878,656,471,317,107,141,313,973,936,685,655,559,201,630,341,263,457,253,892,446,495.82"
},
{
"input": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "$1,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000,000.00"
},
{
"input": "-7200722479435658295856375503813639375609209638447823589904775057990210002452424572601761458228411.3",
"output": "($7,200,722,479,435,658,295,856,375,503,813,639,375,609,209,638,447,823,589,904,775,057,990,210,002,452,424,572,601,761,458,228,411.30)"
},
{
"input": "1.62929379626674077244098830537592273171157251593607257308766051098303017164327540412154291842807913",
"output": "$1.62"
},
{
"input": "9094697811219913240397316094992038813655777565859532452.35345453828434088557646454113264025096745262",
"output": "$9,094,697,811,219,913,240,397,316,094,992,038,813,655,777,565,859,532,452.35"
},
{
"input": "-241995182456075514870952227695034085165209475359259147742565065759917424411707290789641890279251.11",
"output": "($241,995,182,456,075,514,870,952,227,695,034,085,165,209,475,359,259,147,742,565,065,759,917,424,411,707,290,789,641,890,279,251.11)"
},
{
"input": "2567340036354357844391998756110821468858185018763415770617907336824217629234299240638243305079104961",
"output": "$2,567,340,036,354,357,844,391,998,756,110,821,468,858,185,018,763,415,770,617,907,336,824,217,629,234,299,240,638,243,305,079,104,961.00"
}
] | 1,568,731,854
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 100
| 310
| 0
|
# import sys
# sys.stdin = open('_input.txt')
inp = list(input().split('.'))
ans = ['', '', '.', '00', '']
ans[0] = '$' if inp[0][0]!='-' else '($'
ans[4] = '' if inp[0][0]!='-' else ')'
ans[1] = inp[0] if inp[0][0]!='-' else inp[0][1:]
ans[1] = ''.join(reversed(ans[1]))
for i, j in zip(range(3, len(ans[1]), 3), range(len(ans[1]))):
ans[1] = ans[1][:i+j] + ',' + ans[1][i+j:]
ans[1] = ''.join(reversed(ans[1]))
if len(inp)==2:
if len(inp[1]) < 2: ans[3] = inp[1][0] + '0'
else: ans[3] = inp[1][:2]
print(''.join(ans))
|
Title: Help Kingdom of Far Far Away 2
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For some time the program of rounding numbers that had been developed by the Codeforces participants during one of the previous rounds, helped the citizens of Far Far Away to convert numbers into a more easily readable format. However, as time went by, the economy of the Far Far Away developed and the scale of operations grew. So the King ordered to found the Bank of Far Far Away and very soon even the rounding didn't help to quickly determine even the order of the numbers involved in operations. Besides, rounding a number to an integer wasn't very convenient as a bank needed to operate with all numbers with accuracy of up to 0.01, and not up to an integer.
The King issued yet another order: to introduce financial format to represent numbers denoting amounts of money. The formal rules of storing a number in the financial format are as follows:
- A number contains the integer part and the fractional part. The two parts are separated with a character "." (decimal point). - To make digits in the integer part of a number easier to read, they are split into groups of three digits, starting from the least significant ones. The groups are separated with the character "," (comma). For example, if the integer part of a number equals 12345678, then it will be stored in the financial format as 12,345,678 - In the financial format a number's fractional part should contain exactly two digits. So, if the initial number (the number that is converted into the financial format) contains less than two digits in the fractional part (or contains no digits at all), it is complemented with zeros until its length equals 2. If the fractional part contains more than two digits, the extra digits are simply discarded (they are not rounded: see sample tests). - When a number is stored in the financial format, the minus sign is not written. Instead, if the initial number had the minus sign, the result is written in round brackets. - Please keep in mind that the bank of Far Far Away operates using an exotic foreign currency — snakes ($), that's why right before the number in the financial format we should put the sign "$". If the number should be written in the brackets, then the snake sign should also be inside the brackets.
For example, by the above given rules number 2012 will be stored in the financial format as "$2,012.00" and number -12345678.9 will be stored as "($12,345,678.90)".
The merchants of Far Far Away visited you again and expressed much hope that you supply them with the program that can convert arbitrary numbers to the financial format. Can you help them?
Input Specification:
The input contains a number that needs to be converted into financial format. The number's notation length does not exceed 100 characters, including (possible) signs "-" (minus) and "." (decimal point). The number's notation is correct, that is:
- The number's notation only contains characters from the set {"0" – "9", "-", "."}. - The decimal point (if it is present) is unique and is preceded and followed by a non-zero quantity on decimal digits - A number cannot start with digit 0, except for a case when its whole integer part equals zero (in this case the integer parts is guaranteed to be a single zero: "0"). - The minus sign (if it is present) is unique and stands in the very beginning of the number's notation - If a number is identically equal to 0 (that is, if it is written as, for example, "0" or "0.000"), than it is not preceded by the minus sign. - The input data contains no spaces. - The number's notation contains at least one decimal digit.
Output Specification:
Print the number given in the input in the financial format by the rules described in the problem statement.
Demo Input:
['2012\n', '0.000\n', '-0.00987654321\n', '-12345678.9\n']
Demo Output:
['$2,012.00', '$0.00', '($0.00)', '($12,345,678.90)']
Note:
Pay attention to the second and third sample tests. They show that the sign of a number in the financial format (and consequently, the presence or absence of brackets) is determined solely by the sign of the initial number. It does not depend on the sign of the number you got after translating the number to the financial format.
|
```python
# import sys
# sys.stdin = open('_input.txt')
inp = list(input().split('.'))
ans = ['', '', '.', '00', '']
ans[0] = '$' if inp[0][0]!='-' else '($'
ans[4] = '' if inp[0][0]!='-' else ')'
ans[1] = inp[0] if inp[0][0]!='-' else inp[0][1:]
ans[1] = ''.join(reversed(ans[1]))
for i, j in zip(range(3, len(ans[1]), 3), range(len(ans[1]))):
ans[1] = ans[1][:i+j] + ',' + ans[1][i+j:]
ans[1] = ''.join(reversed(ans[1]))
if len(inp)==2:
if len(inp[1]) < 2: ans[3] = inp[1][0] + '0'
else: ans[3] = inp[1][:2]
print(''.join(ans))
```
| 3
|
|
556
|
A
|
Case of the Zeros and Ones
|
PROGRAMMING
| 900
|
[
"greedy"
] | null | null |
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones.
Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result.
Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
|
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has.
The second line contains the string of length *n* consisting only from zeros and ones.
|
Output the minimum length of the string that may remain after applying the described operations several times.
|
[
"4\n1100\n",
"5\n01010\n",
"8\n11101111\n"
] |
[
"0\n",
"1\n",
"6\n"
] |
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 250
|
[
{
"input": "4\n1100",
"output": "0"
},
{
"input": "5\n01010",
"output": "1"
},
{
"input": "8\n11101111",
"output": "6"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n00",
"output": "2"
},
{
"input": "2\n01",
"output": "0"
},
{
"input": "2\n10",
"output": "0"
},
{
"input": "2\n11",
"output": "2"
},
{
"input": "3\n001",
"output": "1"
},
{
"input": "6\n110110",
"output": "2"
},
{
"input": "7\n0000011",
"output": "3"
},
{
"input": "6\n110010",
"output": "0"
},
{
"input": "6\n110100",
"output": "0"
},
{
"input": "3\n100",
"output": "1"
},
{
"input": "6\n010111",
"output": "2"
},
{
"input": "8\n01011100",
"output": "0"
},
{
"input": "6\n001011",
"output": "0"
},
{
"input": "7\n1110000",
"output": "1"
},
{
"input": "9\n011111101",
"output": "5"
}
] | 1,611,431,047
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 11
| 1,000
| 1,740,800
|
n = int(input())
s = input()
l = [str(i) for i in s]
r=s
while (1):
flag=1
if "01" in r or "10" in r:
l.remove("1")
l.remove("0")
r=""
for i in l:
r = r + i
flag=0
if flag==1:
break
print(len(l))
|
Title: Case of the Zeros and Ones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones.
Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result.
Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
Input Specification:
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has.
The second line contains the string of length *n* consisting only from zeros and ones.
Output Specification:
Output the minimum length of the string that may remain after applying the described operations several times.
Demo Input:
['4\n1100\n', '5\n01010\n', '8\n11101111\n']
Demo Output:
['0\n', '1\n', '6\n']
Note:
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
n = int(input())
s = input()
l = [str(i) for i in s]
r=s
while (1):
flag=1
if "01" in r or "10" in r:
l.remove("1")
l.remove("0")
r=""
for i in l:
r = r + i
flag=0
if flag==1:
break
print(len(l))
```
| 0
|
|
246
|
B
|
Increase and Decrease
|
PROGRAMMING
| 1,300
|
[
"greedy",
"math"
] | null | null |
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
|
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
|
[
"2\n2 1\n",
"3\n1 4 1\n"
] |
[
"1\n",
"3\n"
] |
none
| 1,000
|
[
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 4 1",
"output": "3"
},
{
"input": "4\n2 -7 -2 -6",
"output": "3"
},
{
"input": "4\n2 0 -2 -1",
"output": "3"
},
{
"input": "6\n-1 1 0 0 -1 -1",
"output": "5"
},
{
"input": "5\n0 0 0 0 0",
"output": "5"
},
{
"input": "100\n968 793 -628 -416 942 -308 977 168 728 -879 952 781 -425 -475 -480 738 -740 142 -319 -116 -701 -183 41 324 -918 -391 -176 781 763 888 475 -617 134 -802 -133 -211 855 -869 -236 503 550 387 137 -221 -957 -800 -56 -673 440 -791 -217 -959 -892 886 -593 427 890 223 -425 -342 -262 693 -137 924 860 156 -110 444 -12 703 421 -638 725 -551 597 -206 -80 393 -441 -759 617 424 -506 209 579 -685 -861 507 312 597 -81 -491 424 222 -892 629 512 743 -452 -504",
"output": "99"
}
] | 1,588,505,045
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 30
| 218
| 2,867,200
|
n=int(input())
print([n,n-1][sum(map(int,input().split()))%n!=0])
|
Title: Increase and Decrease
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
Output Specification:
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
Demo Input:
['2\n2 1\n', '3\n1 4 1\n']
Demo Output:
['1\n', '3\n']
Note:
none
|
```python
n=int(input())
print([n,n-1][sum(map(int,input().split()))%n!=0])
```
| 3
|
|
922
|
C
|
Cave Painting
|
PROGRAMMING
| 1,600
|
[
"brute force",
"number theory"
] | null | null |
Imp is watching a documentary about cave painting.
Some numbers, carved in chaotic order, immediately attracted his attention. Imp rapidly proposed a guess that they are the remainders of division of a number *n* by all integers *i* from 1 to *k*. Unfortunately, there are too many integers to analyze for Imp.
Imp wants you to check whether all these remainders are distinct. Formally, he wants to check, if all , 1<=≤<=*i*<=≤<=*k*, are distinct, i. e. there is no such pair (*i*,<=*j*) that:
- 1<=≤<=*i*<=<<=*j*<=≤<=*k*, - , where is the remainder of division *x* by *y*.
|
The only line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=1018).
|
Print "Yes", if all the remainders are distinct, and "No" otherwise.
You can print each letter in arbitrary case (lower or upper).
|
[
"4 4\n",
"5 3\n"
] |
[
"No\n",
"Yes\n"
] |
In the first sample remainders modulo 1 and 4 coincide.
| 1,250
|
[
{
"input": "4 4",
"output": "No"
},
{
"input": "5 3",
"output": "Yes"
},
{
"input": "1 1",
"output": "Yes"
},
{
"input": "744 18",
"output": "No"
},
{
"input": "47879 10",
"output": "Yes"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "No"
},
{
"input": "657180569218773599 42",
"output": "Yes"
},
{
"input": "442762254977842799 30",
"output": "Yes"
},
{
"input": "474158606260730555 1",
"output": "Yes"
},
{
"input": "807873101233533988 39",
"output": "No"
},
{
"input": "423 7",
"output": "No"
},
{
"input": "264306177888923090 5",
"output": "No"
},
{
"input": "998857801526481788 87",
"output": "No"
},
{
"input": "999684044704565212 28",
"output": "No"
},
{
"input": "319575605003866172 71",
"output": "No"
},
{
"input": "755804560577415016 17",
"output": "No"
},
{
"input": "72712630136142067 356370939",
"output": "No"
},
{
"input": "807264258068668062 33080422",
"output": "No"
},
{
"input": "808090496951784190 311661970",
"output": "No"
},
{
"input": "808916740129867614 180178111",
"output": "No"
},
{
"input": "1 2",
"output": "Yes"
},
{
"input": "2 1",
"output": "Yes"
},
{
"input": "57334064998850639 19",
"output": "Yes"
},
{
"input": "144353716412182199 11",
"output": "Yes"
},
{
"input": "411002215096001759 11",
"output": "Yes"
},
{
"input": "347116374613371527 3",
"output": "Yes"
},
{
"input": "518264351335130399 37",
"output": "Yes"
},
{
"input": "192435891235905239 11",
"output": "Yes"
},
{
"input": "491802505049361659 7",
"output": "Yes"
},
{
"input": "310113769227703889 3",
"output": "Yes"
},
{
"input": "876240758958364799 41",
"output": "Yes"
},
{
"input": "173284263472319999 33",
"output": "Yes"
},
{
"input": "334366426725130799 29",
"output": "Yes"
},
{
"input": "415543470272330399 26",
"output": "Yes"
},
{
"input": "631689521541558479 22",
"output": "Yes"
},
{
"input": "581859366558790319 14",
"output": "Yes"
},
{
"input": "224113913709159599 10",
"output": "Yes"
},
{
"input": "740368848764104559 21",
"output": "Yes"
},
{
"input": "895803074828822159 17",
"output": "Yes"
},
{
"input": "400349974997012039 13",
"output": "Yes"
},
{
"input": "205439024252247599 5",
"output": "Yes"
},
{
"input": "197688463911338399 39",
"output": "Yes"
},
{
"input": "283175367224349599 39",
"output": "Yes"
},
{
"input": "893208176423362799 31",
"output": "Yes"
},
{
"input": "440681012669897999 27",
"output": "Yes"
},
{
"input": "947403664618451039 19",
"output": "Yes"
},
{
"input": "232435556779345919 19",
"output": "Yes"
},
{
"input": "504428493840551279 23",
"output": "Yes"
},
{
"input": "30019549241681999 20",
"output": "Yes"
},
{
"input": "648000813924303839 16",
"output": "Yes"
},
{
"input": "763169499725761451 488954176053755860",
"output": "No"
},
{
"input": "199398459594277592 452260924647536414",
"output": "No"
},
{
"input": "635627415167826436 192195636386541160",
"output": "No"
},
{
"input": "71856370741375281 155502380685354417",
"output": "No"
},
{
"input": "731457367464667229 118809129279134971",
"output": "No"
},
{
"input": "167686318743248777 858743836723172421",
"output": "No"
},
{
"input": "603915274316797622 822050585316952974",
"output": "No"
},
{
"input": "647896534275160623 65689274138731296",
"output": "No"
},
{
"input": "648722777453244047 501918229712280140",
"output": "No"
},
{
"input": "649549020631327471 41923378183538525",
"output": "No"
},
{
"input": "650375259514443599 597748177714153637",
"output": "No"
},
{
"input": "651201506987494319 33977137582669778",
"output": "No"
},
{
"input": "652027745870610447 470206093156218622",
"output": "No"
},
{
"input": "652853989048693871 906435048729767466",
"output": "No"
},
{
"input": "653680227931809999 342664004303316311",
"output": "No"
},
{
"input": "654506475404860719 375019787446735639",
"output": "No"
},
{
"input": "655332714287976847 438493956600157103",
"output": "No"
},
{
"input": "166512305365727033 900267947832156186",
"output": "No"
},
{
"input": "167338548543810457 336496907700672326",
"output": "No"
},
{
"input": "168164787426926585 772725863274221171",
"output": "No"
},
{
"input": "523 3",
"output": "No"
},
{
"input": "39211 6",
"output": "No"
},
{
"input": "22151 9",
"output": "No"
},
{
"input": "1 3",
"output": "No"
},
{
"input": "47 5",
"output": "No"
},
{
"input": "999999998999999999 1000000000",
"output": "No"
},
{
"input": "11 6",
"output": "No"
},
{
"input": "7 4",
"output": "No"
},
{
"input": "1 10",
"output": "No"
},
{
"input": "9 5",
"output": "No"
},
{
"input": "2519 20",
"output": "No"
},
{
"input": "700001 3",
"output": "Yes"
},
{
"input": "13 7",
"output": "No"
},
{
"input": "999999 10000",
"output": "No"
},
{
"input": "1 4",
"output": "No"
},
{
"input": "232792559 30",
"output": "No"
},
{
"input": "1 5",
"output": "No"
},
{
"input": "5 4",
"output": "No"
},
{
"input": "5 8",
"output": "No"
},
{
"input": "55 4",
"output": "No"
}
] | 1,593,458,776
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 70
| 109
| 6,758,400
|
h,m=list(map(int,input().split()))
if h<=m and h!=1 and m!=1:
print('NO')
else:
r='YES'
for i in range(1,m):
if h%i!=(i-1):
r='NO'
break
print(r)
|
Title: Cave Painting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imp is watching a documentary about cave painting.
Some numbers, carved in chaotic order, immediately attracted his attention. Imp rapidly proposed a guess that they are the remainders of division of a number *n* by all integers *i* from 1 to *k*. Unfortunately, there are too many integers to analyze for Imp.
Imp wants you to check whether all these remainders are distinct. Formally, he wants to check, if all , 1<=≤<=*i*<=≤<=*k*, are distinct, i. e. there is no such pair (*i*,<=*j*) that:
- 1<=≤<=*i*<=<<=*j*<=≤<=*k*, - , where is the remainder of division *x* by *y*.
Input Specification:
The only line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=1018).
Output Specification:
Print "Yes", if all the remainders are distinct, and "No" otherwise.
You can print each letter in arbitrary case (lower or upper).
Demo Input:
['4 4\n', '5 3\n']
Demo Output:
['No\n', 'Yes\n']
Note:
In the first sample remainders modulo 1 and 4 coincide.
|
```python
h,m=list(map(int,input().split()))
if h<=m and h!=1 and m!=1:
print('NO')
else:
r='YES'
for i in range(1,m):
if h%i!=(i-1):
r='NO'
break
print(r)
```
| 0
|
|
200
|
B
|
Drinks
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
|
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
|
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
|
[
"3\n50 50 100\n",
"4\n0 25 50 75\n"
] |
[
"66.666666666667\n",
"37.500000000000\n"
] |
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
| 500
|
[
{
"input": "3\n50 50 100",
"output": "66.666666666667"
},
{
"input": "4\n0 25 50 75",
"output": "37.500000000000"
},
{
"input": "3\n0 1 8",
"output": "3.000000000000"
},
{
"input": "5\n96 89 93 95 70",
"output": "88.600000000000"
},
{
"input": "7\n62 41 78 4 38 39 75",
"output": "48.142857142857"
},
{
"input": "13\n2 22 7 0 1 17 3 17 11 2 21 26 22",
"output": "11.615384615385"
},
{
"input": "21\n5 4 11 7 0 5 45 21 0 14 51 6 0 16 10 19 8 9 7 12 18",
"output": "12.761904761905"
},
{
"input": "26\n95 70 93 74 94 70 91 70 39 79 80 57 87 75 37 93 48 67 51 90 85 26 23 64 66 84",
"output": "69.538461538462"
},
{
"input": "29\n84 99 72 96 83 92 95 98 97 93 76 84 99 93 81 76 93 99 99 100 95 100 96 95 97 100 71 98 94",
"output": "91.551724137931"
},
{
"input": "33\n100 99 100 100 99 99 99 100 100 100 99 99 99 100 100 100 100 99 100 99 100 100 97 100 100 100 100 100 100 100 98 98 100",
"output": "99.515151515152"
},
{
"input": "34\n14 9 10 5 4 26 18 23 0 1 0 20 18 15 2 2 3 5 14 1 9 4 2 15 7 1 7 19 10 0 0 11 0 2",
"output": "8.147058823529"
},
{
"input": "38\n99 98 100 100 99 92 99 99 98 84 88 94 86 99 93 100 98 99 65 98 85 84 64 97 96 89 79 96 91 84 99 93 72 96 94 97 96 93",
"output": "91.921052631579"
},
{
"input": "52\n100 94 99 98 99 99 99 95 97 97 98 100 100 98 97 100 98 90 100 99 97 94 90 98 100 100 90 99 100 95 98 95 94 85 97 94 96 94 99 99 99 98 100 100 94 99 99 100 98 87 100 100",
"output": "97.019230769231"
},
{
"input": "58\n10 70 12 89 1 82 100 53 40 100 21 69 92 91 67 66 99 77 25 48 8 63 93 39 46 79 82 14 44 42 1 79 0 69 56 73 67 17 59 4 65 80 20 60 77 52 3 61 16 76 33 18 46 100 28 59 9 6",
"output": "50.965517241379"
},
{
"input": "85\n7 8 1 16 0 15 1 7 0 11 15 6 2 12 2 8 9 8 2 0 3 7 15 7 1 8 5 7 2 26 0 3 11 1 8 10 31 0 7 6 1 8 1 0 9 14 4 8 7 16 9 1 0 16 10 9 6 1 1 4 2 7 4 5 4 1 20 6 16 16 1 1 10 17 8 12 14 19 3 8 1 7 10 23 10",
"output": "7.505882352941"
},
{
"input": "74\n5 3 0 7 13 10 12 10 18 5 0 18 2 13 7 17 2 7 5 2 40 19 0 2 2 3 0 45 4 20 0 4 2 8 1 19 3 9 17 1 15 0 16 1 9 4 0 9 32 2 6 18 11 18 1 15 16 12 7 19 5 3 9 28 26 8 3 10 33 29 4 13 28 6",
"output": "10.418918918919"
},
{
"input": "98\n42 9 21 11 9 11 22 12 52 20 10 6 56 9 26 27 1 29 29 14 38 17 41 21 7 45 15 5 29 4 51 20 6 8 34 17 13 53 30 45 0 10 16 41 4 5 6 4 14 2 31 6 0 11 13 3 3 43 13 36 51 0 7 16 28 23 8 36 30 22 8 54 21 45 39 4 50 15 1 30 17 8 18 10 2 20 16 50 6 68 15 6 38 7 28 8 29 41",
"output": "20.928571428571"
},
{
"input": "99\n60 65 40 63 57 44 30 84 3 10 39 53 40 45 72 20 76 11 61 32 4 26 97 55 14 57 86 96 34 69 52 22 26 79 31 4 21 35 82 47 81 28 72 70 93 84 40 4 69 39 83 58 30 7 32 73 74 12 92 23 61 88 9 58 70 32 75 40 63 71 46 55 39 36 14 97 32 16 95 41 28 20 85 40 5 50 50 50 75 6 10 64 38 19 77 91 50 72 96",
"output": "49.191919191919"
},
{
"input": "99\n100 88 40 30 81 80 91 98 69 73 88 96 79 58 14 100 87 84 52 91 83 88 72 83 99 35 54 80 46 79 52 72 85 32 99 39 79 79 45 83 88 50 75 75 50 59 65 75 97 63 92 58 89 46 93 80 89 33 69 86 99 99 66 85 72 74 79 98 85 95 46 63 77 97 49 81 89 39 70 76 68 91 90 56 31 93 51 87 73 95 74 69 87 95 57 68 49 95 92",
"output": "73.484848484848"
},
{
"input": "100\n18 15 17 0 3 3 0 4 1 8 2 22 7 21 5 0 0 8 3 16 1 0 2 9 9 3 10 8 17 20 5 4 8 12 2 3 1 1 3 2 23 0 1 0 5 7 4 0 1 3 3 4 25 2 2 14 8 4 9 3 0 11 0 3 12 3 14 16 7 7 14 1 17 9 0 35 42 12 3 1 25 9 3 8 5 3 2 8 22 14 11 6 3 9 6 8 7 7 4 6",
"output": "7.640000000000"
},
{
"input": "100\n88 77 65 87 100 63 91 96 92 89 77 95 76 80 84 83 100 71 85 98 26 54 74 78 69 59 96 86 88 91 95 26 52 88 64 70 84 81 76 84 94 82 100 66 97 98 43 94 59 94 100 80 98 73 69 83 94 70 74 79 91 31 62 88 69 55 62 97 40 64 62 83 87 85 50 90 69 72 67 49 100 51 69 96 81 90 83 91 86 34 79 69 100 66 97 98 47 97 74 100",
"output": "77.660000000000"
},
{
"input": "100\n91 92 90 91 98 84 85 96 83 98 99 87 94 70 87 75 86 90 89 88 82 83 91 94 88 86 90 99 100 98 97 75 95 99 95 100 91 92 76 93 95 97 88 93 95 81 96 89 88 100 98 87 90 96 100 99 58 90 96 77 92 82 100 100 93 93 98 99 79 88 97 95 98 66 96 83 96 100 99 92 98 98 92 93 100 97 98 100 98 97 100 100 94 90 99 100 98 79 80 81",
"output": "91.480000000000"
},
{
"input": "1\n0",
"output": "0.000000000000"
},
{
"input": "1\n100",
"output": "100.000000000000"
},
{
"input": "1\n78",
"output": "78.000000000000"
},
{
"input": "2\n0 100",
"output": "50.000000000000"
},
{
"input": "2\n100 100",
"output": "100.000000000000"
},
{
"input": "5\n0 0 0 0 1",
"output": "0.200000000000"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99",
"output": "99.990000000000"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "0.010000000000"
},
{
"input": "5\n100 100 100 100 100",
"output": "100.000000000000"
}
] | 1,690,049,759
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 31
| 92
| 0
|
n=int(input())
x=[int(x) for x in input().split()]
s=(sum(x))
t=s/n
print(t)
|
Title: Drinks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Vasya loves orange juice very much. That's why any food and drink in his kitchen necessarily contains orange juice. There are *n* drinks in his fridge, the volume fraction of orange juice in the *i*-th drink equals *p**i* percent.
One day Vasya decided to make himself an orange cocktail. He took equal proportions of each of the *n* drinks and mixed them. Then he wondered, how much orange juice the cocktail has.
Find the volume fraction of orange juice in the final drink.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of orange-containing drinks in Vasya's fridge. The second line contains *n* integers *p**i* (0<=≤<=*p**i*<=≤<=100) — the volume fraction of orange juice in the *i*-th drink, in percent. The numbers are separated by a space.
Output Specification:
Print the volume fraction in percent of orange juice in Vasya's cocktail. The answer will be considered correct if the absolute or relative error does not exceed 10<=<=-<=4.
Demo Input:
['3\n50 50 100\n', '4\n0 25 50 75\n']
Demo Output:
['66.666666666667\n', '37.500000000000\n']
Note:
Note to the first sample: let's assume that Vasya takes *x* milliliters of each drink from the fridge. Then the volume of pure juice in the cocktail will equal <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c1fac6e64d3a8ee6a5ac138cbe51e60039b22473.png" style="max-width: 100.0%;max-height: 100.0%;"/> milliliters. The total cocktail's volume equals 3·*x* milliliters, so the volume fraction of the juice in the cocktail equals <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ceb0664e55a1f9f5fa1243ec74680a4665a4d58d.png" style="max-width: 100.0%;max-height: 100.0%;"/>, that is, 66.(6) percent.
|
```python
n=int(input())
x=[int(x) for x in input().split()]
s=(sum(x))
t=s/n
print(t)
```
| 3
|
|
58
|
A
|
Chat room
|
PROGRAMMING
| 1,000
|
[
"greedy",
"strings"
] |
A. Chat room
|
1
|
256
|
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
|
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
|
If Vasya managed to say hello, print "YES", otherwise print "NO".
|
[
"ahhellllloou\n",
"hlelo\n"
] |
[
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "ahhellllloou",
"output": "YES"
},
{
"input": "hlelo",
"output": "NO"
},
{
"input": "helhcludoo",
"output": "YES"
},
{
"input": "hehwelloho",
"output": "YES"
},
{
"input": "pnnepelqomhhheollvlo",
"output": "YES"
},
{
"input": "tymbzjyqhymedasloqbq",
"output": "NO"
},
{
"input": "yehluhlkwo",
"output": "NO"
},
{
"input": "hatlevhhalrohairnolsvocafgueelrqmlqlleello",
"output": "YES"
},
{
"input": "hhhtehdbllnhwmbyhvelqqyoulretpbfokflhlhreeflxeftelziclrwllrpflflbdtotvlqgoaoqldlroovbfsq",
"output": "YES"
},
{
"input": "rzlvihhghnelqtwlexmvdjjrliqllolhyewgozkuovaiezgcilelqapuoeglnwmnlftxxiigzczlouooi",
"output": "YES"
},
{
"input": "pfhhwctyqdlkrwhebfqfelhyebwllhemtrmeblgrynmvyhioesqklclocxmlffuormljszllpoo",
"output": "YES"
},
{
"input": "lqllcolohwflhfhlnaow",
"output": "NO"
},
{
"input": "heheeellollvoo",
"output": "YES"
},
{
"input": "hellooo",
"output": "YES"
},
{
"input": "o",
"output": "NO"
},
{
"input": "hhqhzeclohlehljlhtesllylrolmomvuhcxsobtsckogdv",
"output": "YES"
},
{
"input": "yoegfuzhqsihygnhpnukluutocvvwuldiighpogsifealtgkfzqbwtmgghmythcxflebrkctlldlkzlagovwlstsghbouk",
"output": "YES"
},
{
"input": "uatqtgbvrnywfacwursctpagasnhydvmlinrcnqrry",
"output": "NO"
},
{
"input": "tndtbldbllnrwmbyhvqaqqyoudrstpbfokfoclnraefuxtftmgzicorwisrpfnfpbdtatvwqgyalqtdtrjqvbfsq",
"output": "NO"
},
{
"input": "rzlvirhgemelnzdawzpaoqtxmqucnahvqnwldklrmjiiyageraijfivigvozgwngiulttxxgzczptusoi",
"output": "YES"
},
{
"input": "kgyelmchocojsnaqdsyeqgnllytbqietpdlgknwwumqkxrexgdcnwoldicwzwofpmuesjuxzrasscvyuqwspm",
"output": "YES"
},
{
"input": "pnyvrcotjvgynbeldnxieghfltmexttuxzyac",
"output": "NO"
},
{
"input": "dtwhbqoumejligbenxvzhjlhosqojetcqsynlzyhfaevbdpekgbtjrbhlltbceobcok",
"output": "YES"
},
{
"input": "crrfpfftjwhhikwzeedrlwzblckkteseofjuxjrktcjfsylmlsvogvrcxbxtffujqshslemnixoeezivksouefeqlhhokwbqjz",
"output": "YES"
},
{
"input": "jhfbndhyzdvhbvhmhmefqllujdflwdpjbehedlsqfdsqlyelwjtyloxwsvasrbqosblzbowlqjmyeilcvotdlaouxhdpoeloaovb",
"output": "YES"
},
{
"input": "hwlghueoemiqtjhhpashjsouyegdlvoyzeunlroypoprnhlyiwiuxrghekaylndhrhllllwhbebezoglydcvykllotrlaqtvmlla",
"output": "YES"
},
{
"input": "wshiaunnqnqxodholbipwhhjmyeblhgpeleblklpzwhdunmpqkbuzloetmwwxmeltkrcomulxauzlwmlklldjodozxryghsnwgcz",
"output": "YES"
},
{
"input": "shvksednttggehroewuiptvvxtrzgidravtnjwuqrlnnkxbplctzkckinpkgjopjfoxdbojtcvsuvablcbkrzajrlhgobkcxeqti",
"output": "YES"
},
{
"input": "hyyhddqhxhekehkwfhlnlsihzefwchzerevcjtokefplholrbvxlltdlafjxrfhleglrvlolojoqaolagtbeyogxlbgfolllslli",
"output": "YES"
},
{
"input": "iaagrdhhelxpdegueiulflquvlzidoprzkehthkldaytrjwhyhprwjxlltinxvuilxohqgjqcvkkdcuoliekcnlilwgqlnlzouoo",
"output": "YES"
},
{
"input": "wfluaeseldgxyvxpwuhkptdmlflnlhktwxiabsvkolsquymrmhzczzoybvlilhmvsuunggvgxzgyyffk",
"output": "NO"
},
{
"input": "loee",
"output": "NO"
},
{
"input": "izdipwylefqmjbuoznfglgcfvedeouflkeehxbasaqmiooppfsqlhprospqgxvzrcpwlfdddngoqvpwvggsnvvxhmjoslwjudjlo",
"output": "NO"
},
{
"input": "pplynflbjlseflaegzqpdxswgunhnlglqhycrbcwdfhclmcrwekkzsoosmfblljeenwfjyifcvxihhhbyhmhlkvtskeglaovjnsi",
"output": "YES"
},
{
"input": "xqjqmenkodmlhzyzmmvofdngktygbbxbzpluzcohohmalkoeuwfikblltaaigv",
"output": "NO"
},
{
"input": "hello",
"output": "YES"
},
{
"input": "oohell",
"output": "NO"
},
{
"input": "hell",
"output": "NO"
},
{
"input": "eloellohoelo",
"output": "NO"
},
{
"input": "helllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllo",
"output": "YES"
}
] | 1,631,911,333
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 40
| 62
| 6,758,400
|
s = input()
s1 = 'hello'
j=0
for i in range (len(s)):
if s[i]==s1[j]:
j+=1
if j==5:
print('YES')
break
elif j<5 and i== len(s)-1:
print('NO')
|
Title: Chat room
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya has recently learned to type and log on to the Internet. He immediately entered a chat room and decided to say hello to everybody. Vasya typed the word *s*. It is considered that Vasya managed to say hello if several letters can be deleted from the typed word so that it resulted in the word "hello". For example, if Vasya types the word "ahhellllloou", it will be considered that he said hello, and if he types "hlelo", it will be considered that Vasya got misunderstood and he didn't manage to say hello. Determine whether Vasya managed to say hello by the given word *s*.
Input Specification:
The first and only line contains the word *s*, which Vasya typed. This word consisits of small Latin letters, its length is no less that 1 and no more than 100 letters.
Output Specification:
If Vasya managed to say hello, print "YES", otherwise print "NO".
Demo Input:
['ahhellllloou\n', 'hlelo\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none
|
```python
s = input()
s1 = 'hello'
j=0
for i in range (len(s)):
if s[i]==s1[j]:
j+=1
if j==5:
print('YES')
break
elif j<5 and i== len(s)-1:
print('NO')
```
| 3.956411
|
910
|
A
|
The Way to Home
|
PROGRAMMING
| 800
|
[
"dfs and similar",
"dp",
"greedy",
"implementation"
] | null | null |
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
|
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
|
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
|
[
"8 4\n10010101\n",
"4 2\n1001\n",
"8 4\n11100101\n",
"12 3\n101111100101\n"
] |
[
"2\n",
"-1\n",
"3\n",
"4\n"
] |
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
| 500
|
[
{
"input": "8 4\n10010101",
"output": "2"
},
{
"input": "4 2\n1001",
"output": "-1"
},
{
"input": "8 4\n11100101",
"output": "3"
},
{
"input": "12 3\n101111100101",
"output": "4"
},
{
"input": "5 4\n11011",
"output": "1"
},
{
"input": "5 4\n10001",
"output": "1"
},
{
"input": "10 7\n1101111011",
"output": "2"
},
{
"input": "10 9\n1110000101",
"output": "1"
},
{
"input": "10 9\n1100000001",
"output": "1"
},
{
"input": "20 5\n11111111110111101001",
"output": "4"
},
{
"input": "20 11\n11100000111000011011",
"output": "2"
},
{
"input": "20 19\n10100000000000000001",
"output": "1"
},
{
"input": "50 13\n10011010100010100111010000010000000000010100000101",
"output": "5"
},
{
"input": "50 8\n11010100000011001100001100010001110000101100110011",
"output": "8"
},
{
"input": "99 4\n111111111111111111111111111111111111111111111111111111111011111111111111111111111111111111111111111",
"output": "25"
},
{
"input": "99 98\n100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 5\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "20"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111111111111111111110111111111111111111111",
"output": "25"
},
{
"input": "100 4\n1111111111111111111111111111111111111111111111111111111111111101111111011111111111111111111111111111",
"output": "25"
},
{
"input": "100 3\n1111110111111111111111111111111111111111101111111111111111111111111101111111111111111111111111111111",
"output": "34"
},
{
"input": "100 8\n1111111111101110111111111111111111111111111111111111111111111111111111110011111111111111011111111111",
"output": "13"
},
{
"input": "100 7\n1011111111111111111011101111111011111101111111111101111011110111111111111111111111110111111011111111",
"output": "15"
},
{
"input": "100 9\n1101111110111110101111111111111111011001110111011101011111111111010101111111100011011111111010111111",
"output": "12"
},
{
"input": "100 6\n1011111011111111111011010110011001010101111110111111000111011011111110101101110110101111110000100111",
"output": "18"
},
{
"input": "100 7\n1110001111101001110011111111111101111101101001010001101000101100000101101101011111111101101000100001",
"output": "16"
},
{
"input": "100 11\n1000010100011100011011100000010011001111011110100100001011010100011011111001101101110110010110001101",
"output": "10"
},
{
"input": "100 9\n1001001110000011100100000001000110111101101010101001000101001010011001101100110011011110110011011111",
"output": "13"
},
{
"input": "100 7\n1010100001110101111011000111000001110100100110110001110110011010100001100100001110111100110000101001",
"output": "18"
},
{
"input": "100 10\n1110110000000110000000101110100000111000001011100000100110010001110111001010101000011000000001011011",
"output": "12"
},
{
"input": "100 13\n1000000100000000100011000010010000101010011110000000001000011000110100001000010001100000011001011001",
"output": "9"
},
{
"input": "100 11\n1000000000100000010000100001000100000000010000100100000000100100001000000001011000110001000000000101",
"output": "12"
},
{
"input": "100 22\n1000100000001010000000000000000001000000100000000000000000010000000000001000000000000000000100000001",
"output": "7"
},
{
"input": "100 48\n1000000000000000011000000000000000000000000000000001100000000000000000000000000000000000000000000001",
"output": "3"
},
{
"input": "100 48\n1000000000000000000000100000000000000000000000000000000000000000000001000000000000000000100000000001",
"output": "3"
},
{
"input": "100 75\n1000000100000000000000000000000000000000000000000000000000000000000000000000000001000000000000000001",
"output": "3"
},
{
"input": "100 73\n1000000000000000000000000000000100000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 99\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "99"
},
{
"input": "100 2\n1111111111111111111111111111111110111111111111111111111111111111111111111111111111111111111111111111",
"output": "50"
},
{
"input": "100 1\n1111111111111111011111111111111111111111111111111111111111111111111101111111111111111111111111111111",
"output": "-1"
},
{
"input": "100 3\n1111111111111111111111111101111111111111111111111011111111111111111111111111111011111111111111111111",
"output": "33"
},
{
"input": "100 1\n1101111111111111111111101111111111111111111111111111111111111011111111101111101111111111111111111111",
"output": "-1"
},
{
"input": "100 6\n1111111111111111111111101111111101011110001111111111111111110111111111111111111111111110010111111111",
"output": "17"
},
{
"input": "100 2\n1111111101111010110111011011110111101111111011111101010101011111011111111111111011111001101111101111",
"output": "-1"
},
{
"input": "100 8\n1100110101111001101001111000111100110100011110111011001011111110000110101000001110111011100111011011",
"output": "14"
},
{
"input": "100 10\n1000111110100000001001101100000010011100010101001100010011111001001101111110110111101111001010001101",
"output": "11"
},
{
"input": "100 7\n1110000011010001110101011010000011110001000000011101110111010110001000011101111010010001101111110001",
"output": "-1"
},
{
"input": "100 3\n1111010001000001011011000011001111000100101000101101000010111101111000010000011110110011001101010111",
"output": "-1"
},
{
"input": "100 9\n1101010101101100010111011000010100001010000101010011001001100010110110000000010000101000000001101101",
"output": "13"
},
{
"input": "100 14\n1010100000000000010101000010001100000000000011100010000001000001011010001110001010100000100001101101",
"output": "9"
},
{
"input": "100 13\n1000000001101001110000010000011001000000000000001010000000100001001010000000000000000100010000000001",
"output": "-1"
},
{
"input": "100 18\n1000000000000000110000000000000000010000000001000001000001000000000100000000000010000000000000000001",
"output": "-1"
},
{
"input": "100 32\n1000000000000000000000000001000000000000000000000101000000000000000000000000000000000001000000000001",
"output": "-1"
},
{
"input": "100 79\n1000000001000000000101000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 41\n1000000000000000000000000000000000010000000000000000000000000000000000000000100000000000000000000001",
"output": "3"
},
{
"input": "100 82\n1000000000000000000100000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "2"
},
{
"input": "100 96\n1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001",
"output": "-1"
},
{
"input": "43 30\n1001000001111111010100100100110101011101101",
"output": "2"
},
{
"input": "7 1\n1111111",
"output": "6"
},
{
"input": "9 3\n101000001",
"output": "-1"
},
{
"input": "10 3\n1100000001",
"output": "-1"
},
{
"input": "8 2\n10000101",
"output": "-1"
},
{
"input": "2 1\n11",
"output": "1"
}
] | 1,514,192,254
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 63
| 77
| 5,632,000
|
a=input().split(' ')
n,d=int(a[0]),int(a[1])
data=input()
data=[0]+[int(i) for i in data]
coord = 0
a=[99999]*(n+1)
def is_jump(i, j):
return(data[i]==1 and data[j]==1)
a[n]=0
for i in range(n,0,-1):
for j in range(max(1,i-d),i):
if is_jump(i,j):
a[j]=min(a[j],a[i]+1)
if a[1]!=99999:
print(a[1])
else:
print('-1')
|
Title: The Way to Home
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A frog lives on the axis *Ox* and needs to reach home which is in the point *n*. She starts from the point 1. The frog can jump to the right at a distance not more than *d*. So, after she jumped from the point *x* she can reach the point *x*<=+<=*a*, where *a* is an integer from 1 to *d*.
For each point from 1 to *n* is known if there is a lily flower in it. The frog can jump only in points with a lilies. Guaranteed that there are lilies in the points 1 and *n*.
Determine the minimal number of jumps that the frog needs to reach home which is in the point *n* from the point 1. Consider that initially the frog is in the point 1. If the frog can not reach home, print -1.
Input Specification:
The first line contains two integers *n* and *d* (2<=≤<=*n*<=≤<=100, 1<=≤<=*d*<=≤<=*n*<=-<=1) — the point, which the frog wants to reach, and the maximal length of the frog jump.
The second line contains a string *s* of length *n*, consisting of zeros and ones. If a character of the string *s* equals to zero, then in the corresponding point there is no lily flower. In the other case, in the corresponding point there is a lily flower. Guaranteed that the first and the last characters of the string *s* equal to one.
Output Specification:
If the frog can not reach the home, print -1.
In the other case, print the minimal number of jumps that the frog needs to reach the home which is in the point *n* from the point 1.
Demo Input:
['8 4\n10010101\n', '4 2\n1001\n', '8 4\n11100101\n', '12 3\n101111100101\n']
Demo Output:
['2\n', '-1\n', '3\n', '4\n']
Note:
In the first example the from can reach home in two jumps: the first jump from the point 1 to the point 4 (the length of the jump is three), and the second jump from the point 4 to the point 8 (the length of the jump is four).
In the second example the frog can not reach home, because to make it she need to jump on a distance three, but the maximum length of her jump equals to two.
|
```python
a=input().split(' ')
n,d=int(a[0]),int(a[1])
data=input()
data=[0]+[int(i) for i in data]
coord = 0
a=[99999]*(n+1)
def is_jump(i, j):
return(data[i]==1 and data[j]==1)
a[n]=0
for i in range(n,0,-1):
for j in range(max(1,i-d),i):
if is_jump(i,j):
a[j]=min(a[j],a[i]+1)
if a[1]!=99999:
print(a[1])
else:
print('-1')
```
| 3
|
|
687
|
B
|
Remainders Game
|
PROGRAMMING
| 1,800
|
[
"chinese remainder theorem",
"math",
"number theory"
] | null | null |
Today Pari and Arya are playing a game called Remainders.
Pari chooses two positive integer *x* and *k*, and tells Arya *k* but not *x*. Arya have to find the value . There are *n* ancient numbers *c*1,<=*c*2,<=...,<=*c**n* and Pari has to tell Arya if Arya wants. Given *k* and the ancient values, tell us if Arya has a winning strategy independent of value of *x* or not. Formally, is it true that Arya can understand the value for any positive integer *x*?
Note, that means the remainder of *x* after dividing it by *y*.
|
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<= *k*<=≤<=1<=000<=000) — the number of ancient integers and value *k* that is chosen by Pari.
The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=1<=000<=000).
|
Print "Yes" (without quotes) if Arya has a winning strategy independent of value of *x*, or "No" (without quotes) otherwise.
|
[
"4 5\n2 3 5 12\n",
"2 7\n2 3\n"
] |
[
"Yes\n",
"No\n"
] |
In the first sample, Arya can understand <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d170efffcde0907ee6bcf32de21051bce0677a2c.png" style="max-width: 100.0%;max-height: 100.0%;"/> because 5 is one of the ancient numbers.
In the second sample, Arya can't be sure what <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/57b5f6a96f5db073270dd3ed4266c69299ec701d.png" style="max-width: 100.0%;max-height: 100.0%;"/> is. For example 1 and 7 have the same remainders after dividing by 2 and 3, but they differ in remainders after dividing by 7.
| 1,000
|
[
{
"input": "4 5\n2 3 5 12",
"output": "Yes"
},
{
"input": "2 7\n2 3",
"output": "No"
},
{
"input": "1 6\n8",
"output": "No"
},
{
"input": "2 3\n9 4",
"output": "Yes"
},
{
"input": "4 16\n19 16 13 9",
"output": "Yes"
},
{
"input": "5 10\n5 16 19 9 17",
"output": "Yes"
},
{
"input": "11 95\n31 49 8 139 169 121 71 17 43 29 125",
"output": "No"
},
{
"input": "17 71\n173 43 139 73 169 199 49 81 11 89 131 107 23 29 125 152 17",
"output": "No"
},
{
"input": "13 86\n41 64 17 31 13 97 19 25 81 47 61 37 71",
"output": "No"
},
{
"input": "15 91\n49 121 83 67 128 125 27 113 41 169 149 19 37 29 71",
"output": "Yes"
},
{
"input": "2 4\n2 2",
"output": "No"
},
{
"input": "14 87\n1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619 1619",
"output": "No"
},
{
"input": "12 100\n1766 1766 1766 1766 1766 1766 1766 1766 1766 1766 1766 1766",
"output": "No"
},
{
"input": "1 994619\n216000",
"output": "No"
},
{
"input": "1 651040\n911250",
"output": "No"
},
{
"input": "1 620622\n60060",
"output": "No"
},
{
"input": "1 1\n559872",
"output": "Yes"
},
{
"input": "88 935089\n967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967 967",
"output": "No"
},
{
"input": "93 181476\n426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426 426",
"output": "No"
},
{
"input": "91 4900\n630 630 70 630 910 630 630 630 770 70 770 630 630 770 70 630 70 630 70 630 70 630 630 70 910 630 630 630 770 630 630 630 70 910 70 630 70 630 770 630 630 70 630 770 70 630 70 70 630 630 70 70 70 70 630 70 70 770 910 630 70 630 770 70 910 70 630 910 630 70 770 70 70 630 770 630 70 630 70 70 630 70 630 770 630 70 630 630 70 910 630",
"output": "No"
},
{
"input": "61 531012\n698043 698043 698043 963349 698043 698043 698043 963349 698043 698043 698043 963349 698043 698043 698043 698043 966694 698043 698043 698043 698043 698043 698043 636247 698043 963349 698043 698043 698043 698043 697838 698043 963349 698043 698043 966694 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 698043 963349 698043 698043 698043 698043 963349 698043",
"output": "No"
},
{
"input": "1 216000\n648000",
"output": "Yes"
},
{
"input": "2 8\n4 4",
"output": "No"
},
{
"input": "3 8\n4 4 4",
"output": "No"
},
{
"input": "2 8\n2 4",
"output": "No"
},
{
"input": "3 12\n2 2 3",
"output": "No"
},
{
"input": "10 4\n2 2 2 2 2 2 2 2 2 2",
"output": "No"
},
{
"input": "10 1024\n1 2 4 8 16 32 64 128 256 512",
"output": "No"
},
{
"input": "3 24\n2 2 3",
"output": "No"
},
{
"input": "1 8\n2",
"output": "No"
},
{
"input": "2 9\n3 3",
"output": "No"
},
{
"input": "3 4\n2 2 2",
"output": "No"
},
{
"input": "3 4\n1 2 2",
"output": "No"
},
{
"input": "1 4\n2",
"output": "No"
},
{
"input": "1 100003\n2",
"output": "No"
},
{
"input": "1 2\n12",
"output": "Yes"
},
{
"input": "2 988027\n989018 995006",
"output": "Yes"
},
{
"input": "3 9\n3 3 3",
"output": "No"
},
{
"input": "1 49\n7",
"output": "No"
},
{
"input": "2 600000\n200000 300000",
"output": "Yes"
},
{
"input": "3 8\n2 2 2",
"output": "No"
},
{
"input": "7 510510\n524288 531441 390625 823543 161051 371293 83521",
"output": "Yes"
},
{
"input": "2 30\n6 10",
"output": "Yes"
},
{
"input": "2 27000\n5400 4500",
"output": "Yes"
},
{
"input": "3 8\n1 2 4",
"output": "No"
},
{
"input": "4 16\n2 2 2 2",
"output": "No"
},
{
"input": "2 16\n4 8",
"output": "No"
},
{
"input": "2 8\n4 2",
"output": "No"
},
{
"input": "3 4\n2 2 3",
"output": "No"
},
{
"input": "1 8\n4",
"output": "No"
},
{
"input": "1 999983\n2",
"output": "No"
},
{
"input": "3 16\n2 4 8",
"output": "No"
},
{
"input": "2 216\n12 18",
"output": "No"
},
{
"input": "2 16\n8 8",
"output": "No"
},
{
"input": "2 36\n18 12",
"output": "Yes"
},
{
"input": "2 36\n12 18",
"output": "Yes"
},
{
"input": "2 1000000\n1000000 1000000",
"output": "Yes"
},
{
"input": "3 20\n2 2 5",
"output": "No"
},
{
"input": "1 2\n6",
"output": "Yes"
},
{
"input": "4 4\n2 3 6 5",
"output": "No"
},
{
"input": "1 2\n1",
"output": "No"
},
{
"input": "1 6\n6",
"output": "Yes"
},
{
"input": "2 16\n4 4",
"output": "No"
},
{
"input": "2 3779\n1 2",
"output": "No"
},
{
"input": "2 8\n4 12",
"output": "No"
},
{
"input": "2 24\n4 6",
"output": "No"
},
{
"input": "1 1\n5",
"output": "Yes"
},
{
"input": "10 255255\n1000000 700000 300000 110000 130000 170000 190000 230000 290000 310000",
"output": "Yes"
},
{
"input": "2 1000\n500 2",
"output": "No"
},
{
"input": "4 8\n2 2 2 2",
"output": "No"
},
{
"input": "1 666013\n1",
"output": "No"
},
{
"input": "1 999983\n1",
"output": "No"
},
{
"input": "1 125\n5",
"output": "No"
},
{
"input": "2 32\n4 8",
"output": "No"
},
{
"input": "3 32\n2 4 8",
"output": "No"
},
{
"input": "3 8\n2 4 11",
"output": "No"
},
{
"input": "1 32\n2",
"output": "No"
},
{
"input": "4 4\n2 2 2 2",
"output": "No"
},
{
"input": "8 32\n2 2 2 2 2 2 2 2",
"output": "No"
},
{
"input": "3 24\n2 4 3",
"output": "No"
},
{
"input": "2 4\n2 6",
"output": "No"
},
{
"input": "2 24\n6 4",
"output": "No"
},
{
"input": "1 20998\n2",
"output": "No"
},
{
"input": "1 1\n1",
"output": "Yes"
},
{
"input": "2 20998\n2 10499",
"output": "Yes"
},
{
"input": "1 5\n1",
"output": "No"
},
{
"input": "2 25\n5 5",
"output": "No"
},
{
"input": "5 2\n2 2 2 2 2",
"output": "Yes"
},
{
"input": "3 12\n2 3 6",
"output": "No"
},
{
"input": "1 1\n3",
"output": "Yes"
},
{
"input": "2 16\n8 4",
"output": "No"
},
{
"input": "40 10\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "No"
}
] | 1,498,969,419
| 2,147,483,647
|
PyPy 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
n,k=list(map(int,input().strip().split(' ')))
K=list(map(int,input().strip().split(' ')))
if 1==1:
def gcd(a,b):
if a>b:
a,b=b,a
if b%a==0:
return b
else:
return gcd(a,b%a)
return (a*b)//gcd(a,b)
def LCM(a,b):
return (a*b)//gcd(a,b)
temp=K[0]
for i in range(len(K)):
temp=LCM(K[i],temp)
temp=gcd(k,temp)
if temp%k==0:
print('YES')
else:
print('NO')
|
Title: Remainders Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Today Pari and Arya are playing a game called Remainders.
Pari chooses two positive integer *x* and *k*, and tells Arya *k* but not *x*. Arya have to find the value . There are *n* ancient numbers *c*1,<=*c*2,<=...,<=*c**n* and Pari has to tell Arya if Arya wants. Given *k* and the ancient values, tell us if Arya has a winning strategy independent of value of *x* or not. Formally, is it true that Arya can understand the value for any positive integer *x*?
Note, that means the remainder of *x* after dividing it by *y*.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*,<= *k*<=≤<=1<=000<=000) — the number of ancient integers and value *k* that is chosen by Pari.
The second line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=1<=000<=000).
Output Specification:
Print "Yes" (without quotes) if Arya has a winning strategy independent of value of *x*, or "No" (without quotes) otherwise.
Demo Input:
['4 5\n2 3 5 12\n', '2 7\n2 3\n']
Demo Output:
['Yes\n', 'No\n']
Note:
In the first sample, Arya can understand <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d170efffcde0907ee6bcf32de21051bce0677a2c.png" style="max-width: 100.0%;max-height: 100.0%;"/> because 5 is one of the ancient numbers.
In the second sample, Arya can't be sure what <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/57b5f6a96f5db073270dd3ed4266c69299ec701d.png" style="max-width: 100.0%;max-height: 100.0%;"/> is. For example 1 and 7 have the same remainders after dividing by 2 and 3, but they differ in remainders after dividing by 7.
|
```python
n,k=list(map(int,input().strip().split(' ')))
K=list(map(int,input().strip().split(' ')))
if 1==1:
def gcd(a,b):
if a>b:
a,b=b,a
if b%a==0:
return b
else:
return gcd(a,b%a)
return (a*b)//gcd(a,b)
def LCM(a,b):
return (a*b)//gcd(a,b)
temp=K[0]
for i in range(len(K)):
temp=LCM(K[i],temp)
temp=gcd(k,temp)
if temp%k==0:
print('YES')
else:
print('NO')
```
| -1
|
|
656
|
C
|
Without Text
|
PROGRAMMING
| 2,000
|
[
"*special"
] | null | null |
You can preview the image in better quality by the link: [http://assets.codeforces.com/files/656/without-text.png](//assets.codeforces.com/files/656/without-text.png)
|
The only line of the input is a string (between 1 and 50 characters long, inclusive). Each character will be an alphanumeric character or a full stop ".".
|
Output the required answer.
|
[
"Codeforces\n",
"APRIL.1st\n"
] |
[
"-87\n",
"17\n"
] |
none
| 0
|
[
{
"input": "Codeforces",
"output": "-87"
},
{
"input": "APRIL.1st",
"output": "17"
},
{
"input": ".0.1.2.",
"output": "0"
},
{
"input": "CODEcode",
"output": "0"
},
{
"input": "A",
"output": "1"
},
{
"input": "ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ",
"output": "1300"
},
{
"input": ".5i7kqPokKqEsLMn8ib",
"output": "-67"
},
{
"input": "Bgh",
"output": "-13"
},
{
"input": "LHg25JHfDf74yUj2rezrsTGBzsVZKyFMikyesiW",
"output": "-95"
},
{
"input": "XugVHXi3RqJWXaP9i6g.0fP",
"output": "108"
},
{
"input": "vTUvjiXvQbCUrJ5tbAblMtPZ6r8RVFFXrV6CL",
"output": "88"
},
{
"input": "uVVcZsrSe",
"output": "23"
},
{
"input": "rXVKP0A.qQnv9ATzvUxSz.eMD6ZoIIvb",
"output": "0"
},
{
"input": "sVmF.LOJCNrkn2iupiiou",
"output": "-93"
},
{
"input": "rXoypUjrOofxvzuSUrNfhxn490ZBwQZ0mMHYFlY4DCNQW",
"output": "-11"
},
{
"input": "oZndfd2PbCT85u6081",
"output": "-1"
},
{
"input": "K1mOToYzavp3Kaeacv",
"output": "-43"
},
{
"input": "K3n5JwuWoJdFUVq8H5QldFqDD2B9yCUDFY1TTMN10",
"output": "118"
},
{
"input": "J5pm96D11kPTf",
"output": "4"
},
{
"input": "G7pT.FXaC9ChoODEaRkTGL41NIcXmG9FiiS",
"output": "137"
},
{
"input": "G45OZakwa5JVOES9UdXq9Edpj",
"output": "82"
},
{
"input": "F646Pj3RlX5iZ9ei8oCh.IDjGCcvPQofAPCpNRwkBa6uido8w",
"output": "-44"
},
{
"input": "D86oFsPzzwtuj5oEoxrYo",
"output": "-191"
},
{
"input": "D5LkqCdKJsy",
"output": "-36"
},
{
"input": "C7NRgNxtXJlwSuEhNJHkWH0LmEpUwcKbs",
"output": "17"
},
{
"input": "B9O9WWF",
"output": "69"
},
{
"input": "M1TEc65C1h",
"output": "30"
},
{
"input": "L3TuSHPiE7oQPhOnQlHZhsknMEO5.2.R",
"output": "99"
},
{
"input": "L5VbIQ",
"output": "58"
},
{
"input": "I9WJ8Z4neyQpjakuk6bIJyzbWVnT",
"output": "-14"
},
{
"input": "I6lEiuI6zuUfJQ0peI",
"output": "-36"
},
{
"input": "H8nxY2bfCKIrUMANJT2V1v7JPOnoQGMuk7SZp.oS",
"output": "121"
},
{
"input": "FApeOAvCPk64",
"output": "-12"
},
{
"input": "F7",
"output": "6"
},
{
"input": "E94HphU3y4z6Q3nMYz8YYuvvtR",
"output": "-43"
},
{
"input": "DB6zepob9WnHY0zvC8nPOzVpSYDZsTgLfzdvj4L8DrRPCdHS",
"output": "6"
},
{
"input": "O",
"output": "15"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "-1300"
},
{
"input": "kKKKKKkkkkkKKKKKkkkKKKKKkkkkkkkkkkkKKKKKkkkkkKKKKK",
"output": "0"
}
] | 1,659,730,295
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 156
| 6,963,200
|
import sys, os
import math
from itertools import combinations, permutations
from turtle import st
TC = False
def solve():
print(sum(map(lambda x:96-x if x>96 else x-64,map(ord,filter(str.isalpha,input())))))
if os.path.exists('input.txt'):
debug = True
sys.stdin = open("input.txt","r")
#sys.stdout = open("output.txt","w")
if TC:
for _ in range(int(input())):
solve()
else:
solve()
|
Title: Without Text
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You can preview the image in better quality by the link: [http://assets.codeforces.com/files/656/without-text.png](//assets.codeforces.com/files/656/without-text.png)
Input Specification:
The only line of the input is a string (between 1 and 50 characters long, inclusive). Each character will be an alphanumeric character or a full stop ".".
Output Specification:
Output the required answer.
Demo Input:
['Codeforces\n', 'APRIL.1st\n']
Demo Output:
['-87\n', '17\n']
Note:
none
|
```python
import sys, os
import math
from itertools import combinations, permutations
from turtle import st
TC = False
def solve():
print(sum(map(lambda x:96-x if x>96 else x-64,map(ord,filter(str.isalpha,input())))))
if os.path.exists('input.txt'):
debug = True
sys.stdin = open("input.txt","r")
#sys.stdout = open("output.txt","w")
if TC:
for _ in range(int(input())):
solve()
else:
solve()
```
| 3
|
|
330
|
A
|
Cakeminator
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation"
] | null | null |
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
|
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
|
Output the maximum number of cake cells that the cakeminator can eat.
|
[
"3 4\nS...\n....\n..S.\n"
] |
[
"8\n"
] |
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
| 500
|
[
{
"input": "3 4\nS...\n....\n..S.",
"output": "8"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "2 2\nSS\nSS",
"output": "0"
},
{
"input": "7 3\nS..\nS..\nS..\nS..\nS..\nS..\nS..",
"output": "14"
},
{
"input": "3 5\n..S..\nSSSSS\n..S..",
"output": "0"
},
{
"input": "10 10\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS",
"output": "0"
},
{
"input": "10 10\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS\nS...SSSSSS",
"output": "30"
},
{
"input": "10 10\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..\n....S..S..",
"output": "80"
},
{
"input": "9 5\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS\nSSSSS",
"output": "0"
},
{
"input": "9 9\n...S.....\nS.S.....S\n.S....S..\n.S.....SS\n.........\n..S.S..S.\n.SS......\n....S....\n..S...S..",
"output": "17"
},
{
"input": "5 6\nSSSSSS\nSSSSSS\nSSSSSS\nSS.S..\nS.S.SS",
"output": "0"
},
{
"input": "9 8\n........\n.......S\n........\nS.......\n........\n........\nS.......\n........\n.......S",
"output": "64"
},
{
"input": "9 7\n......S\n......S\nS.S.S..\n.......\n.......\n.S.....\n.S....S\n..S....\n.S....S",
"output": "28"
},
{
"input": "10 10\n.....S....\n....SS..S.\n.S...S....\n........SS\n.S.......S\nSS..S.....\n.SS.....SS\nS..S......\n.......SSS\nSSSSS....S",
"output": "10"
},
{
"input": "6 7\n..S.SS.\n......S\n....S.S\nSS..S..\nS..SS.S\n.....S.",
"output": "0"
},
{
"input": "10 6\n.SSSSS\nSSS.SS\nSSSSSS\nS.SSSS\nSSSSS.\nS.SSSS\nSS.SSS\n.SSS.S\n.SSS..\nSS..SS",
"output": "0"
},
{
"input": "2 2\n..\n..",
"output": "4"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "3 2\nS.\n.S\nS.",
"output": "0"
},
{
"input": "4 3\n.S.\nS.S\n.S.\nS.S",
"output": "0"
},
{
"input": "2 3\n...\nSSS",
"output": "3"
},
{
"input": "2 4\nS.SS\nS.SS",
"output": "2"
},
{
"input": "2 2\n..\n.S",
"output": "3"
},
{
"input": "3 2\n.S\n.S\nSS",
"output": "0"
},
{
"input": "2 4\nSS.S\n..S.",
"output": "0"
},
{
"input": "2 3\n...\nS..",
"output": "5"
}
] | 1,603,199,976
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 42
| 340
| 0
|
r,c=map(int,input().split())
lis=[]
for i in range(r):
lis.append(input())
dicr={}
dicc={}
for i in range(r):
for j in range(c):
if(lis[i][j]=="S"):
dicr[i]=1
dicc[j]=1
#print(lis)
#print(dicr,dicc)
count=0
for i in range(r):
for j in range(c):
if(lis[i][j]!="S"):
if(dicr.get(i,0)==0 or dicc.get(j,0)==0):
count+=1
print(count)
|
Title: Cakeminator
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a rectangular cake, represented as an *r*<=×<=*c* grid. Each cell either has an evil strawberry, or is empty. For example, a 3<=×<=4 cake may look as follows:
The cakeminator is going to eat the cake! Each time he eats, he chooses a row or a column that does not contain any evil strawberries and contains at least one cake cell that has not been eaten before, and eats all the cake cells there. He may decide to eat any number of times.
Please output the maximum number of cake cells that the cakeminator can eat.
Input Specification:
The first line contains two integers *r* and *c* (2<=≤<=*r*,<=*c*<=≤<=10), denoting the number of rows and the number of columns of the cake. The next *r* lines each contains *c* characters — the *j*-th character of the *i*-th line denotes the content of the cell at row *i* and column *j*, and is either one of these:
- '.' character denotes a cake cell with no evil strawberry; - 'S' character denotes a cake cell with an evil strawberry.
Output Specification:
Output the maximum number of cake cells that the cakeminator can eat.
Demo Input:
['3 4\nS...\n....\n..S.\n']
Demo Output:
['8\n']
Note:
For the first example, one possible way to eat the maximum number of cake cells is as follows (perform 3 eats).
|
```python
r,c=map(int,input().split())
lis=[]
for i in range(r):
lis.append(input())
dicr={}
dicc={}
for i in range(r):
for j in range(c):
if(lis[i][j]=="S"):
dicr[i]=1
dicc[j]=1
#print(lis)
#print(dicr,dicc)
count=0
for i in range(r):
for j in range(c):
if(lis[i][j]!="S"):
if(dicr.get(i,0)==0 or dicc.get(j,0)==0):
count+=1
print(count)
```
| 3
|
|
34
|
A
|
Reconnaissance 2
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Reconnaissance 2
|
2
|
256
|
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
|
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
|
[
"5\n10 12 13 15 10\n",
"4\n10 20 30 40\n"
] |
[
"5 1\n",
"1 2\n"
] |
none
| 500
|
[
{
"input": "5\n10 12 13 15 10",
"output": "5 1"
},
{
"input": "4\n10 20 30 40",
"output": "1 2"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "2 3"
},
{
"input": "5\n826 747 849 687 437",
"output": "1 2"
},
{
"input": "5\n999 999 993 969 999",
"output": "1 2"
},
{
"input": "5\n4 24 6 1 15",
"output": "3 4"
},
{
"input": "2\n511 32",
"output": "1 2"
},
{
"input": "3\n907 452 355",
"output": "2 3"
},
{
"input": "4\n303 872 764 401",
"output": "4 1"
},
{
"input": "10\n684 698 429 694 956 812 594 170 937 764",
"output": "1 2"
},
{
"input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695",
"output": "7 8"
},
{
"input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000",
"output": "12 13"
},
{
"input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58",
"output": "16 17"
},
{
"input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000",
"output": "1 2"
},
{
"input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4",
"output": "1 2"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "86 87"
},
{
"input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25",
"output": "7 8"
},
{
"input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964",
"output": "1 2"
},
{
"input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967",
"output": "81 82"
},
{
"input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17",
"output": "36 37"
}
] | 1,611,735,464
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
a=int(input())
n=list(map(int,input().strip().split()))[:a]
p=sorted(n)
print(p)
j=n.index(p[0])+1
n.remove(p[0])
k=n.index(p[1])+2
if k!=j+1:
print(k,j)
else:
print(j,k)
|
Title: Reconnaissance 2
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output Specification:
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
Demo Input:
['5\n10 12 13 15 10\n', '4\n10 20 30 40\n']
Demo Output:
['5 1\n', '1 2\n']
Note:
none
|
```python
a=int(input())
n=list(map(int,input().strip().split()))[:a]
p=sorted(n)
print(p)
j=n.index(p[0])+1
n.remove(p[0])
k=n.index(p[1])+2
if k!=j+1:
print(k,j)
else:
print(j,k)
```
| 0
|
339
|
A
|
Helpful Maths
|
PROGRAMMING
| 800
|
[
"greedy",
"implementation",
"sortings",
"strings"
] | null | null |
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
|
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
|
Print the new sum that Xenia can count.
|
[
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] |
[
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] |
none
| 500
|
[
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,695,909,365
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 21
| 92
| 0
|
s = input().split("+")
s.sort()
result = ""
for i in s:
result = result + i + "+"
print(result[:-1])
|
Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none
|
```python
s = input().split("+")
s.sort()
result = ""
for i in s:
result = result + i + "+"
print(result[:-1])
```
| 3
|
|
69
|
A
|
Young Physicist
|
PROGRAMMING
| 1,000
|
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500
|
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,641,793,811
| 2,147,483,647
|
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0
| 92
| 0
|
n=int(input())
sum[0,0,0]
for i in range(n):
f=list(map(int,input().split()))
sum[0]=sum[0]+f[0]
sum[1]=sum[1]+f[1]
sum[2]=sum[2]+f[2]
if sum==[0,0,0]:
print('YES')
else:
print('NO')
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
n=int(input())
sum[0,0,0]
for i in range(n):
f=list(map(int,input().split()))
sum[0]=sum[0]+f[0]
sum[1]=sum[1]+f[1]
sum[2]=sum[2]+f[2]
if sum==[0,0,0]:
print('YES')
else:
print('NO')
```
| -1
|
263
|
A
|
Beautiful Matrix
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
|
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
|
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
|
[
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] |
[
"3\n",
"1\n"
] |
none
| 500
|
[
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,696,234,157
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
# -*- coding: utf-8 -*-
"""
Created on Mon Oct 2 15:52:51 2023
@author: masiyu004
"""
x=[]
for i in range(5):
row=list(map(int,input().split()))
x.append(row)
for i in range(5):
for j in range(5):
if x[i][j]==1:
r=int(i)
c=int(j)
r=3-r
c=3-c
if r<0:
r=-r
if c<0:
c=-c
print(r+c)
|
Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
# -*- coding: utf-8 -*-
"""
Created on Mon Oct 2 15:52:51 2023
@author: masiyu004
"""
x=[]
for i in range(5):
row=list(map(int,input().split()))
x.append(row)
for i in range(5):
for j in range(5):
if x[i][j]==1:
r=int(i)
c=int(j)
r=3-r
c=3-c
if r<0:
r=-r
if c<0:
c=-c
print(r+c)
```
| 0
|
|
596
|
A
|
Wilbur and Swimming Pool
|
PROGRAMMING
| 1,100
|
[
"geometry",
"implementation"
] | null | null |
After making bad dives into swimming pools, Wilbur wants to build a swimming pool in the shape of a rectangle in his backyard. He has set up coordinate axes, and he wants the sides of the rectangle to be parallel to them. Of course, the area of the rectangle must be positive. Wilbur had all four vertices of the planned pool written on a paper, until his friend came along and erased some of the vertices.
Now Wilbur is wondering, if the remaining *n* vertices of the initial rectangle give enough information to restore the area of the planned swimming pool.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=4) — the number of vertices that were not erased by Wilbur's friend.
Each of the following *n* lines contains two integers *x**i* and *y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000) —the coordinates of the *i*-th vertex that remains. Vertices are given in an arbitrary order.
It's guaranteed that these points are distinct vertices of some rectangle, that has positive area and which sides are parallel to the coordinate axes.
|
Print the area of the initial rectangle if it could be uniquely determined by the points remaining. Otherwise, print <=-<=1.
|
[
"2\n0 0\n1 1\n",
"1\n1 1\n"
] |
[
"1\n",
"-1\n"
] |
In the first sample, two opposite corners of the initial rectangle are given, and that gives enough information to say that the rectangle is actually a unit square.
In the second sample there is only one vertex left and this is definitely not enough to uniquely define the area.
| 500
|
[
{
"input": "2\n0 0\n1 1",
"output": "1"
},
{
"input": "1\n1 1",
"output": "-1"
},
{
"input": "1\n-188 17",
"output": "-1"
},
{
"input": "1\n71 -740",
"output": "-1"
},
{
"input": "4\n-56 -858\n-56 -174\n778 -858\n778 -174",
"output": "570456"
},
{
"input": "2\n14 153\n566 -13",
"output": "91632"
},
{
"input": "2\n-559 894\n314 127",
"output": "669591"
},
{
"input": "1\n-227 -825",
"output": "-1"
},
{
"input": "2\n-187 583\n25 13",
"output": "120840"
},
{
"input": "2\n-337 451\n32 -395",
"output": "312174"
},
{
"input": "4\n-64 -509\n-64 960\n634 -509\n634 960",
"output": "1025362"
},
{
"input": "2\n-922 -505\n712 -683",
"output": "290852"
},
{
"input": "2\n-1000 -1000\n-1000 0",
"output": "-1"
},
{
"input": "2\n-1000 -1000\n0 -1000",
"output": "-1"
},
{
"input": "4\n-414 -891\n-414 896\n346 -891\n346 896",
"output": "1358120"
},
{
"input": "2\n56 31\n704 -121",
"output": "98496"
},
{
"input": "4\n-152 198\n-152 366\n458 198\n458 366",
"output": "102480"
},
{
"input": "3\n-890 778\n-418 296\n-890 296",
"output": "227504"
},
{
"input": "4\n852 -184\n852 724\n970 -184\n970 724",
"output": "107144"
},
{
"input": "1\n858 -279",
"output": "-1"
},
{
"input": "2\n-823 358\n446 358",
"output": "-1"
},
{
"input": "2\n-739 -724\n-739 443",
"output": "-1"
},
{
"input": "2\n686 664\n686 -590",
"output": "-1"
},
{
"input": "3\n-679 301\n240 -23\n-679 -23",
"output": "297756"
},
{
"input": "2\n-259 -978\n978 -978",
"output": "-1"
},
{
"input": "1\n627 -250",
"output": "-1"
},
{
"input": "3\n-281 598\n679 -990\n-281 -990",
"output": "1524480"
},
{
"input": "2\n-414 -431\n-377 -688",
"output": "9509"
},
{
"input": "3\n-406 566\n428 426\n-406 426",
"output": "116760"
},
{
"input": "3\n-686 695\n-547 308\n-686 308",
"output": "53793"
},
{
"input": "1\n-164 -730",
"output": "-1"
},
{
"input": "2\n980 -230\n980 592",
"output": "-1"
},
{
"input": "4\n-925 306\n-925 602\n398 306\n398 602",
"output": "391608"
},
{
"input": "3\n576 -659\n917 -739\n576 -739",
"output": "27280"
},
{
"input": "1\n720 -200",
"output": "-1"
},
{
"input": "4\n-796 -330\n-796 758\n171 -330\n171 758",
"output": "1052096"
},
{
"input": "2\n541 611\n-26 611",
"output": "-1"
},
{
"input": "3\n-487 838\n134 691\n-487 691",
"output": "91287"
},
{
"input": "2\n-862 -181\n-525 -181",
"output": "-1"
},
{
"input": "1\n-717 916",
"output": "-1"
},
{
"input": "1\n-841 -121",
"output": "-1"
},
{
"input": "4\n259 153\n259 999\n266 153\n266 999",
"output": "5922"
},
{
"input": "2\n295 710\n295 254",
"output": "-1"
},
{
"input": "4\n137 -184\n137 700\n712 -184\n712 700",
"output": "508300"
},
{
"input": "2\n157 994\n377 136",
"output": "188760"
},
{
"input": "1\n193 304",
"output": "-1"
},
{
"input": "4\n5 -952\n5 292\n553 -952\n553 292",
"output": "681712"
},
{
"input": "2\n-748 697\n671 575",
"output": "173118"
},
{
"input": "2\n-457 82\n260 -662",
"output": "533448"
},
{
"input": "2\n-761 907\n967 907",
"output": "-1"
},
{
"input": "3\n-639 51\n-321 -539\n-639 -539",
"output": "187620"
},
{
"input": "2\n-480 51\n89 -763",
"output": "463166"
},
{
"input": "4\n459 -440\n459 -94\n872 -440\n872 -94",
"output": "142898"
},
{
"input": "2\n380 -849\n68 -849",
"output": "-1"
},
{
"input": "2\n-257 715\n102 715",
"output": "-1"
},
{
"input": "2\n247 -457\n434 -921",
"output": "86768"
},
{
"input": "4\n-474 -894\n-474 -833\n-446 -894\n-446 -833",
"output": "1708"
},
{
"input": "3\n-318 831\n450 31\n-318 31",
"output": "614400"
},
{
"input": "3\n-282 584\n696 488\n-282 488",
"output": "93888"
},
{
"input": "3\n258 937\n395 856\n258 856",
"output": "11097"
},
{
"input": "1\n-271 -499",
"output": "-1"
},
{
"input": "2\n-612 208\n326 -559",
"output": "719446"
},
{
"input": "2\n115 730\n562 -546",
"output": "570372"
},
{
"input": "2\n-386 95\n-386 750",
"output": "-1"
},
{
"input": "3\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "3\n0 4\n3 4\n3 1",
"output": "9"
},
{
"input": "3\n1 1\n1 2\n2 1",
"output": "1"
},
{
"input": "3\n1 4\n4 4\n4 1",
"output": "9"
},
{
"input": "3\n1 1\n2 1\n1 2",
"output": "1"
},
{
"input": "3\n0 0\n1 0\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 5\n5 0",
"output": "25"
},
{
"input": "3\n0 0\n0 1\n1 1",
"output": "1"
},
{
"input": "4\n0 0\n1 0\n1 1\n0 1",
"output": "1"
},
{
"input": "3\n4 4\n1 4\n4 1",
"output": "9"
},
{
"input": "3\n0 0\n2 0\n2 1",
"output": "2"
},
{
"input": "3\n0 0\n2 0\n0 2",
"output": "4"
},
{
"input": "3\n0 0\n0 1\n5 0",
"output": "5"
},
{
"input": "3\n1 1\n1 3\n3 1",
"output": "4"
},
{
"input": "4\n0 0\n1 0\n0 1\n1 1",
"output": "1"
},
{
"input": "2\n1 0\n2 1",
"output": "1"
},
{
"input": "3\n0 0\n1 0\n0 1",
"output": "1"
},
{
"input": "3\n1 0\n0 0\n0 1",
"output": "1"
},
{
"input": "3\n0 0\n0 5\n5 5",
"output": "25"
},
{
"input": "3\n1 0\n5 0\n5 10",
"output": "40"
},
{
"input": "3\n0 0\n1 0\n1 2",
"output": "2"
},
{
"input": "4\n0 1\n0 0\n1 0\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n2 0\n0 1",
"output": "2"
},
{
"input": "3\n-2 -1\n-1 -1\n-1 -2",
"output": "1"
},
{
"input": "2\n1 0\n0 1",
"output": "1"
},
{
"input": "4\n1 1\n3 3\n3 1\n1 3",
"output": "4"
},
{
"input": "3\n2 1\n1 2\n2 2",
"output": "1"
},
{
"input": "3\n0 0\n0 3\n3 0",
"output": "9"
},
{
"input": "2\n0 3\n3 3",
"output": "-1"
},
{
"input": "4\n2 0\n2 8\n5 8\n5 0",
"output": "24"
},
{
"input": "2\n0 999\n100 250",
"output": "74900"
},
{
"input": "3\n1 1\n1 5\n5 1",
"output": "16"
},
{
"input": "3\n0 1\n0 0\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n10 0\n0 10",
"output": "100"
},
{
"input": "2\n0 0\n-1 -1",
"output": "1"
},
{
"input": "3\n1 5\n2 2\n2 5",
"output": "3"
},
{
"input": "3\n0 0\n0 1\n2 0",
"output": "2"
},
{
"input": "3\n0 1\n1 0\n0 0",
"output": "1"
},
{
"input": "3\n0 0\n0 -1\n1 -1",
"output": "1"
},
{
"input": "3\n0 1\n1 0\n1 1",
"output": "1"
},
{
"input": "3\n3 5\n3 2\n7 2",
"output": "12"
},
{
"input": "3\n1 2\n1 3\n2 2",
"output": "1"
},
{
"input": "3\n5 0\n0 0\n0 5",
"output": "25"
},
{
"input": "3\n1 0\n1 3\n5 0",
"output": "12"
},
{
"input": "3\n0 0\n0 2\n2 0",
"output": "4"
},
{
"input": "3\n1 1\n0 0\n1 0",
"output": "1"
},
{
"input": "3\n1 2\n1 3\n2 3",
"output": "1"
},
{
"input": "4\n0 0\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "2\n-3 0\n3 3",
"output": "18"
},
{
"input": "3\n1 1\n0 1\n1 0",
"output": "1"
},
{
"input": "3\n0 0\n5 0\n5 5",
"output": "25"
},
{
"input": "3\n79 79\n79 158\n158 79",
"output": "6241"
},
{
"input": "3\n1 0\n1 -1\n0 0",
"output": "1"
},
{
"input": "3\n1 1\n1 2\n2 2",
"output": "1"
},
{
"input": "3\n0 1\n0 0\n1 0",
"output": "1"
},
{
"input": "3\n2 1\n2 4\n6 1",
"output": "12"
},
{
"input": "3\n5 0\n0 0\n5 5",
"output": "25"
}
] | 1,532,081,563
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 13
| 139
| 0
|
n=int(input())
sx=set();sy=set()
for i in range(n):
x,y=list(map(int,input().split()))
sx.add(x)
sy.add(y)
if len(sx)==2:
xt=max(sx)-min(sx)
yt=max(sy)-min(sy)
print(xt*yt)
else:
print(-1)
|
Title: Wilbur and Swimming Pool
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After making bad dives into swimming pools, Wilbur wants to build a swimming pool in the shape of a rectangle in his backyard. He has set up coordinate axes, and he wants the sides of the rectangle to be parallel to them. Of course, the area of the rectangle must be positive. Wilbur had all four vertices of the planned pool written on a paper, until his friend came along and erased some of the vertices.
Now Wilbur is wondering, if the remaining *n* vertices of the initial rectangle give enough information to restore the area of the planned swimming pool.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=4) — the number of vertices that were not erased by Wilbur's friend.
Each of the following *n* lines contains two integers *x**i* and *y**i* (<=-<=1000<=≤<=*x**i*,<=*y**i*<=≤<=1000) —the coordinates of the *i*-th vertex that remains. Vertices are given in an arbitrary order.
It's guaranteed that these points are distinct vertices of some rectangle, that has positive area and which sides are parallel to the coordinate axes.
Output Specification:
Print the area of the initial rectangle if it could be uniquely determined by the points remaining. Otherwise, print <=-<=1.
Demo Input:
['2\n0 0\n1 1\n', '1\n1 1\n']
Demo Output:
['1\n', '-1\n']
Note:
In the first sample, two opposite corners of the initial rectangle are given, and that gives enough information to say that the rectangle is actually a unit square.
In the second sample there is only one vertex left and this is definitely not enough to uniquely define the area.
|
```python
n=int(input())
sx=set();sy=set()
for i in range(n):
x,y=list(map(int,input().split()))
sx.add(x)
sy.add(y)
if len(sx)==2:
xt=max(sx)-min(sx)
yt=max(sy)-min(sy)
print(xt*yt)
else:
print(-1)
```
| 0
|
|
9
|
A
|
Die Roll
|
PROGRAMMING
| 800
|
[
"math",
"probabilities"
] |
A. Die Roll
|
1
|
64
|
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
|
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
|
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
|
[
"4 2\n"
] |
[
"1/2\n"
] |
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
| 0
|
[
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,605,376,060
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 36
| 186
| 0
|
import math
y, w = map(int, input().split())
c = 7 - max(y, w)
g = math.gcd(c, 6)
print(f'{c//g}/{6//g}')
|
Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points.
|
```python
import math
y, w = map(int, input().split())
c = 7 - max(y, w)
g = math.gcd(c, 6)
print(f'{c//g}/{6//g}')
```
| 3.907
|
215
|
A
|
Bicycle Chain
|
PROGRAMMING
| 900
|
[
"brute force",
"implementation"
] | null | null |
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
|
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
|
[
"2\n4 5\n3\n12 13 15\n",
"4\n1 2 3 4\n5\n10 11 12 13 14\n"
] |
[
"2\n",
"1\n"
] |
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
| 500
|
[
{
"input": "2\n4 5\n3\n12 13 15",
"output": "2"
},
{
"input": "4\n1 2 3 4\n5\n10 11 12 13 14",
"output": "1"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 2\n1\n1",
"output": "1"
},
{
"input": "1\n1\n2\n1 2",
"output": "1"
},
{
"input": "4\n3 7 11 13\n4\n51 119 187 221",
"output": "4"
},
{
"input": "4\n2 3 4 5\n3\n1 2 3",
"output": "2"
},
{
"input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97",
"output": "1"
},
{
"input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28",
"output": "1"
},
{
"input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958",
"output": "1"
},
{
"input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20",
"output": "1"
},
{
"input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50",
"output": "1"
},
{
"input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38",
"output": "4"
},
{
"input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100",
"output": "1"
},
{
"input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149",
"output": "1"
},
{
"input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193",
"output": "1"
},
{
"input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245",
"output": "1"
},
{
"input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298",
"output": "1"
},
{
"input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350",
"output": "1"
},
{
"input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388",
"output": "1"
},
{
"input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999",
"output": "8"
},
{
"input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813",
"output": "3"
},
{
"input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217",
"output": "3"
},
{
"input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555",
"output": "8"
},
{
"input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345",
"output": "20"
},
{
"input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735",
"output": "23"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968",
"output": "12"
},
{
"input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706",
"output": "1"
},
{
"input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394",
"output": "1"
},
{
"input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284",
"output": "1"
},
{
"input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790",
"output": "4"
},
{
"input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902",
"output": "17"
},
{
"input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991",
"output": "28"
},
{
"input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862",
"output": "15"
},
{
"input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691",
"output": "8"
},
{
"input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673",
"output": "38"
},
{
"input": "3\n3 4 5\n3\n6 20 25",
"output": "2"
},
{
"input": "4\n2 3 5 8\n4\n2 6 8 10",
"output": "1"
},
{
"input": "4\n3 5 7 11\n4\n3 5 7 22",
"output": "1"
},
{
"input": "2\n2 3\n3\n20 30 50",
"output": "1"
},
{
"input": "3\n1 2 3\n4\n2 4 6 49",
"output": "1"
},
{
"input": "2\n4 5\n3\n12 15 20",
"output": "1"
},
{
"input": "3\n2 5 7\n3\n4 5 7",
"output": "1"
},
{
"input": "3\n3 5 8\n3\n6 8 10",
"output": "2"
},
{
"input": "2\n2 3\n4\n4 6 9 33",
"output": "1"
},
{
"input": "2\n2 3\n4\n4 6 21 40",
"output": "1"
},
{
"input": "3\n4 9 10\n3\n8 9 10",
"output": "1"
},
{
"input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000",
"output": "1"
},
{
"input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14",
"output": "1"
}
] | 1,598,259,500
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 186
| 6,963,200
|
N=int(input())
A=list(map(int,input().split()))
M=int(input())
B=list(map(int,input().split()))
ans=0
for i in range(N):
for j in range(M):
if B[j]%A[i]:
temp=B[j]//A[i]
ans=max(ans,temp)
count=0
#print(ans)
for i in range(N):
for j in range(M):
if B[j]/A[i]==ans:
count+=1
# print(B[j],A[i])
print(count)
|
Title: Bicycle Chain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Output Specification:
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
Demo Input:
['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
|
```python
N=int(input())
A=list(map(int,input().split()))
M=int(input())
B=list(map(int,input().split()))
ans=0
for i in range(N):
for j in range(M):
if B[j]%A[i]:
temp=B[j]//A[i]
ans=max(ans,temp)
count=0
#print(ans)
for i in range(N):
for j in range(M):
if B[j]/A[i]==ans:
count+=1
# print(B[j],A[i])
print(count)
```
| 0
|
|
459
|
B
|
Pashmak and Flowers
|
PROGRAMMING
| 1,300
|
[
"combinatorics",
"implementation",
"sortings"
] | null | null |
Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way.
|
The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109).
|
The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively.
|
[
"2\n1 2\n",
"3\n1 4 5\n",
"5\n3 1 2 3 1\n"
] |
[
"1 1",
"4 1",
"2 4"
] |
In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers.
| 500
|
[
{
"input": "2\n1 2",
"output": "1 1"
},
{
"input": "3\n1 4 5",
"output": "4 1"
},
{
"input": "5\n3 1 2 3 1",
"output": "2 4"
},
{
"input": "2\n1 1",
"output": "0 1"
},
{
"input": "3\n1 1 1",
"output": "0 3"
},
{
"input": "4\n1 1 1 1",
"output": "0 6"
},
{
"input": "5\n1 1 1 1 1",
"output": "0 10"
},
{
"input": "5\n2 2 2 2 2",
"output": "0 10"
},
{
"input": "10\n2 2 2 2 2 2 2 2 2 2",
"output": "0 45"
},
{
"input": "3\n2 2 2",
"output": "0 3"
},
{
"input": "3\n3 3 3",
"output": "0 3"
},
{
"input": "2\n10000000 100000000",
"output": "90000000 1"
},
{
"input": "5\n5 5 5 5 5",
"output": "0 10"
},
{
"input": "5\n3 3 3 3 3",
"output": "0 10"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "0 15"
},
{
"input": "2\n5 6",
"output": "1 1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "0 45"
},
{
"input": "10\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "0 45"
},
{
"input": "4\n4 4 4 4",
"output": "0 6"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "0 21"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 1 1",
"output": "0 55"
},
{
"input": "8\n8 8 8 8 8 8 8 8",
"output": "0 28"
},
{
"input": "2\n3 2",
"output": "1 1"
}
] | 1,684,229,743
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 58
| 124
| 28,672,000
|
import math
n = int(input())
a = list(map(int,input().split()))
if n==2:
print(max(a[0],a[1])-min(a[0],a[1]),1)
else:
mn,mx= min(a),max(a)
xc,mc=a.count(mx),a.count(mn)
if xc==mc and mn==mx:
print(mx-mn,math.comb(xc,2))
else:
print(mx-mn,mc*xc)
|
Title: Pashmak and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pashmak decided to give Parmida a pair of flowers from the garden. There are *n* flowers in the garden and the *i*-th of them has a beauty number *b**i*. Parmida is a very strange girl so she doesn't want to have the two most beautiful flowers necessarily. She wants to have those pairs of flowers that their beauty difference is maximal possible!
Your task is to write a program which calculates two things:
1. The maximum beauty difference of flowers that Pashmak can give to Parmida. 1. The number of ways that Pashmak can pick the flowers. Two ways are considered different if and only if there is at least one flower that is chosen in the first way and not chosen in the second way.
Input Specification:
The first line of the input contains *n* (2<=≤<=*n*<=≤<=2·105). In the next line there are *n* space-separated integers *b*1, *b*2, ..., *b**n* (1<=≤<=*b**i*<=≤<=109).
Output Specification:
The only line of output should contain two integers. The maximum beauty difference and the number of ways this may happen, respectively.
Demo Input:
['2\n1 2\n', '3\n1 4 5\n', '5\n3 1 2 3 1\n']
Demo Output:
['1 1', '4 1', '2 4']
Note:
In the third sample the maximum beauty difference is 2 and there are 4 ways to do this:
1. choosing the first and the second flowers; 1. choosing the first and the fifth flowers; 1. choosing the fourth and the second flowers; 1. choosing the fourth and the fifth flowers.
|
```python
import math
n = int(input())
a = list(map(int,input().split()))
if n==2:
print(max(a[0],a[1])-min(a[0],a[1]),1)
else:
mn,mx= min(a),max(a)
xc,mc=a.count(mx),a.count(mn)
if xc==mc and mn==mx:
print(mx-mn,math.comb(xc,2))
else:
print(mx-mn,mc*xc)
```
| 3
|
|
616
|
B
|
Dinner with Emma
|
PROGRAMMING
| 1,000
|
[
"games",
"greedy"
] | null | null |
Jack decides to invite Emma out for a dinner. Jack is a modest student, he doesn't want to go to an expensive restaurant. Emma is a girl with high taste, she prefers elite places.
Munhattan consists of *n* streets and *m* avenues. There is exactly one restaurant on the intersection of each street and avenue. The streets are numbered with integers from 1 to *n* and the avenues are numbered with integers from 1 to *m*. The cost of dinner in the restaurant at the intersection of the *i*-th street and the *j*-th avenue is *c**ij*.
Jack and Emma decide to choose the restaurant in the following way. Firstly Emma chooses the street to dinner and then Jack chooses the avenue. Emma and Jack makes their choice optimally: Emma wants to maximize the cost of the dinner, Jack wants to minimize it. Emma takes into account that Jack wants to minimize the cost of the dinner. Find the cost of the dinner for the couple in love.
|
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of streets and avenues in Munhattan.
Each of the next *n* lines contains *m* integers *c**ij* (1<=≤<=*c**ij*<=≤<=109) — the cost of the dinner in the restaurant on the intersection of the *i*-th street and the *j*-th avenue.
|
Print the only integer *a* — the cost of the dinner for Jack and Emma.
|
[
"3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1\n",
"3 3\n1 2 3\n2 3 1\n3 1 2\n"
] |
[
"2\n",
"1\n"
] |
In the first example if Emma chooses the first or the third streets Jack can choose an avenue with the cost of the dinner 1. So she chooses the second street and Jack chooses any avenue. The cost of the dinner is 2.
In the second example regardless of Emma's choice Jack can choose a restaurant with the cost of the dinner 1.
| 0
|
[
{
"input": "3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1",
"output": "2"
},
{
"input": "3 3\n1 2 3\n2 3 1\n3 1 2",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 10\n74 35 82 39 1 84 29 41 70 12",
"output": "1"
},
{
"input": "10 1\n44\n23\n65\n17\n48\n29\n49\n88\n91\n85",
"output": "91"
},
{
"input": "10 10\n256 72 455 45 912 506 235 68 951 92\n246 305 45 212 788 621 449 876 459 899\n732 107 230 357 370 610 997 669 61 192\n131 93 481 527 983 920 825 540 435 54\n777 682 984 20 337 480 264 137 249 502\n51 467 479 228 923 752 714 436 199 973\n3 91 612 571 631 212 751 84 886 948\n252 130 583 23 194 985 234 978 709 16\n636 991 203 469 719 540 184 902 503 652\n826 680 150 284 37 987 360 183 447 51",
"output": "184"
},
{
"input": "1 1\n1000000000",
"output": "1000000000"
},
{
"input": "2 1\n999999999\n1000000000",
"output": "1000000000"
}
] | 1,685,179,620
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 16
| 31
| 102,400
|
n,m = map(int,input().split())
mn = []
for i in range(n):
mn.append(min(list(map(int,input().split()))))
print(max(mn))
|
Title: Dinner with Emma
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jack decides to invite Emma out for a dinner. Jack is a modest student, he doesn't want to go to an expensive restaurant. Emma is a girl with high taste, she prefers elite places.
Munhattan consists of *n* streets and *m* avenues. There is exactly one restaurant on the intersection of each street and avenue. The streets are numbered with integers from 1 to *n* and the avenues are numbered with integers from 1 to *m*. The cost of dinner in the restaurant at the intersection of the *i*-th street and the *j*-th avenue is *c**ij*.
Jack and Emma decide to choose the restaurant in the following way. Firstly Emma chooses the street to dinner and then Jack chooses the avenue. Emma and Jack makes their choice optimally: Emma wants to maximize the cost of the dinner, Jack wants to minimize it. Emma takes into account that Jack wants to minimize the cost of the dinner. Find the cost of the dinner for the couple in love.
Input Specification:
The first line contains two integers *n*,<=*m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of streets and avenues in Munhattan.
Each of the next *n* lines contains *m* integers *c**ij* (1<=≤<=*c**ij*<=≤<=109) — the cost of the dinner in the restaurant on the intersection of the *i*-th street and the *j*-th avenue.
Output Specification:
Print the only integer *a* — the cost of the dinner for Jack and Emma.
Demo Input:
['3 4\n4 1 3 5\n2 2 2 2\n5 4 5 1\n', '3 3\n1 2 3\n2 3 1\n3 1 2\n']
Demo Output:
['2\n', '1\n']
Note:
In the first example if Emma chooses the first or the third streets Jack can choose an avenue with the cost of the dinner 1. So she chooses the second street and Jack chooses any avenue. The cost of the dinner is 2.
In the second example regardless of Emma's choice Jack can choose a restaurant with the cost of the dinner 1.
|
```python
n,m = map(int,input().split())
mn = []
for i in range(n):
mn.append(min(list(map(int,input().split()))))
print(max(mn))
```
| 3
|
|
981
|
G
|
Magic multisets
|
PROGRAMMING
| 2,500
|
[
"data structures"
] | null | null |
In the School of Magic in Dirtpolis a lot of interesting objects are studied on Computer Science lessons.
Consider, for example, the magic multiset. If you try to add an integer to it that is already presented in the multiset, each element in the multiset duplicates. For example, if you try to add the integer $2$ to the multiset $\{1, 2, 3, 3\}$, you will get $\{1, 1, 2, 2, 3, 3, 3, 3\}$.
If you try to add an integer that is not presented in the multiset, it is simply added to it. For example, if you try to add the integer $4$ to the multiset $\{1, 2, 3, 3\}$, you will get $\{1, 2, 3, 3, 4\}$.
Also consider an array of $n$ initially empty magic multisets, enumerated from $1$ to $n$.
You are to answer $q$ queries of the form "add an integer $x$ to all multisets with indices $l, l + 1, \ldots, r$" and "compute the sum of sizes of multisets with indices $l, l + 1, \ldots, r$". The answers for the second type queries can be large, so print the answers modulo $998244353$.
|
The first line contains two integers $n$ and $q$ ($1 \leq n, q \leq 2 \cdot 10^{5}$) — the number of magic multisets in the array and the number of queries, respectively.
The next $q$ lines describe queries, one per line. Each line starts with an integer $t$ ($1 \leq t \leq 2$) — the type of the query. If $t$ equals $1$, it is followed by three integers $l$, $r$, $x$ ($1 \leq l \leq r \leq n$, $1 \leq x \leq n$) meaning that you should add $x$ to all multisets with indices from $l$ to $r$ inclusive. If $t$ equals $2$, it is followed by two integers $l$, $r$ ($1 \leq l \leq r \leq n$) meaning that you should compute the sum of sizes of all multisets with indices from $l$ to $r$ inclusive.
|
For each query of the second type print the sum of sizes of multisets on the given segment.
The answers can be large, so print them modulo $998244353$.
|
[
"4 4\n1 1 2 1\n1 1 2 2\n1 1 4 1\n2 1 4\n",
"3 7\n1 1 1 3\n1 1 1 3\n1 1 1 2\n1 1 1 1\n2 1 1\n1 1 1 2\n2 1 1\n"
] |
[
"10\n",
"4\n8\n"
] |
In the first example after the first two queries the multisets are equal to $[\{1, 2\},\{1, 2\},\{\},\{\}]$, after the third query they are equal to $[\{1, 1, 2, 2\},\{1, 1, 2, 2\},\{1\},\{1\}]$.
In the second example the first multiset evolves as follows:
$\{\} \to \{3\} \to \{3, 3\} \to \{2, 3, 3\} \to \{1, 2, 3, 3\} \to \{1, 1, 2, 2, 3, 3, 3, 3\}$.
| 3,250
|
[] | 1,527,436,933
| 4,333
|
Python 3
|
MEMORY_LIMIT_EXCEEDED
|
PRETESTS
| 2
| 436
| 268,390,400
|
# -*- coding: utf - 8 -*-
"""""""""""""""""""""""""""""""""""""""""""""
| author: mr.math - Hakimov Rahimjon |
| e-mail: [email protected] |
| created: 27.05.2018 20:50 |
"""""""""""""""""""""""""""""""""""""""""""""
# inp = open("input.txt", "r"); input = inp.readline; out = open("output.txt", "w"); print = out.write
TN = 1
# ===========================================
def add(ls_t, obj):
if obj in ls_t:
ls_t += ls_t
else:
ls_t += [obj]
return ls_t
# ===========================================
def solution():
n, q = map(int, input().split())
lst = [[] for i in range(n+1)]
for i in range(q):
l = list(map(int, input().split()))
if l[0] == 1:
for j in range(l[1]-1, l[2]):
add(lst[j], l[3])
else:
ans = 0
for j in range(l[1]-1, l[2]):
ans += len(lst[j])
print(ans % 998244353)
# ===========================================
while TN != 0:
solution()
TN -= 1
# ===========================================
# inp.close()
# out.close()
|
Title: Magic multisets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the School of Magic in Dirtpolis a lot of interesting objects are studied on Computer Science lessons.
Consider, for example, the magic multiset. If you try to add an integer to it that is already presented in the multiset, each element in the multiset duplicates. For example, if you try to add the integer $2$ to the multiset $\{1, 2, 3, 3\}$, you will get $\{1, 1, 2, 2, 3, 3, 3, 3\}$.
If you try to add an integer that is not presented in the multiset, it is simply added to it. For example, if you try to add the integer $4$ to the multiset $\{1, 2, 3, 3\}$, you will get $\{1, 2, 3, 3, 4\}$.
Also consider an array of $n$ initially empty magic multisets, enumerated from $1$ to $n$.
You are to answer $q$ queries of the form "add an integer $x$ to all multisets with indices $l, l + 1, \ldots, r$" and "compute the sum of sizes of multisets with indices $l, l + 1, \ldots, r$". The answers for the second type queries can be large, so print the answers modulo $998244353$.
Input Specification:
The first line contains two integers $n$ and $q$ ($1 \leq n, q \leq 2 \cdot 10^{5}$) — the number of magic multisets in the array and the number of queries, respectively.
The next $q$ lines describe queries, one per line. Each line starts with an integer $t$ ($1 \leq t \leq 2$) — the type of the query. If $t$ equals $1$, it is followed by three integers $l$, $r$, $x$ ($1 \leq l \leq r \leq n$, $1 \leq x \leq n$) meaning that you should add $x$ to all multisets with indices from $l$ to $r$ inclusive. If $t$ equals $2$, it is followed by two integers $l$, $r$ ($1 \leq l \leq r \leq n$) meaning that you should compute the sum of sizes of all multisets with indices from $l$ to $r$ inclusive.
Output Specification:
For each query of the second type print the sum of sizes of multisets on the given segment.
The answers can be large, so print them modulo $998244353$.
Demo Input:
['4 4\n1 1 2 1\n1 1 2 2\n1 1 4 1\n2 1 4\n', '3 7\n1 1 1 3\n1 1 1 3\n1 1 1 2\n1 1 1 1\n2 1 1\n1 1 1 2\n2 1 1\n']
Demo Output:
['10\n', '4\n8\n']
Note:
In the first example after the first two queries the multisets are equal to $[\{1, 2\},\{1, 2\},\{\},\{\}]$, after the third query they are equal to $[\{1, 1, 2, 2\},\{1, 1, 2, 2\},\{1\},\{1\}]$.
In the second example the first multiset evolves as follows:
$\{\} \to \{3\} \to \{3, 3\} \to \{2, 3, 3\} \to \{1, 2, 3, 3\} \to \{1, 1, 2, 2, 3, 3, 3, 3\}$.
|
```python
# -*- coding: utf - 8 -*-
"""""""""""""""""""""""""""""""""""""""""""""
| author: mr.math - Hakimov Rahimjon |
| e-mail: [email protected] |
| created: 27.05.2018 20:50 |
"""""""""""""""""""""""""""""""""""""""""""""
# inp = open("input.txt", "r"); input = inp.readline; out = open("output.txt", "w"); print = out.write
TN = 1
# ===========================================
def add(ls_t, obj):
if obj in ls_t:
ls_t += ls_t
else:
ls_t += [obj]
return ls_t
# ===========================================
def solution():
n, q = map(int, input().split())
lst = [[] for i in range(n+1)]
for i in range(q):
l = list(map(int, input().split()))
if l[0] == 1:
for j in range(l[1]-1, l[2]):
add(lst[j], l[3])
else:
ans = 0
for j in range(l[1]-1, l[2]):
ans += len(lst[j])
print(ans % 998244353)
# ===========================================
while TN != 0:
solution()
TN -= 1
# ===========================================
# inp.close()
# out.close()
```
| 0
|
|
746
|
A
|
Compote
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Nikolay has *a* lemons, *b* apples and *c* pears. He decided to cook a compote. According to the recipe the fruits should be in the ratio 1:<=2:<=4. It means that for each lemon in the compote should be exactly 2 apples and exactly 4 pears. You can't crumble up, break up or cut these fruits into pieces. These fruits — lemons, apples and pears — should be put in the compote as whole fruits.
Your task is to determine the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. It is possible that Nikolay can't use any fruits, in this case print 0.
|
The first line contains the positive integer *a* (1<=≤<=*a*<=≤<=1000) — the number of lemons Nikolay has.
The second line contains the positive integer *b* (1<=≤<=*b*<=≤<=1000) — the number of apples Nikolay has.
The third line contains the positive integer *c* (1<=≤<=*c*<=≤<=1000) — the number of pears Nikolay has.
|
Print the maximum total number of lemons, apples and pears from which Nikolay can cook the compote.
|
[
"2\n5\n7\n",
"4\n7\n13\n",
"2\n3\n2\n"
] |
[
"7\n",
"21\n",
"0\n"
] |
In the first example Nikolay can use 1 lemon, 2 apples and 4 pears, so the answer is 1 + 2 + 4 = 7.
In the second example Nikolay can use 3 lemons, 6 apples and 12 pears, so the answer is 3 + 6 + 12 = 21.
In the third example Nikolay don't have enough pears to cook any compote, so the answer is 0.
| 500
|
[
{
"input": "2\n5\n7",
"output": "7"
},
{
"input": "4\n7\n13",
"output": "21"
},
{
"input": "2\n3\n2",
"output": "0"
},
{
"input": "1\n1\n1",
"output": "0"
},
{
"input": "1\n2\n4",
"output": "7"
},
{
"input": "1000\n1000\n1000",
"output": "1750"
},
{
"input": "1\n1\n4",
"output": "0"
},
{
"input": "1\n2\n3",
"output": "0"
},
{
"input": "1\n1000\n1000",
"output": "7"
},
{
"input": "1000\n1\n1000",
"output": "0"
},
{
"input": "1000\n2\n1000",
"output": "7"
},
{
"input": "1000\n500\n1000",
"output": "1750"
},
{
"input": "1000\n1000\n4",
"output": "7"
},
{
"input": "1000\n1000\n3",
"output": "0"
},
{
"input": "4\n8\n12",
"output": "21"
},
{
"input": "10\n20\n40",
"output": "70"
},
{
"input": "100\n200\n399",
"output": "693"
},
{
"input": "200\n400\n800",
"output": "1400"
},
{
"input": "199\n400\n800",
"output": "1393"
},
{
"input": "201\n400\n800",
"output": "1400"
},
{
"input": "200\n399\n800",
"output": "1393"
},
{
"input": "200\n401\n800",
"output": "1400"
},
{
"input": "200\n400\n799",
"output": "1393"
},
{
"input": "200\n400\n801",
"output": "1400"
},
{
"input": "139\n252\n871",
"output": "882"
},
{
"input": "109\n346\n811",
"output": "763"
},
{
"input": "237\n487\n517",
"output": "903"
},
{
"input": "161\n331\n725",
"output": "1127"
},
{
"input": "39\n471\n665",
"output": "273"
},
{
"input": "9\n270\n879",
"output": "63"
},
{
"input": "137\n422\n812",
"output": "959"
},
{
"input": "15\n313\n525",
"output": "105"
},
{
"input": "189\n407\n966",
"output": "1323"
},
{
"input": "18\n268\n538",
"output": "126"
},
{
"input": "146\n421\n978",
"output": "1022"
},
{
"input": "70\n311\n685",
"output": "490"
},
{
"input": "244\n405\n625",
"output": "1092"
},
{
"input": "168\n454\n832",
"output": "1176"
},
{
"input": "46\n344\n772",
"output": "322"
},
{
"input": "174\n438\n987",
"output": "1218"
},
{
"input": "144\n387\n693",
"output": "1008"
},
{
"input": "22\n481\n633",
"output": "154"
},
{
"input": "196\n280\n848",
"output": "980"
},
{
"input": "190\n454\n699",
"output": "1218"
},
{
"input": "231\n464\n928",
"output": "1617"
},
{
"input": "151\n308\n616",
"output": "1057"
},
{
"input": "88\n182\n364",
"output": "616"
},
{
"input": "12\n26\n52",
"output": "84"
},
{
"input": "204\n412\n824",
"output": "1428"
},
{
"input": "127\n256\n512",
"output": "889"
},
{
"input": "224\n446\n896",
"output": "1561"
},
{
"input": "146\n291\n584",
"output": "1015"
},
{
"input": "83\n164\n332",
"output": "574"
},
{
"input": "20\n38\n80",
"output": "133"
},
{
"input": "198\n393\n792",
"output": "1372"
},
{
"input": "120\n239\n480",
"output": "833"
},
{
"input": "208\n416\n831",
"output": "1449"
},
{
"input": "130\n260\n517",
"output": "903"
},
{
"input": "67\n134\n267",
"output": "462"
},
{
"input": "245\n490\n979",
"output": "1708"
},
{
"input": "182\n364\n727",
"output": "1267"
},
{
"input": "104\n208\n413",
"output": "721"
},
{
"input": "10\n2\n100",
"output": "7"
},
{
"input": "2\n100\n100",
"output": "14"
},
{
"input": "2\n3\n8",
"output": "7"
},
{
"input": "1\n2\n8",
"output": "7"
},
{
"input": "1\n2\n200",
"output": "7"
},
{
"input": "5\n4\n16",
"output": "14"
},
{
"input": "1\n10\n10",
"output": "7"
},
{
"input": "1\n4\n8",
"output": "7"
},
{
"input": "100\n4\n1000",
"output": "14"
},
{
"input": "2\n6\n12",
"output": "14"
},
{
"input": "10\n7\n4",
"output": "7"
},
{
"input": "2\n10\n100",
"output": "14"
},
{
"input": "2\n3\n4",
"output": "7"
},
{
"input": "1\n2\n999",
"output": "7"
},
{
"input": "1\n10\n20",
"output": "7"
},
{
"input": "100\n18\n20",
"output": "35"
},
{
"input": "100\n1\n100",
"output": "0"
},
{
"input": "3\n7\n80",
"output": "21"
},
{
"input": "2\n8\n24",
"output": "14"
},
{
"input": "1\n100\n100",
"output": "7"
},
{
"input": "2\n1\n8",
"output": "0"
},
{
"input": "10\n5\n23",
"output": "14"
}
] | 1,658,866,050
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 84
| 46
| 0
|
a = int(input())
b = int(input())
c = int(input())
least = [a, int(b / 2), int(c / 4)]
least.sort()
print(least[0] * 7)
|
Title: Compote
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nikolay has *a* lemons, *b* apples and *c* pears. He decided to cook a compote. According to the recipe the fruits should be in the ratio 1:<=2:<=4. It means that for each lemon in the compote should be exactly 2 apples and exactly 4 pears. You can't crumble up, break up or cut these fruits into pieces. These fruits — lemons, apples and pears — should be put in the compote as whole fruits.
Your task is to determine the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. It is possible that Nikolay can't use any fruits, in this case print 0.
Input Specification:
The first line contains the positive integer *a* (1<=≤<=*a*<=≤<=1000) — the number of lemons Nikolay has.
The second line contains the positive integer *b* (1<=≤<=*b*<=≤<=1000) — the number of apples Nikolay has.
The third line contains the positive integer *c* (1<=≤<=*c*<=≤<=1000) — the number of pears Nikolay has.
Output Specification:
Print the maximum total number of lemons, apples and pears from which Nikolay can cook the compote.
Demo Input:
['2\n5\n7\n', '4\n7\n13\n', '2\n3\n2\n']
Demo Output:
['7\n', '21\n', '0\n']
Note:
In the first example Nikolay can use 1 lemon, 2 apples and 4 pears, so the answer is 1 + 2 + 4 = 7.
In the second example Nikolay can use 3 lemons, 6 apples and 12 pears, so the answer is 3 + 6 + 12 = 21.
In the third example Nikolay don't have enough pears to cook any compote, so the answer is 0.
|
```python
a = int(input())
b = int(input())
c = int(input())
least = [a, int(b / 2), int(c / 4)]
least.sort()
print(least[0] * 7)
```
| 3
|
|
673
|
A
|
Bear and Game
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
|
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
|
Print the number of minutes Limak will watch the game.
|
[
"3\n7 20 88\n",
"9\n16 20 30 40 50 60 70 80 90\n",
"9\n15 20 30 40 50 60 70 80 90\n"
] |
[
"35\n",
"15\n",
"90\n"
] |
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
| 500
|
[
{
"input": "3\n7 20 88",
"output": "35"
},
{
"input": "9\n16 20 30 40 50 60 70 80 90",
"output": "15"
},
{
"input": "9\n15 20 30 40 50 60 70 80 90",
"output": "90"
},
{
"input": "30\n6 11 12 15 22 24 30 31 32 33 34 35 40 42 44 45 47 50 53 54 57 58 63 67 75 77 79 81 83 88",
"output": "90"
},
{
"input": "60\n1 2 4 5 6 7 11 14 16 18 20 21 22 23 24 25 26 33 34 35 36 37 38 39 41 42 43 44 46 47 48 49 52 55 56 57 58 59 60 61 63 64 65 67 68 70 71 72 73 74 75 77 78 80 82 83 84 85 86 88",
"output": "90"
},
{
"input": "90\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n1",
"output": "16"
},
{
"input": "5\n15 30 45 60 75",
"output": "90"
},
{
"input": "6\n14 29 43 59 70 74",
"output": "58"
},
{
"input": "1\n15",
"output": "30"
},
{
"input": "1\n16",
"output": "15"
},
{
"input": "14\n14 22 27 31 35 44 46 61 62 69 74 79 88 89",
"output": "90"
},
{
"input": "76\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n90",
"output": "15"
},
{
"input": "6\n13 17 32 47 60 66",
"output": "81"
},
{
"input": "84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84",
"output": "90"
},
{
"input": "9\n6 20 27 28 40 53 59 70 85",
"output": "90"
},
{
"input": "12\n14 22 27 31 35 44 62 69 74 79 88 89",
"output": "59"
},
{
"input": "5\n15 30 45 60 74",
"output": "89"
},
{
"input": "72\n3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89",
"output": "54"
},
{
"input": "8\n1 16 30 31 32 33 34 50",
"output": "49"
},
{
"input": "12\n1 3 6 10 15 21 28 36 45 55 66 78",
"output": "90"
},
{
"input": "25\n1 2 3 4 5 6 7 8 9 10 11 23 36 50 65 81 82 83 84 85 86 87 88 89 90",
"output": "80"
},
{
"input": "8\n5 17 20 35 42 53 67 76",
"output": "90"
},
{
"input": "9\n15 28 39 48 55 60 63 64 74",
"output": "89"
},
{
"input": "10\n15 28 39 48 55 60 63 64 74 82",
"output": "90"
},
{
"input": "2\n1 18",
"output": "16"
},
{
"input": "9\n10 20 30 40 50 60 70 80 84",
"output": "90"
},
{
"input": "2\n16 50",
"output": "15"
},
{
"input": "6\n15 30 45 60 75 84",
"output": "90"
},
{
"input": "8\n15 20 30 40 50 60 73 83",
"output": "90"
},
{
"input": "8\n10 20 30 40 50 60 70 80",
"output": "90"
},
{
"input": "3\n1 20 90",
"output": "16"
},
{
"input": "6\n15 30 45 60 74 89",
"output": "90"
}
] | 1,668,183,446
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 31
| 0
|
def getMinus(lstHotPart,amountPart):
timeMax = 90
timeWatch = 0
timeTurnOff = 15
timeToContinuos = 15
for part in lstHotPart:
if part <= timeToContinuos and part < timeMax:
timeToContinuos = part + timeTurnOff
timeWatch = part
else:
if part == timeMax:
timeWatch = timeMax
else:
timeWatch += timeTurnOff
return timeWatch
amountPart = int(input())
lstHotPart = list(map(int,(input().split())))
print(getMinus(lstHotPart,amountPart))
|
Title: Bear and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
Output Specification:
Print the number of minutes Limak will watch the game.
Demo Input:
['3\n7 20 88\n', '9\n16 20 30 40 50 60 70 80 90\n', '9\n15 20 30 40 50 60 70 80 90\n']
Demo Output:
['35\n', '15\n', '90\n']
Note:
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game.
|
```python
def getMinus(lstHotPart,amountPart):
timeMax = 90
timeWatch = 0
timeTurnOff = 15
timeToContinuos = 15
for part in lstHotPart:
if part <= timeToContinuos and part < timeMax:
timeToContinuos = part + timeTurnOff
timeWatch = part
else:
if part == timeMax:
timeWatch = timeMax
else:
timeWatch += timeTurnOff
return timeWatch
amountPart = int(input())
lstHotPart = list(map(int,(input().split())))
print(getMinus(lstHotPart,amountPart))
```
| 0
|
|
839
|
A
|
Arya and Bran
|
PROGRAMMING
| 900
|
[
"implementation"
] | null | null |
Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies.
At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later.
Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*).
Print -1 if she can't give him *k* candies during *n* given days.
|
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000).
The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
|
If it is impossible for Arya to give Bran *k* candies within *n* days, print -1.
Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day.
|
[
"2 3\n1 2\n",
"3 17\n10 10 10\n",
"1 9\n10\n"
] |
[
"2",
"3",
"-1"
] |
In the first sample, Arya can give Bran 3 candies in 2 days.
In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day.
In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
| 500
|
[
{
"input": "2 3\n1 2",
"output": "2"
},
{
"input": "3 17\n10 10 10",
"output": "3"
},
{
"input": "1 9\n10",
"output": "-1"
},
{
"input": "10 70\n6 5 2 3 3 2 1 4 3 2",
"output": "-1"
},
{
"input": "20 140\n40 4 81 40 10 54 34 50 84 60 16 1 90 78 38 93 99 60 81 99",
"output": "18"
},
{
"input": "30 133\n3 2 3 4 3 7 4 5 5 6 7 2 1 3 4 6 7 4 6 4 7 5 7 1 3 4 1 6 8 5",
"output": "30"
},
{
"input": "40 320\n70 79 21 64 95 36 63 29 66 89 30 34 100 76 42 12 4 56 80 78 83 1 39 9 34 45 6 71 27 31 55 52 72 71 38 21 43 83 48 47",
"output": "40"
},
{
"input": "50 300\n5 3 11 8 7 4 9 5 5 1 6 3 5 7 4 2 2 10 8 1 7 10 4 4 11 5 2 4 9 1 5 4 11 9 11 2 7 4 4 8 10 9 1 11 10 2 4 11 6 9",
"output": "-1"
},
{
"input": "37 30\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "30"
},
{
"input": "100 456\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "57"
},
{
"input": "90 298\n94 90 98 94 93 90 99 98 90 96 93 96 92 92 97 98 94 94 96 100 93 96 95 98 94 91 95 95 94 90 93 96 93 100 99 98 94 95 98 91 91 98 97 100 98 93 92 93 91 100 92 97 95 95 97 94 98 97 99 100 90 96 93 100 95 99 92 100 99 91 97 99 98 93 90 93 97 95 94 96 90 100 94 93 91 92 97 97 97 100",
"output": "38"
},
{
"input": "7 43\n4 3 7 9 3 8 10",
"output": "-1"
},
{
"input": "99 585\n8 2 3 3 10 7 9 4 7 4 6 8 7 11 5 8 7 4 7 7 6 7 11 8 1 7 3 2 10 1 6 10 10 5 10 2 5 5 11 6 4 1 5 10 5 8 1 3 7 10 6 1 1 3 8 11 5 8 2 2 5 4 7 6 7 5 8 7 10 9 6 11 4 8 2 7 1 7 1 4 11 1 9 6 1 10 6 10 1 5 6 5 2 5 11 5 1 10 8",
"output": "-1"
},
{
"input": "30 177\n8 7 5 8 3 7 2 4 3 8 11 3 9 11 2 4 1 4 5 6 11 5 8 3 6 3 11 2 11 8",
"output": "-1"
},
{
"input": "19 129\n3 3 10 11 4 7 3 8 10 2 11 6 11 9 4 2 11 10 5",
"output": "-1"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "13 104\n94 55 20 96 86 76 13 71 13 1 32 76 69",
"output": "13"
},
{
"input": "85 680\n61 44 55 6 30 74 27 26 17 45 73 1 67 71 39 32 13 25 79 66 4 59 49 28 29 22 10 17 98 80 36 99 52 24 59 44 27 79 29 46 29 12 47 72 82 25 6 30 81 72 95 65 30 71 72 45 39 16 16 89 48 42 59 71 50 58 31 65 91 70 48 56 28 34 53 89 94 98 49 55 94 65 91 11 53",
"output": "85"
},
{
"input": "100 458\n3 6 4 1 8 4 1 5 4 4 5 8 4 4 6 6 5 1 2 2 2 1 7 1 1 2 6 5 7 8 3 3 8 3 7 5 7 6 6 2 4 2 2 1 1 8 6 1 5 3 3 4 1 4 6 8 5 4 8 5 4 5 5 1 3 1 6 7 6 2 7 3 4 8 1 8 6 7 1 2 4 6 7 4 8 8 8 4 8 7 5 2 8 4 2 5 6 8 8 5",
"output": "100"
},
{
"input": "98 430\n4 7 6 3 4 1 7 1 1 6 6 1 5 4 6 1 5 4 6 6 1 5 1 1 8 1 6 6 2 6 8 4 4 6 6 8 8 7 4 1 2 4 1 5 4 3 7 3 2 5 7 7 7 2 2 2 7 2 8 7 3 4 5 7 8 3 7 6 7 3 2 4 7 1 4 4 7 1 1 8 4 5 8 3 1 5 3 5 2 1 3 3 8 1 3 5 8 6",
"output": "98"
},
{
"input": "90 80\n6 1 7 1 1 8 6 6 6 1 5 4 2 2 8 4 8 7 7 2 5 7 7 8 5 5 6 3 3 8 3 5 6 3 4 2 6 5 5 3 3 3 8 6 6 1 8 3 6 5 4 8 5 4 3 7 1 3 2 3 3 7 7 7 3 5 2 6 2 3 6 4 6 5 5 3 2 1 1 7 3 3 4 3 4 2 1 2 3 1",
"output": "18"
},
{
"input": "89 99\n7 7 3 5 2 7 8 8 1 1 5 7 7 4 1 5 3 4 4 8 8 3 3 2 6 3 8 2 7 5 8 1 3 5 3 6 4 3 6 2 3 3 4 5 1 6 1 7 7 7 6 7 7 7 8 8 8 2 1 7 5 8 6 7 7 4 7 5 7 8 1 3 5 8 7 1 4 2 5 8 3 4 4 5 5 6 2 4 2",
"output": "21"
},
{
"input": "50 700\n4 3 2 8 8 5 5 3 3 4 7 2 6 6 3 3 8 4 2 4 8 6 5 4 5 4 5 8 6 5 4 7 2 4 1 6 2 6 8 6 2 5 8 1 3 8 3 8 4 1",
"output": "-1"
},
{
"input": "82 359\n95 98 95 90 90 96 91 94 93 99 100 100 92 99 96 94 99 90 94 96 91 91 90 93 97 96 90 94 97 99 93 90 99 98 96 100 93 97 100 91 100 92 93 100 92 90 90 94 99 95 100 98 99 96 94 96 96 99 99 91 97 100 95 100 99 91 94 91 98 98 100 97 93 93 96 97 94 94 92 100 91 91",
"output": "45"
},
{
"input": "60 500\n93 93 100 99 91 92 95 93 95 99 93 91 97 98 90 91 98 100 95 100 94 93 92 91 91 98 98 90 93 91 90 96 92 93 92 94 94 91 96 94 98 100 97 96 96 97 91 99 97 95 96 94 91 92 99 95 97 92 98 90",
"output": "-1"
},
{
"input": "98 776\n48 63 26 3 88 81 27 33 37 10 2 89 41 84 98 93 25 44 42 90 41 65 97 1 28 69 42 14 86 18 96 28 28 94 78 8 44 31 96 45 26 52 93 25 48 39 3 75 94 93 63 59 67 86 18 74 27 38 68 7 31 60 69 67 20 11 19 34 47 43 86 96 3 49 56 60 35 49 89 28 92 69 48 15 17 73 99 69 2 73 27 35 28 53 11 1 96 50",
"output": "97"
},
{
"input": "100 189\n15 14 32 65 28 96 33 93 48 28 57 20 32 20 90 42 57 53 18 58 94 21 27 29 37 22 94 45 67 60 83 23 20 23 35 93 3 42 6 46 68 46 34 25 17 16 50 5 49 91 23 76 69 100 58 68 81 32 88 41 64 29 37 13 95 25 6 59 74 58 31 35 16 80 13 80 10 59 85 18 16 70 51 40 44 28 8 76 8 87 53 86 28 100 2 73 14 100 52 9",
"output": "24"
},
{
"input": "99 167\n72 4 79 73 49 58 15 13 92 92 42 36 35 21 13 10 51 94 64 35 86 50 6 80 93 77 59 71 2 88 22 10 27 30 87 12 77 6 34 56 31 67 78 84 36 27 15 15 12 56 80 7 56 14 10 9 14 59 15 20 34 81 8 49 51 72 4 58 38 77 31 86 18 61 27 86 95 36 46 36 39 18 78 39 48 37 71 12 51 92 65 48 39 22 16 87 4 5 42",
"output": "21"
},
{
"input": "90 4\n48 4 4 78 39 3 85 29 69 52 70 39 11 98 42 56 65 98 77 24 61 31 6 59 60 62 84 46 67 59 15 44 99 23 12 74 2 48 84 60 51 28 17 90 10 82 3 43 50 100 45 57 57 95 53 71 20 74 52 46 64 59 72 33 74 16 44 44 80 71 83 1 70 59 61 6 82 69 81 45 88 28 17 24 22 25 53 97 1 100",
"output": "1"
},
{
"input": "30 102\n55 94 3 96 3 47 92 85 25 78 27 70 97 83 40 2 55 12 74 84 91 37 31 85 7 40 33 54 72 5",
"output": "13"
},
{
"input": "81 108\n61 59 40 100 8 75 5 74 87 12 6 23 98 26 59 68 27 4 98 79 14 44 4 11 89 77 29 90 33 3 43 1 87 91 28 24 4 84 75 7 37 46 15 46 8 87 68 66 5 21 36 62 77 74 91 95 88 28 12 48 18 93 14 51 33 5 99 62 99 38 49 15 56 87 52 64 69 46 41 12 92",
"output": "14"
},
{
"input": "2 16\n10 6",
"output": "2"
},
{
"input": "2 8\n7 8",
"output": "2"
},
{
"input": "2 9\n4 8",
"output": "2"
},
{
"input": "3 19\n9 9 1",
"output": "3"
},
{
"input": "4 32\n9 9 9 5",
"output": "4"
},
{
"input": "2 15\n14 1",
"output": "2"
},
{
"input": "2 3\n3 3",
"output": "1"
},
{
"input": "3 10\n10 1 1",
"output": "2"
},
{
"input": "12 20\n3 16 19 10 1 6 17 8 6 20 1 4",
"output": "4"
},
{
"input": "4 15\n14 3 3 3",
"output": "2"
},
{
"input": "5 40\n10 10 10 10 1",
"output": "5"
},
{
"input": "4 31\n9 9 8 5",
"output": "4"
},
{
"input": "4 31\n20 7 1 1",
"output": "-1"
},
{
"input": "2 10\n9 1",
"output": "2"
},
{
"input": "10 50\n100 10 1 1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "2 11\n10 2",
"output": "2"
},
{
"input": "3 21\n10 10 1",
"output": "3"
},
{
"input": "2 2\n1 2",
"output": "2"
},
{
"input": "3 2\n1 8 8",
"output": "2"
},
{
"input": "2 11\n10 1",
"output": "2"
},
{
"input": "2 16\n12 4",
"output": "2"
},
{
"input": "3 11\n9 2 2",
"output": "2"
},
{
"input": "3 11\n4 3 4",
"output": "3"
},
{
"input": "2 13\n7 6",
"output": "2"
},
{
"input": "3 24\n14 3 4",
"output": "-1"
},
{
"input": "2 13\n10 3",
"output": "2"
},
{
"input": "3 11\n9 2 1",
"output": "2"
},
{
"input": "2 15\n12 3",
"output": "2"
},
{
"input": "2 14\n11 4",
"output": "2"
}
] | 1,695,422,672
| 2,147,483,647
|
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 0
| 77
| 2,867,200
|
n, k = map(int, input().split())
a = map(int, input().split())
s = 0
e = 0
f = False
for i in range(n):
if a[i] < 8:
df = 8 - a[i]
if e <= df:
s += a[i] + e
e = 0
else:
e = e - df
s += a[i] + df
elif a[i] > 8:
s += 8
e += a[i] - 8
else:
s += 8
if s >= k:
f = True
break
if f==True:
print(i+1)
else:
print(-1)
|
Title: Arya and Bran
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bran and his older sister Arya are from the same house. Bran like candies so much, so Arya is going to give him some Candies.
At first, Arya and Bran have 0 Candies. There are *n* days, at the *i*-th day, Arya finds *a**i* candies in a box, that is given by the Many-Faced God. Every day she can give Bran at most 8 of her candies. If she don't give him the candies at the same day, they are saved for her and she can give them to him later.
Your task is to find the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day. Formally, you need to output the minimum day index to the end of which *k* candies will be given out (the days are indexed from 1 to *n*).
Print -1 if she can't give him *k* candies during *n* given days.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=10000).
The second line contains *n* integers *a*1,<=*a*2,<=*a*3,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100).
Output Specification:
If it is impossible for Arya to give Bran *k* candies within *n* days, print -1.
Otherwise print a single integer — the minimum number of days Arya needs to give Bran *k* candies before the end of the *n*-th day.
Demo Input:
['2 3\n1 2\n', '3 17\n10 10 10\n', '1 9\n10\n']
Demo Output:
['2', '3', '-1']
Note:
In the first sample, Arya can give Bran 3 candies in 2 days.
In the second sample, Arya can give Bran 17 candies in 3 days, because she can give him at most 8 candies per day.
In the third sample, Arya can't give Bran 9 candies, because she can give him at most 8 candies per day and she must give him the candies within 1 day.
|
```python
n, k = map(int, input().split())
a = map(int, input().split())
s = 0
e = 0
f = False
for i in range(n):
if a[i] < 8:
df = 8 - a[i]
if e <= df:
s += a[i] + e
e = 0
else:
e = e - df
s += a[i] + df
elif a[i] > 8:
s += 8
e += a[i] - 8
else:
s += 8
if s >= k:
f = True
break
if f==True:
print(i+1)
else:
print(-1)
```
| -1
|
|
510
|
A
|
Fox And Snake
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead.
A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on.
Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#').
Consider sample tests in order to understand the snake pattern.
|
The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50).
*n* is an odd number.
|
Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces.
|
[
"3 3\n",
"3 4\n",
"5 3\n",
"9 9\n"
] |
[
"###\n..#\n###\n",
"####\n...#\n####\n",
"###\n..#\n###\n#..\n###\n",
"#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n"
] |
none
| 500
|
[
{
"input": "3 3",
"output": "###\n..#\n###"
},
{
"input": "3 4",
"output": "####\n...#\n####"
},
{
"input": "5 3",
"output": "###\n..#\n###\n#..\n###"
},
{
"input": "9 9",
"output": "#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########"
},
{
"input": "3 5",
"output": "#####\n....#\n#####"
},
{
"input": "3 6",
"output": "######\n.....#\n######"
},
{
"input": "7 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "7 4",
"output": "####\n...#\n####\n#...\n####\n...#\n####"
},
{
"input": "49 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "43 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "43 27",
"output": "###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n....................."
},
{
"input": "11 15",
"output": "###############\n..............#\n###############\n#..............\n###############\n..............#\n###############\n#..............\n###############\n..............#\n###############"
},
{
"input": "11 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "19 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "23 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "49 49",
"output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..."
},
{
"input": "33 43",
"output": "###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#.................."
},
{
"input": "33 44",
"output": "############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#......."
},
{
"input": "45 45",
"output": "#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#########################################..."
},
{
"input": "45 49",
"output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..."
},
{
"input": "45 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###"
},
{
"input": "45 4",
"output": "####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####"
},
{
"input": "5 4",
"output": "####\n...#\n####\n#...\n####"
},
{
"input": "5 5",
"output": "#####\n....#\n#####\n#....\n#####"
},
{
"input": "5 6",
"output": "######\n.....#\n######\n#.....\n######"
},
{
"input": "7 5",
"output": "#####\n....#\n#####\n#....\n#####\n....#\n#####"
},
{
"input": "7 6",
"output": "######\n.....#\n######\n#.....\n######\n.....#\n######"
},
{
"input": "7 7",
"output": "#######\n......#\n#######\n#......\n#######\n......#\n#######"
}
] | 1,679,670,080
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 28
| 46
| 0
|
n,m=map(int,input().split())
q=1
for i in range(n):
i+=1
if i%2==1:
print("#"*m)
else:
if q==1:
print(("."*(m-1))+"#")
q=0
else:
print("#"+("."*(m-1)))
q=1
|
Title: Fox And Snake
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead.
A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on.
Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#').
Consider sample tests in order to understand the snake pattern.
Input Specification:
The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50).
*n* is an odd number.
Output Specification:
Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces.
Demo Input:
['3 3\n', '3 4\n', '5 3\n', '9 9\n']
Demo Output:
['###\n..#\n###\n', '####\n...#\n####\n', '###\n..#\n###\n#..\n###\n', '#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n']
Note:
none
|
```python
n,m=map(int,input().split())
q=1
for i in range(n):
i+=1
if i%2==1:
print("#"*m)
else:
if q==1:
print(("."*(m-1))+"#")
q=0
else:
print("#"+("."*(m-1)))
q=1
```
| 3
|
|
522
|
B
|
Photo to Remember
|
PROGRAMMING
| 1,100
|
[
"*special",
"data structures",
"dp",
"implementation"
] | null | null |
One day *n* friends met at a party, they hadn't seen each other for a long time and so they decided to make a group photo together.
Simply speaking, the process of taking photos can be described as follows. On the photo, each photographed friend occupies a rectangle of pixels: the *i*-th of them occupies the rectangle of width *w**i* pixels and height *h**i* pixels. On the group photo everybody stands in a line, thus the minimum pixel size of the photo including all the photographed friends, is *W*<=×<=*H*, where *W* is the total sum of all widths and *H* is the maximum height of all the photographed friends.
As is usually the case, the friends made *n* photos — the *j*-th (1<=≤<=*j*<=≤<=*n*) photo had everybody except for the *j*-th friend as he was the photographer.
Print the minimum size of each made photo in pixels.
|
The first line contains integer *n* (2<=≤<=*n*<=≤<=200<=000) — the number of friends.
Then *n* lines follow: the *i*-th line contains information about the *i*-th friend. The line contains a pair of integers *w**i*,<=*h**i* (1<=≤<=*w**i*<=≤<=10,<=1<=≤<=*h**i*<=≤<=1000) — the width and height in pixels of the corresponding rectangle.
|
Print *n* space-separated numbers *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* — the total number of pixels on the minimum photo containing all friends expect for the *i*-th one.
|
[
"3\n1 10\n5 5\n10 1\n",
"3\n2 1\n1 2\n2 1\n"
] |
[
"75 110 60 ",
"6 4 6 "
] |
none
| 1,000
|
[
{
"input": "3\n1 10\n5 5\n10 1",
"output": "75 110 60 "
},
{
"input": "3\n2 1\n1 2\n2 1",
"output": "6 4 6 "
},
{
"input": "2\n1 5\n2 3",
"output": "6 5 "
},
{
"input": "2\n2 3\n1 1",
"output": "1 6 "
},
{
"input": "3\n1 10\n2 10\n3 10",
"output": "50 40 30 "
},
{
"input": "3\n2 10\n1 9\n3 7",
"output": "36 50 30 "
},
{
"input": "3\n1 1\n3 2\n2 3",
"output": "15 9 8 "
},
{
"input": "3\n3 123\n1 456\n2 789",
"output": "2367 3945 1824 "
},
{
"input": "3\n2 987\n3 654\n1 321",
"output": "2616 2961 4935 "
},
{
"input": "3\n3 143\n2 543\n1 893",
"output": "2679 3572 2715 "
},
{
"input": "2\n1 1\n1 2",
"output": "2 1 "
},
{
"input": "3\n2 22\n1 11\n2 22",
"output": "66 88 66 "
},
{
"input": "3\n1 11\n1 12\n1 13",
"output": "26 26 24 "
},
{
"input": "3\n1 11\n1 12\n2 10",
"output": "36 33 24 "
},
{
"input": "10\n6 20\n1 175\n1 758\n1 169\n2 490\n2 600\n4 463\n7 377\n9 40\n4 961",
"output": "29791 34596 34596 34596 33635 33635 31713 28830 26908 25014 "
},
{
"input": "10\n8 158\n1 709\n6 766\n4 335\n5 356\n2 972\n1 108\n4 235\n3 631\n1 414",
"output": "26244 33048 28188 30132 29160 25278 33048 30132 31104 33048 "
},
{
"input": "10\n7 549\n9 115\n8 141\n3 650\n5 730\n3 841\n7 18\n9 170\n2 217\n1 155",
"output": "39527 37845 38686 42891 41209 37230 39527 37845 43732 44573 "
},
{
"input": "10\n6 386\n9 816\n9 268\n9 481\n8 284\n10 715\n9 351\n7 580\n4 327\n7 392",
"output": "58752 49335 56304 56304 57120 55488 56304 57936 60384 57936 "
},
{
"input": "10\n9 292\n4 6\n6 638\n8 461\n10 970\n10 488\n9 769\n10 644\n8 280\n5 334",
"output": "67900 72750 70810 68870 53061 66930 67900 66930 68870 71780 "
},
{
"input": "10\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000\n10 1000",
"output": "90000 90000 90000 90000 90000 90000 90000 90000 90000 90000 "
}
] | 1,589,369,795
| 2,147,483,647
|
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 25
| 2,000
| 47,001,600
|
import math as mt
import sys,string
input=sys.stdin.readline
#print=sys.stdout.write
import random
from collections import deque,defaultdict
L=lambda : list(map(int,input().split()))
Ls=lambda : list(input().split())
M=lambda : map(int,input().split())
I=lambda :int(input())
n=I()
W=0
H=[]
l=[]
for i in range(n):
a,b=M()
W+=a
H.append(b)
l.append([a,b])
H.sort()
for i in range(n):
x=H.index(l[i][1])
if(x==n-1):
p=H[n-2]
else:
p=H[-1]
print((W-l[i][0])*(p),end=" ")
|
Title: Photo to Remember
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day *n* friends met at a party, they hadn't seen each other for a long time and so they decided to make a group photo together.
Simply speaking, the process of taking photos can be described as follows. On the photo, each photographed friend occupies a rectangle of pixels: the *i*-th of them occupies the rectangle of width *w**i* pixels and height *h**i* pixels. On the group photo everybody stands in a line, thus the minimum pixel size of the photo including all the photographed friends, is *W*<=×<=*H*, where *W* is the total sum of all widths and *H* is the maximum height of all the photographed friends.
As is usually the case, the friends made *n* photos — the *j*-th (1<=≤<=*j*<=≤<=*n*) photo had everybody except for the *j*-th friend as he was the photographer.
Print the minimum size of each made photo in pixels.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=200<=000) — the number of friends.
Then *n* lines follow: the *i*-th line contains information about the *i*-th friend. The line contains a pair of integers *w**i*,<=*h**i* (1<=≤<=*w**i*<=≤<=10,<=1<=≤<=*h**i*<=≤<=1000) — the width and height in pixels of the corresponding rectangle.
Output Specification:
Print *n* space-separated numbers *b*1,<=*b*2,<=...,<=*b**n*, where *b**i* — the total number of pixels on the minimum photo containing all friends expect for the *i*-th one.
Demo Input:
['3\n1 10\n5 5\n10 1\n', '3\n2 1\n1 2\n2 1\n']
Demo Output:
['75 110 60 ', '6 4 6 ']
Note:
none
|
```python
import math as mt
import sys,string
input=sys.stdin.readline
#print=sys.stdout.write
import random
from collections import deque,defaultdict
L=lambda : list(map(int,input().split()))
Ls=lambda : list(input().split())
M=lambda : map(int,input().split())
I=lambda :int(input())
n=I()
W=0
H=[]
l=[]
for i in range(n):
a,b=M()
W+=a
H.append(b)
l.append([a,b])
H.sort()
for i in range(n):
x=H.index(l[i][1])
if(x==n-1):
p=H[n-2]
else:
p=H[-1]
print((W-l[i][0])*(p),end=" ")
```
| 0
|
|
91
|
B
|
Queue
|
PROGRAMMING
| 1,500
|
[
"binary search",
"data structures"
] |
B. Queue
|
2
|
256
|
There are *n* walruses standing in a queue in an airport. They are numbered starting from the queue's tail: the 1-st walrus stands at the end of the queue and the *n*-th walrus stands at the beginning of the queue. The *i*-th walrus has the age equal to *a**i*.
The *i*-th walrus becomes displeased if there's a younger walrus standing in front of him, that is, if exists such *j* (*i*<=<<=*j*), that *a**i*<=><=*a**j*. The displeasure of the *i*-th walrus is equal to the number of walruses between him and the furthest walrus ahead of him, which is younger than the *i*-th one. That is, the further that young walrus stands from him, the stronger the displeasure is.
The airport manager asked you to count for each of *n* walruses in the queue his displeasure.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=105) — the number of walruses in the queue. The second line contains integers *a**i* (1<=≤<=*a**i*<=≤<=109).
Note that some walruses can have the same age but for the displeasure to emerge the walrus that is closer to the head of the queue needs to be strictly younger than the other one.
|
Print *n* numbers: if the *i*-th walrus is pleased with everything, print "-1" (without the quotes). Otherwise, print the *i*-th walrus's displeasure: the number of other walruses that stand between him and the furthest from him younger walrus.
|
[
"6\n10 8 5 3 50 45\n",
"7\n10 4 6 3 2 8 15\n",
"5\n10 3 1 10 11\n"
] |
[
"2 1 0 -1 0 -1 ",
"4 2 1 0 -1 -1 -1 ",
"1 0 -1 -1 -1 "
] |
none
| 1,000
|
[
{
"input": "6\n10 8 5 3 50 45",
"output": "2 1 0 -1 0 -1 "
},
{
"input": "7\n10 4 6 3 2 8 15",
"output": "4 2 1 0 -1 -1 -1 "
},
{
"input": "5\n10 3 1 10 11",
"output": "1 0 -1 -1 -1 "
},
{
"input": "13\n18 9 8 9 23 20 18 18 33 25 31 37 36",
"output": "2 0 -1 -1 2 1 -1 -1 1 -1 -1 0 -1 "
},
{
"input": "10\n15 21 17 22 27 21 31 26 32 30",
"output": "-1 0 -1 1 2 -1 2 -1 0 -1 "
},
{
"input": "10\n18 20 18 17 17 13 22 20 34 29",
"output": "4 3 2 1 0 -1 0 -1 0 -1 "
},
{
"input": "13\n16 14 12 9 11 28 30 21 35 30 32 31 43",
"output": "3 2 1 -1 -1 1 0 -1 2 -1 0 -1 -1 "
},
{
"input": "15\n18 6 18 21 14 20 13 9 18 20 28 13 19 25 21",
"output": "10 -1 8 8 6 6 0 -1 2 2 3 -1 -1 0 -1 "
},
{
"input": "11\n15 17 18 18 26 22 23 33 33 21 29",
"output": "-1 -1 -1 -1 4 3 2 2 1 -1 -1 "
},
{
"input": "15\n14 4 5 12 6 19 14 19 12 22 23 17 14 21 27",
"output": "7 -1 -1 0 -1 6 1 4 -1 3 2 0 -1 -1 -1 "
},
{
"input": "2\n1 1000000000",
"output": "-1 -1 "
},
{
"input": "2\n1000000000 1",
"output": "0 -1 "
},
{
"input": "5\n15 1 8 15 3",
"output": "3 -1 1 0 -1 "
},
{
"input": "12\n5 1 2 5 100 1 1000 100 10000 20000 10000 20000",
"output": "4 -1 2 1 0 -1 0 -1 -1 0 -1 -1 "
}
] | 1,679,730,998
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 61
| 622
| 19,148,800
|
import sys
input = sys.stdin.readline
n = int(input())
w = list(map(int, input().split()))
d = sorted([(j, i) for i, j in enumerate(w)])
x = -1
w = [0]*n
for j, i in d:
if i > x:
w[i] = -1
x = i
else:
w[i] = x-i-1
print(' '.join(map(str, w)))
|
Title: Queue
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There are *n* walruses standing in a queue in an airport. They are numbered starting from the queue's tail: the 1-st walrus stands at the end of the queue and the *n*-th walrus stands at the beginning of the queue. The *i*-th walrus has the age equal to *a**i*.
The *i*-th walrus becomes displeased if there's a younger walrus standing in front of him, that is, if exists such *j* (*i*<=<<=*j*), that *a**i*<=><=*a**j*. The displeasure of the *i*-th walrus is equal to the number of walruses between him and the furthest walrus ahead of him, which is younger than the *i*-th one. That is, the further that young walrus stands from him, the stronger the displeasure is.
The airport manager asked you to count for each of *n* walruses in the queue his displeasure.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=105) — the number of walruses in the queue. The second line contains integers *a**i* (1<=≤<=*a**i*<=≤<=109).
Note that some walruses can have the same age but for the displeasure to emerge the walrus that is closer to the head of the queue needs to be strictly younger than the other one.
Output Specification:
Print *n* numbers: if the *i*-th walrus is pleased with everything, print "-1" (without the quotes). Otherwise, print the *i*-th walrus's displeasure: the number of other walruses that stand between him and the furthest from him younger walrus.
Demo Input:
['6\n10 8 5 3 50 45\n', '7\n10 4 6 3 2 8 15\n', '5\n10 3 1 10 11\n']
Demo Output:
['2 1 0 -1 0 -1 ', '4 2 1 0 -1 -1 -1 ', '1 0 -1 -1 -1 ']
Note:
none
|
```python
import sys
input = sys.stdin.readline
n = int(input())
w = list(map(int, input().split()))
d = sorted([(j, i) for i, j in enumerate(w)])
x = -1
w = [0]*n
for j, i in d:
if i > x:
w[i] = -1
x = i
else:
w[i] = x-i-1
print(' '.join(map(str, w)))
```
| 3.808833
|
489
|
C
|
Given Length and Sum of Digits...
|
PROGRAMMING
| 1,400
|
[
"dp",
"greedy",
"implementation"
] | null | null |
You have a positive integer *m* and a non-negative integer *s*. Your task is to find the smallest and the largest of the numbers that have length *m* and sum of digits *s*. The required numbers should be non-negative integers written in the decimal base without leading zeroes.
|
The single line of the input contains a pair of integers *m*, *s* (1<=≤<=*m*<=≤<=100,<=0<=≤<=*s*<=≤<=900) — the length and the sum of the digits of the required numbers.
|
In the output print the pair of the required non-negative integer numbers — first the minimum possible number, then — the maximum possible number. If no numbers satisfying conditions required exist, print the pair of numbers "-1 -1" (without the quotes).
|
[
"2 15\n",
"3 0\n"
] |
[
"69 96\n",
"-1 -1\n"
] |
none
| 1,500
|
[
{
"input": "2 15",
"output": "69 96"
},
{
"input": "3 0",
"output": "-1 -1"
},
{
"input": "2 1",
"output": "10 10"
},
{
"input": "3 10",
"output": "109 910"
},
{
"input": "100 100",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000099999999999 9999999999910000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "1 900",
"output": "-1 -1"
},
{
"input": "1 9",
"output": "9 9"
},
{
"input": "1 0",
"output": "0 0"
},
{
"input": "1 1",
"output": "1 1"
},
{
"input": "1 2",
"output": "2 2"
},
{
"input": "1 8",
"output": "8 8"
},
{
"input": "1 10",
"output": "-1 -1"
},
{
"input": "1 11",
"output": "-1 -1"
},
{
"input": "2 0",
"output": "-1 -1"
},
{
"input": "2 1",
"output": "10 10"
},
{
"input": "2 2",
"output": "11 20"
},
{
"input": "2 8",
"output": "17 80"
},
{
"input": "2 10",
"output": "19 91"
},
{
"input": "2 11",
"output": "29 92"
},
{
"input": "2 16",
"output": "79 97"
},
{
"input": "2 17",
"output": "89 98"
},
{
"input": "2 18",
"output": "99 99"
},
{
"input": "2 19",
"output": "-1 -1"
},
{
"input": "2 20",
"output": "-1 -1"
},
{
"input": "2 900",
"output": "-1 -1"
},
{
"input": "3 1",
"output": "100 100"
},
{
"input": "3 2",
"output": "101 200"
},
{
"input": "3 3",
"output": "102 300"
},
{
"input": "3 9",
"output": "108 900"
},
{
"input": "3 10",
"output": "109 910"
},
{
"input": "3 20",
"output": "299 992"
},
{
"input": "3 21",
"output": "399 993"
},
{
"input": "3 26",
"output": "899 998"
},
{
"input": "3 27",
"output": "999 999"
},
{
"input": "3 28",
"output": "-1 -1"
},
{
"input": "3 100",
"output": "-1 -1"
},
{
"input": "100 0",
"output": "-1 -1"
},
{
"input": "100 1",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 2",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001 2000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 9",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000008 9000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 10",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000009 9100000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 11",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000019 9200000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 296",
"output": "1000000000000000000000000000000000000000000000000000000000000000000799999999999999999999999999999999 9999999999999999999999999999999980000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 297",
"output": "1000000000000000000000000000000000000000000000000000000000000000000899999999999999999999999999999999 9999999999999999999999999999999990000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 298",
"output": "1000000000000000000000000000000000000000000000000000000000000000000999999999999999999999999999999999 9999999999999999999999999999999991000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 299",
"output": "1000000000000000000000000000000000000000000000000000000000000000001999999999999999999999999999999999 9999999999999999999999999999999992000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 300",
"output": "1000000000000000000000000000000000000000000000000000000000000000002999999999999999999999999999999999 9999999999999999999999999999999993000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 301",
"output": "1000000000000000000000000000000000000000000000000000000000000000003999999999999999999999999999999999 9999999999999999999999999999999994000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 895",
"output": "4999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999994"
},
{
"input": "100 896",
"output": "5999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999995"
},
{
"input": "100 897",
"output": "6999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999996"
},
{
"input": "100 898",
"output": "7999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999997"
},
{
"input": "100 899",
"output": "8999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999998"
},
{
"input": "100 900",
"output": "9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999"
},
{
"input": "99 900",
"output": "-1 -1"
},
{
"input": "99 891",
"output": "999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999 999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999999"
},
{
"input": "99 892",
"output": "-1 -1"
},
{
"input": "96 364",
"output": "100000000000000000000000000000000000000000000000000000039999999999999999999999999999999999999999 999999999999999999999999999999999999999940000000000000000000000000000000000000000000000000000000"
},
{
"input": "97 206",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000079999999999999999999999 9999999999999999999999800000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "98 250",
"output": "10000000000000000000000000000000000000000000000000000000000000000000006999999999999999999999999999 99999999999999999999999999970000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "99 96",
"output": "100000000000000000000000000000000000000000000000000000000000000000000000000000000000000059999999999 999999999960000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "100 215",
"output": "1000000000000000000000000000000000000000000000000000000000000000000000000000799999999999999999999999 9999999999999999999999980000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "5 18",
"output": "10089 99000"
},
{
"input": "2 19",
"output": "-1 -1"
},
{
"input": "3 3",
"output": "102 300"
}
] | 1,679,990,548
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 2
| 61
| 0
|
def can(m:int, s:int) -> bool:
return (s >= 0 and s <= m*9)
if __name__ == '__main__':
m, s = map(int, input().split())
if (s == 0 and m != 0) or s > 9 * m:
print(-1, -1)
exit()
ans = ""
for i in range(m):
for d in range(10):
if (i > 0 or d > 0 or (m == 1 and d == 0)) and can(m - i - 1, s - d):
ans += str(d)
s -= d
break
print(ans, ans[::-1])
|
Title: Given Length and Sum of Digits...
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a positive integer *m* and a non-negative integer *s*. Your task is to find the smallest and the largest of the numbers that have length *m* and sum of digits *s*. The required numbers should be non-negative integers written in the decimal base without leading zeroes.
Input Specification:
The single line of the input contains a pair of integers *m*, *s* (1<=≤<=*m*<=≤<=100,<=0<=≤<=*s*<=≤<=900) — the length and the sum of the digits of the required numbers.
Output Specification:
In the output print the pair of the required non-negative integer numbers — first the minimum possible number, then — the maximum possible number. If no numbers satisfying conditions required exist, print the pair of numbers "-1 -1" (without the quotes).
Demo Input:
['2 15\n', '3 0\n']
Demo Output:
['69 96\n', '-1 -1\n']
Note:
none
|
```python
def can(m:int, s:int) -> bool:
return (s >= 0 and s <= m*9)
if __name__ == '__main__':
m, s = map(int, input().split())
if (s == 0 and m != 0) or s > 9 * m:
print(-1, -1)
exit()
ans = ""
for i in range(m):
for d in range(10):
if (i > 0 or d > 0 or (m == 1 and d == 0)) and can(m - i - 1, s - d):
ans += str(d)
s -= d
break
print(ans, ans[::-1])
```
| 0
|
|
842
|
A
|
Kirill And The Game
|
PROGRAMMING
| 1,200
|
[
"brute force",
"two pointers"
] | null | null |
Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number.
For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions).
Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this?
|
First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107).
|
Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise.
You can output each of the letters in any register.
|
[
"1 10 1 10 1\n",
"1 5 6 10 1\n"
] |
[
"YES",
"NO"
] |
none
| 500
|
[
{
"input": "1 10 1 10 1",
"output": "YES"
},
{
"input": "1 5 6 10 1",
"output": "NO"
},
{
"input": "1 1 1 1 1",
"output": "YES"
},
{
"input": "1 1 1 1 2",
"output": "NO"
},
{
"input": "1 100000 1 100000 100000",
"output": "YES"
},
{
"input": "1 100000 1 100000 100001",
"output": "NO"
},
{
"input": "25 10000 200 10000 5",
"output": "YES"
},
{
"input": "1 100000 10 100000 50000",
"output": "NO"
},
{
"input": "91939 94921 10197 89487 1",
"output": "NO"
},
{
"input": "30518 58228 74071 77671 1",
"output": "NO"
},
{
"input": "46646 79126 78816 91164 5",
"output": "NO"
},
{
"input": "30070 83417 92074 99337 2",
"output": "NO"
},
{
"input": "13494 17544 96820 99660 6",
"output": "NO"
},
{
"input": "96918 97018 10077 86510 9",
"output": "YES"
},
{
"input": "13046 45594 14823 52475 1",
"output": "YES"
},
{
"input": "29174 40572 95377 97669 4",
"output": "NO"
},
{
"input": "79894 92433 8634 86398 4",
"output": "YES"
},
{
"input": "96022 98362 13380 94100 6",
"output": "YES"
},
{
"input": "79446 95675 93934 96272 3",
"output": "NO"
},
{
"input": "5440 46549 61481 99500 10",
"output": "NO"
},
{
"input": "21569 53580 74739 87749 3",
"output": "NO"
},
{
"input": "72289 78297 79484 98991 7",
"output": "NO"
},
{
"input": "88417 96645 92742 98450 5",
"output": "NO"
},
{
"input": "71841 96625 73295 77648 8",
"output": "NO"
},
{
"input": "87969 99230 78041 94736 4",
"output": "NO"
},
{
"input": "4 4 1 2 3",
"output": "NO"
},
{
"input": "150 150 1 2 100",
"output": "NO"
},
{
"input": "99 100 1 100 50",
"output": "YES"
},
{
"input": "7 7 3 6 2",
"output": "NO"
},
{
"input": "10 10 1 10 1",
"output": "YES"
},
{
"input": "36 36 5 7 6",
"output": "YES"
},
{
"input": "73 96 1 51 51",
"output": "NO"
},
{
"input": "3 3 1 3 2",
"output": "NO"
},
{
"input": "10000000 10000000 1 100000 10000000",
"output": "YES"
},
{
"input": "9222174 9829060 9418763 9955619 9092468",
"output": "NO"
},
{
"input": "70 70 1 2 50",
"output": "NO"
},
{
"input": "100 200 1 20 5",
"output": "YES"
},
{
"input": "1 200000 65536 65536 65537",
"output": "NO"
},
{
"input": "15 15 1 100 1",
"output": "YES"
},
{
"input": "10000000 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "10 10 2 5 4",
"output": "NO"
},
{
"input": "67 69 7 7 9",
"output": "NO"
},
{
"input": "100000 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "9 12 1 2 7",
"output": "NO"
},
{
"input": "5426234 6375745 2636512 8492816 4409404",
"output": "NO"
},
{
"input": "6134912 6134912 10000000 10000000 999869",
"output": "NO"
},
{
"input": "3 3 1 100 1",
"output": "YES"
},
{
"input": "10000000 10000000 10 10000000 100000",
"output": "YES"
},
{
"input": "4 4 1 100 2",
"output": "YES"
},
{
"input": "8 13 1 4 7",
"output": "NO"
},
{
"input": "10 10 100000 10000000 10000000",
"output": "NO"
},
{
"input": "5 6 1 4 2",
"output": "YES"
},
{
"input": "1002 1003 1 2 1000",
"output": "NO"
},
{
"input": "4 5 1 2 2",
"output": "YES"
},
{
"input": "5 6 1 5 1",
"output": "YES"
},
{
"input": "15 21 2 4 7",
"output": "YES"
},
{
"input": "4 5 3 7 1",
"output": "YES"
},
{
"input": "15 15 3 4 4",
"output": "NO"
},
{
"input": "3 6 1 2 2",
"output": "YES"
},
{
"input": "2 10 3 6 3",
"output": "YES"
},
{
"input": "1 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "8 13 1 2 7",
"output": "NO"
},
{
"input": "98112 98112 100000 100000 128850",
"output": "NO"
},
{
"input": "2 2 1 2 1",
"output": "YES"
},
{
"input": "8 8 3 4 2",
"output": "YES"
},
{
"input": "60 60 2 3 25",
"output": "NO"
},
{
"input": "16 17 2 5 5",
"output": "NO"
},
{
"input": "2 4 1 3 1",
"output": "YES"
},
{
"input": "4 5 1 2 3",
"output": "NO"
},
{
"input": "10 10 3 4 3",
"output": "NO"
},
{
"input": "10 10000000 999999 10000000 300",
"output": "NO"
},
{
"input": "100 120 9 11 10",
"output": "YES"
},
{
"input": "8 20 1 3 4",
"output": "YES"
},
{
"input": "10 14 2 3 4",
"output": "YES"
},
{
"input": "2000 2001 1 3 1000",
"output": "YES"
},
{
"input": "12 13 2 3 5",
"output": "NO"
},
{
"input": "7 7 2 3 3",
"output": "NO"
},
{
"input": "5 8 1 10000000 4",
"output": "YES"
},
{
"input": "5 5 1 1 4",
"output": "NO"
},
{
"input": "5 5 1 6 2",
"output": "NO"
},
{
"input": "200 300 4000381 4000382 4000381",
"output": "NO"
},
{
"input": "11 17 2 5 2",
"output": "NO"
},
{
"input": "9999999 10000000 1 10000000 999997",
"output": "NO"
},
{
"input": "7 8 2 3 3",
"output": "NO"
},
{
"input": "7 7 3 3 2",
"output": "NO"
},
{
"input": "15 15 2 3 7",
"output": "NO"
},
{
"input": "65408 65408 859 859 10000000",
"output": "NO"
},
{
"input": "1000000 10000000 1 100000 1",
"output": "NO"
},
{
"input": "6 12 2 3 2",
"output": "YES"
},
{
"input": "7 8 1 3 3",
"output": "NO"
},
{
"input": "4 4 1 2 2",
"output": "YES"
},
{
"input": "2 3 1 2 2",
"output": "YES"
},
{
"input": "11 14 2 3 5",
"output": "NO"
},
{
"input": "7 7 1 10 3",
"output": "NO"
},
{
"input": "49 50 1 2 27",
"output": "NO"
},
{
"input": "1 10000000 1 10000000 123456",
"output": "YES"
},
{
"input": "100000 10000000 100 10000000 100000",
"output": "YES"
},
{
"input": "17 19 2 3 8",
"output": "NO"
},
{
"input": "4 6 3 9 1",
"output": "YES"
},
{
"input": "19 20 6 7 3",
"output": "NO"
},
{
"input": "5000000 10000000 1 4999999 1",
"output": "NO"
}
] | 1,562,217,575
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 27
| 140
| 0
|
l, r, x, y, k = map(int, input().split())
la, ra = k * x, k * y
if r < la or ra < l:
print('NO')
elif l <= la <= r or l <= ra <= r:
print('YES')
else:
print(('NO', 'YES')[r / k - l / k >= 1])
|
Title: Kirill And The Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number.
For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions).
Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this?
Input Specification:
First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107).
Output Specification:
Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise.
You can output each of the letters in any register.
Demo Input:
['1 10 1 10 1\n', '1 5 6 10 1\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
l, r, x, y, k = map(int, input().split())
la, ra = k * x, k * y
if r < la or ra < l:
print('NO')
elif l <= la <= r or l <= ra <= r:
print('YES')
else:
print(('NO', 'YES')[r / k - l / k >= 1])
```
| 0
|
|
665
|
C
|
Simple Strings
|
PROGRAMMING
| 1,300
|
[
"dp",
"greedy",
"strings"
] | null | null |
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
|
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
|
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
|
[
"aab\n",
"caaab\n",
"zscoder\n"
] |
[
"bab\n",
"cabab\n",
"zscoder\n"
] |
none
| 0
|
[
{
"input": "aab",
"output": "bab"
},
{
"input": "caaab",
"output": "cabab"
},
{
"input": "zscoder",
"output": "zscoder"
},
{
"input": "u",
"output": "u"
},
{
"input": "h",
"output": "h"
},
{
"input": "dtottttotd",
"output": "dtotataotd"
},
{
"input": "rxxxrrxrxxxxxrrrrrxxxxrrrrxrxxrxxrxrxrrrxrrxrrxrxxxrxrrxrrxrxrxxxxxrxxxxrrrxrxxrxxrxxxrrrrrxrrxrrxrr",
"output": "rxaxraxrxaxaxrararxaxararaxrxarxarxrxrarxraxraxrxaxrxraxraxrxrxaxaxrxaxararxrxarxarxaxrararxraxraxra"
},
{
"input": "aazz",
"output": "baza"
},
{
"input": "zz",
"output": "za"
},
{
"input": "gg",
"output": "ga"
},
{
"input": "qasdasd",
"output": "qasdasd"
},
{
"input": "aa",
"output": "ba"
},
{
"input": "ab",
"output": "ab"
},
{
"input": "zza",
"output": "zba"
},
{
"input": "g",
"output": "g"
},
{
"input": "nnop",
"output": "naop"
},
{
"input": "xx",
"output": "xa"
}
] | 1,592,067,248
| 4,148
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 6
| 124
| 0
|
# t = int(input())
t = 1
for j in range(t):
s = list(input())
n = len(s)
for i in range(1,n):
if(s[i] == s[i-1]):
if(i<(n-1)):
if(s[i] == s[i+1]):
s[i] = chr((ord(s[i])+1 - ord('a'))%26 + ord('a'))
else:
s[i] = chr((ord(s[i])+1 - ord('a'))%26 + ord('a'))
if(s[i] == s[i+1]):
s[i] = chr((ord(s[i])+1 - ord('a'))%26 + ord('a'))
else:
s[i] = chr((ord(s[i])+1)%26)
print(''.join(s))
|
Title: Simple Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
Input Specification:
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
Output Specification:
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
Demo Input:
['aab\n', 'caaab\n', 'zscoder\n']
Demo Output:
['bab\n', 'cabab\n', 'zscoder\n']
Note:
none
|
```python
# t = int(input())
t = 1
for j in range(t):
s = list(input())
n = len(s)
for i in range(1,n):
if(s[i] == s[i-1]):
if(i<(n-1)):
if(s[i] == s[i+1]):
s[i] = chr((ord(s[i])+1 - ord('a'))%26 + ord('a'))
else:
s[i] = chr((ord(s[i])+1 - ord('a'))%26 + ord('a'))
if(s[i] == s[i+1]):
s[i] = chr((ord(s[i])+1 - ord('a'))%26 + ord('a'))
else:
s[i] = chr((ord(s[i])+1)%26)
print(''.join(s))
```
| 0
|
|
262
|
A
|
Roma and Lucky Numbers
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers.
Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem.
|
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has.
The numbers in the lines are separated by single spaces.
|
In a single line print a single integer — the answer to the problem.
|
[
"3 4\n1 2 4\n",
"3 2\n447 44 77\n"
] |
[
"3\n",
"2\n"
] |
In the first sample all numbers contain at most four lucky digits, so the answer is 3.
In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
| 500
|
[
{
"input": "3 4\n1 2 4",
"output": "3"
},
{
"input": "3 2\n447 44 77",
"output": "2"
},
{
"input": "2 2\n507978501 180480073",
"output": "2"
},
{
"input": "9 6\n655243746 167613748 1470546 57644035 176077477 56984809 44677 215706823 369042089",
"output": "9"
},
{
"input": "6 100\n170427799 37215529 675016434 168544291 683447134 950090227",
"output": "6"
},
{
"input": "4 2\n194041605 706221269 69909135 257655784",
"output": "3"
},
{
"input": "4 2\n9581849 67346651 530497 272158241",
"output": "4"
},
{
"input": "3 47\n378261451 163985731 230342101",
"output": "3"
},
{
"input": "2 3\n247776868 480572137",
"output": "1"
},
{
"input": "7 77\n366496749 549646417 278840199 119255907 33557677 379268590 150378796",
"output": "7"
},
{
"input": "40 31\n32230963 709031779 144328646 513494529 36547831 416998222 84161665 318773941 170724397 553666286 368402971 48581613 31452501 368026285 47903381 939151438 204145360 189920160 288159400 133145006 314295423 450219949 160203213 358403181 478734385 29331901 31051111 110710191 567314089 139695685 111511396 87708701 317333277 103301481 110400517 634446253 481551313 39202255 105948 738066085",
"output": "40"
},
{
"input": "1 8\n55521105",
"output": "1"
},
{
"input": "49 3\n34644511 150953622 136135827 144208961 359490601 86708232 719413689 188605873 64330753 488776302 104482891 63360106 437791390 46521319 70778345 339141601 136198441 292941209 299339510 582531183 555958105 437904637 74219097 439816011 236010407 122674666 438442529 186501223 63932449 407678041 596993853 92223251 849265278 480265849 30983497 330283357 186901672 20271344 794252593 123774176 27851201 52717531 479907210 196833889 149331196 82147847 255966471 278600081 899317843",
"output": "44"
},
{
"input": "26 2\n330381357 185218042 850474297 483015466 296129476 1205865 538807493 103205601 160403321 694220263 416255901 7245756 507755361 88187633 91426751 1917161 58276681 59540376 576539745 595950717 390256887 105690055 607818885 28976353 488947089 50643601",
"output": "22"
},
{
"input": "38 1\n194481717 126247087 815196361 106258801 381703249 283859137 15290101 40086151 213688513 577996947 513899717 371428417 107799271 11136651 5615081 323386401 381128815 34217126 17709913 520702093 201694245 570931849 169037023 417019726 282437316 7417126 271667553 11375851 185087449 410130883 383045677 5764771 905017051 328584026 215330671 299553233 15838255 234532105",
"output": "20"
},
{
"input": "44 9\n683216389 250581469 130029957 467020047 188395565 206237982 63257361 68314981 732878407 563579660 199133851 53045209 665723851 16273169 10806790 556633156 350593410 474645249 478790761 708234243 71841230 18090541 19836685 146373571 17947452 534010506 46933264 377035021 311636557 75193963 54321761 12759959 71120181 548816939 23608621 31876417 107672995 72575155 369667956 20574379 210596751 532163173 75726739 853719629",
"output": "44"
},
{
"input": "8 6\n204157376 10514197 65483881 347219841 263304577 296402721 11739011 229776191",
"output": "8"
},
{
"input": "38 29\n333702889 680931737 61137217 203030505 68728281 11414209 642645708 590904616 3042901 607198177 189041074 700764043 813035201 198341461 126403544 401436841 420826465 45046581 20249976 46978855 46397957 706610773 24701041 57954481 51603266 593109701 385569073 178982291 582152863 287317968 1474090 34825141 432421977 130257781 151516903 540852403 548392 117246529",
"output": "38"
},
{
"input": "19 3\n562569697 549131571 50676718 84501863 74567295 702372009 365895280 451459937 40378543 167666701 158635641 53639293 442332661 825055617 100109161 326616021 862332843 533271196 4791547",
"output": "18"
},
{
"input": "1 1\n44",
"output": "0"
},
{
"input": "1 1\n4",
"output": "1"
},
{
"input": "10 3\n444 447 774 777 7777 4447 4 7 7 4",
"output": "8"
}
] | 1,615,391,633
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 34
| 154
| 0
|
n,k=map(int,input().split())
c=0
num=map(int,input().split())
for i in list(num):
if list(str(i)).count('7')+list(str(i)).count('4')<=k:
c+=1
print(c)
|
Title: Roma and Lucky Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Roma (a popular Russian name that means 'Roman') loves the Little Lvov Elephant's lucky numbers.
Let us remind you that lucky numbers are positive integers whose decimal representation only contains lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Roma's got *n* positive integers. He wonders, how many of those integers have not more than *k* lucky digits? Help him, write the program that solves the problem.
Input Specification:
The first line contains two integers *n*, *k* (1<=≤<=*n*,<=*k*<=≤<=100). The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=109) — the numbers that Roma has.
The numbers in the lines are separated by single spaces.
Output Specification:
In a single line print a single integer — the answer to the problem.
Demo Input:
['3 4\n1 2 4\n', '3 2\n447 44 77\n']
Demo Output:
['3\n', '2\n']
Note:
In the first sample all numbers contain at most four lucky digits, so the answer is 3.
In the second sample number 447 doesn't fit in, as it contains more than two lucky digits. All other numbers are fine, so the answer is 2.
|
```python
n,k=map(int,input().split())
c=0
num=map(int,input().split())
for i in list(num):
if list(str(i)).count('7')+list(str(i)).count('4')<=k:
c+=1
print(c)
```
| 3
|
|
902
|
A
|
Visiting a Friend
|
PROGRAMMING
| 1,100
|
[
"greedy",
"implementation"
] | null | null |
Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*).
|
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
|
[
"3 5\n0 2\n2 4\n3 5\n",
"3 7\n0 4\n2 5\n6 7\n"
] |
[
"YES\n",
"NO\n"
] |
The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports.
| 500
|
[
{
"input": "3 5\n0 2\n2 4\n3 5",
"output": "YES"
},
{
"input": "3 7\n0 4\n2 5\n6 7",
"output": "NO"
},
{
"input": "1 1\n0 0",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 8\n8 8\n9 9\n9 9\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 100\n71 73\n80 94\n81 92\n84 85\n85 100\n88 91\n91 95\n92 98\n92 98\n99 100\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 6\n1 6\n1 2\n1 3\n1 2\n1 3\n2 5\n2 4\n2 3\n2 4\n2 6\n2 2\n2 5\n2 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 9\n3 3\n3 7\n3 9\n3 3\n3 9\n4 6\n4 7\n4 5\n4 7\n5 8\n5 5\n5 9\n5 7\n5 5\n6 6\n6 9\n6 7\n6 8\n6 9\n6 8\n7 7\n7 8\n7 7\n7 8\n8 9\n8 8\n8 9\n8 8\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 10\n0 7\n1 2\n1 2\n1 4\n1 4\n1 3\n2 2\n2 4\n2 6\n2 9\n2 2\n3 5\n3 8\n4 8\n4 5\n4 6\n5 6\n5 7\n6 6\n6 9\n6 7\n6 9\n7 7\n7 7\n8 10\n8 10\n9 9\n9 9\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 100\n1 38\n2 82\n5 35\n7 71\n8 53\n11 49\n15 27\n17 84\n17 75\n18 99\n18 43\n18 69\n21 89\n27 60\n27 29\n38 62\n38 77\n39 83\n40 66\n48 80\n48 100\n50 51\n50 61\n53 77\n53 63\n55 58\n56 68\n60 82\n62 95\n66 74\n67 83\n69 88\n69 81\n69 88\n69 98\n70 91\n70 76\n71 90\n72 99\n81 99\n85 87\n88 97\n88 93\n90 97\n90 97\n92 98\n98 99\n100 100",
"output": "YES"
},
{
"input": "70 10\n0 4\n0 4\n0 8\n0 9\n0 1\n0 5\n0 7\n1 3\n1 8\n1 8\n1 10\n1 9\n1 6\n1 2\n1 3\n1 2\n2 6\n2 5\n2 4\n2 3\n2 10\n2 2\n2 6\n2 2\n3 10\n3 7\n3 7\n3 4\n3 7\n3 4\n3 8\n3 4\n3 10\n3 5\n3 3\n3 7\n4 8\n4 8\n4 9\n4 6\n5 7\n5 10\n5 7\n5 8\n5 5\n6 8\n6 9\n6 10\n6 6\n6 9\n6 7\n7 8\n7 9\n7 10\n7 10\n8 8\n8 8\n8 9\n8 10\n9 10\n9 9\n9 10\n9 10\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 4\n1 5\n1 9\n1 1\n1 6\n1 6\n2 5\n2 7\n2 7\n2 7\n2 7\n3 4\n3 7\n3 9\n3 5\n3 3\n4 4\n4 6\n4 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n5 8\n5 9\n5 8\n6 8\n6 7\n6 8\n6 9\n6 9\n6 6\n6 9\n6 7\n7 7\n7 7\n7 7\n7 8\n7 7\n7 8\n7 8\n7 9\n8 8\n8 8\n8 8\n8 8\n8 8\n8 9\n8 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 40\n38 38\n40 40",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 92\n92 97\n96 99\n97 98\n97 99\n99 99\n100 100\n100 100\n100 100",
"output": "NO"
},
{
"input": "1 10\n0 10",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 40\n23 23\n23 28\n24 29\n25 38\n26 35\n27 37\n28 39\n28 33\n28 40\n28 33\n29 31\n29 33\n30 38\n30 36\n30 30\n30 38\n31 37\n31 35\n31 32\n31 36\n33 39\n33 40\n35 38\n36 38\n37 38\n37 40\n38 39\n38 40\n38 39\n39 39\n39 40\n40 40\n40 40\n40 40\n40 40",
"output": "YES"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 40\n11 31\n12 26\n13 25\n14 32\n17 19\n21 29\n22 36\n24 27\n25 39\n25 27\n27 32\n27 29\n27 39\n27 29\n28 38\n30 38\n32 40\n32 38\n33 33\n33 40\n34 35\n34 34\n34 38\n34 38\n35 37\n36 39\n36 39\n37 37\n38 40\n39 39\n40 40",
"output": "YES"
},
{
"input": "70 40\n0 34\n1 16\n3 33\n4 36\n4 22\n5 9\n5 9\n7 16\n8 26\n9 29\n9 25\n10 15\n10 22\n10 29\n10 20\n11 27\n11 26\n11 12\n12 19\n13 21\n14 31\n14 36\n15 34\n15 37\n16 21\n17 31\n18 22\n20 27\n20 32\n20 20\n20 29\n21 29\n21 34\n21 30\n22 22\n23 28\n23 39\n24 24\n25 27\n26 38\n27 39\n28 33\n28 39\n28 34\n28 33\n29 30\n29 35\n30 30\n30 38\n30 34\n30 31\n31 36\n31 31\n31 32\n31 38\n33 34\n33 34\n35 36\n36 38\n37 38\n37 39\n38 38\n38 38\n38 38\n39 39\n39 39\n40 40\n40 40\n40 40\n40 40",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n88 99",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 10\n7 10\n9 10",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 5\n4 8\n5 5\n5 7\n6 7\n6 6\n7 7\n7 7\n7 7\n7 8\n7 8\n8 8\n8 8\n8 9\n8 8\n8 9\n9 9\n9 9\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "NO"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n32 37",
"output": "NO"
},
{
"input": "50 10\n0 2\n0 2\n0 6\n1 9\n1 3\n1 2\n1 6\n1 1\n1 1\n2 7\n2 6\n2 4\n3 9\n3 8\n3 8\n3 8\n3 6\n3 4\n3 7\n3 4\n3 6\n3 10\n4 6\n5 9\n5 5\n6 7\n6 10\n7 8\n7 7\n7 7\n7 7\n7 10\n8 8\n8 8\n8 10\n8 8\n8 8\n9 10\n9 10\n9 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "1 1\n0 1",
"output": "YES"
},
{
"input": "30 40\n0 0\n4 8\n5 17\n7 32\n7 16\n8 16\n10 19\n12 22\n12 27\n13 21\n13 28\n13 36\n14 28\n14 18\n18 21\n21 26\n21 36\n22 38\n23 32\n24 30\n26 35\n29 32\n29 32\n31 34\n31 31\n33 33\n33 35\n35 36\n38 38\n40 40",
"output": "NO"
},
{
"input": "30 100\n0 27\n4 82\n11 81\n14 32\n33 97\n33 34\n37 97\n38 52\n45 91\n49 56\n50 97\n57 70\n59 94\n59 65\n62 76\n64 65\n65 95\n67 77\n68 82\n71 94\n80 90\n81 88\n84 93\n85 89\n88 92\n91 97\n92 99\n92 97\n99 99\n100 100",
"output": "NO"
},
{
"input": "10 100\n0 34\n8 56\n17 79\n24 88\n28 79\n45 79\n48 93\n55 87\n68 93\n79 100",
"output": "YES"
},
{
"input": "10 40\n0 21\n1 19\n4 33\n6 26\n8 39\n15 15\n20 24\n27 27\n29 39\n37 40",
"output": "YES"
},
{
"input": "85 10\n0 9\n0 4\n0 2\n0 5\n0 1\n0 8\n0 7\n1 2\n1 10\n1 2\n1 5\n1 10\n1 8\n1 1\n2 8\n2 7\n2 5\n2 5\n2 7\n3 5\n3 7\n3 5\n3 4\n3 7\n4 7\n4 8\n4 6\n5 7\n5 10\n5 5\n5 6\n5 6\n5 6\n5 6\n5 7\n5 8\n5 5\n5 7\n6 10\n6 9\n6 7\n6 10\n6 8\n6 7\n6 10\n6 10\n7 8\n7 9\n7 8\n7 8\n7 8\n7 8\n7 7\n7 7\n8 8\n8 8\n8 10\n8 9\n8 9\n8 9\n8 9\n9 9\n9 10\n9 9\n9 9\n9 9\n9 9\n9 10\n9 10\n9 9\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10\n10 10",
"output": "YES"
},
{
"input": "50 100\n0 95\n1 7\n1 69\n2 83\n5 67\n7 82\n8 31\n11 25\n15 44\n17 75\n17 27\n18 43\n18 69\n18 40\n21 66\n27 29\n27 64\n38 77\n38 90\n39 52\n40 60\n48 91\n48 98\n50 89\n50 63\n53 54\n53 95\n55 76\n56 59\n60 96\n62 86\n66 70\n67 77\n69 88\n69 98\n69 80\n69 95\n70 74\n70 77\n71 99\n72 73\n81 87\n85 99\n88 96\n88 91\n90 97\n90 99\n92 92\n98 99\n100 100",
"output": "NO"
},
{
"input": "50 40\n0 9\n1 26\n1 27\n2 33\n2 5\n3 30\n4 28\n5 31\n5 27\n5 29\n7 36\n8 32\n8 13\n9 24\n10 10\n10 30\n11 26\n11 22\n11 35\n11 23\n12 36\n13 31\n14 31\n17 17\n21 25\n22 33\n24 26\n25 32\n25 25\n27 39\n27 29\n27 34\n27 32\n28 34\n30 36\n32 37\n32 33\n33 35\n33 33\n34 38\n34 38\n34 36\n34 36\n35 36\n36 36\n36 39\n37 37\n38 39\n39 39\n40 40",
"output": "NO"
},
{
"input": "10 10\n0 2\n3 8\n3 5\n3 3\n3 9\n3 8\n5 7\n6 9\n7 7\n9 9",
"output": "NO"
},
{
"input": "70 100\n0 99\n1 87\n1 94\n1 4\n2 72\n3 39\n3 69\n4 78\n5 85\n7 14\n8 59\n12 69\n14 15\n14 76\n17 17\n19 53\n19 57\n19 21\n21 35\n21 83\n24 52\n24 33\n27 66\n27 97\n30 62\n30 74\n30 64\n32 63\n35 49\n37 60\n40 99\n40 71\n41 83\n42 66\n42 46\n45 83\n51 76\n53 69\n54 82\n54 96\n54 88\n55 91\n56 88\n58 62\n62 87\n64 80\n67 90\n67 69\n68 92\n72 93\n74 93\n77 79\n77 91\n78 97\n78 98\n81 85\n81 83\n81 83\n84 85\n86 88\n89 94\n89 100\n92 97\n96 96\n97 98\n97 100\n99 100\n100 100\n100 100\n100 100",
"output": "YES"
},
{
"input": "2 2\n0 2\n0 1",
"output": "YES"
},
{
"input": "2 100\n0 49\n50 100",
"output": "NO"
},
{
"input": "2 100\n0 50\n50 100",
"output": "YES"
},
{
"input": "10 100\n0 10\n10 20\n20 30\n30 40\n40 50\n50 60\n60 70\n70 80\n80 90\n90 100",
"output": "YES"
},
{
"input": "100 10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 10",
"output": "YES"
},
{
"input": "1 4\n1 4",
"output": "NO"
},
{
"input": "3 5\n0 2\n2 5\n3 4",
"output": "YES"
},
{
"input": "2 5\n0 5\n1 2",
"output": "YES"
},
{
"input": "5 5\n0 2\n0 2\n3 5\n3 5\n3 5",
"output": "NO"
},
{
"input": "4 10\n0 3\n2 10\n4 10\n5 7",
"output": "YES"
},
{
"input": "3 8\n0 0\n1 8\n2 8",
"output": "NO"
},
{
"input": "6 8\n0 3\n1 5\n2 3\n5 6\n6 7\n7 8",
"output": "YES"
}
] | 1,629,639,696
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 55
| 124
| 20,172,800
|
n,m = [int(i) for i in input().split()]
lis = []
for j in range(n):
a,b = [int(i) for i in input().split()]
lis.append((a,b))
reach = 0
lis.sort()
for a,b in lis:
if a <= reach<=b:
reach = max(reach,b)
if reach == m:
print('YES')
else:
print('NO')
|
Title: Visiting a Friend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pig is visiting a friend.
Pig's house is located at point 0, and his friend's house is located at point *m* on an axis.
Pig can use teleports to move along the axis.
To use a teleport, Pig should come to a certain point (where the teleport is located) and choose where to move: for each teleport there is the rightmost point it can move Pig to, this point is known as the limit of the teleport.
Formally, a teleport located at point *x* with limit *y* can move Pig from point *x* to any point within the segment [*x*;<=*y*], including the bounds.
Determine if Pig can visit the friend using teleports only, or he should use his car.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100,<=1<=≤<=*m*<=≤<=100) — the number of teleports and the location of the friend's house.
The next *n* lines contain information about teleports.
The *i*-th of these lines contains two integers *a**i* and *b**i* (0<=≤<=*a**i*<=≤<=*b**i*<=≤<=*m*), where *a**i* is the location of the *i*-th teleport, and *b**i* is its limit.
It is guaranteed that *a**i*<=≥<=*a**i*<=-<=1 for every *i* (2<=≤<=*i*<=≤<=*n*).
Output Specification:
Print "YES" if there is a path from Pig's house to his friend's house that uses only teleports, and "NO" otherwise.
You can print each letter in arbitrary case (upper or lower).
Demo Input:
['3 5\n0 2\n2 4\n3 5\n', '3 7\n0 4\n2 5\n6 7\n']
Demo Output:
['YES\n', 'NO\n']
Note:
The first example is shown on the picture below:
Pig can use the first teleport from his house (point 0) to reach point 2, then using the second teleport go from point 2 to point 3, then using the third teleport go from point 3 to point 5, where his friend lives.
The second example is shown on the picture below:
You can see that there is no path from Pig's house to his friend's house that uses only teleports.
|
```python
n,m = [int(i) for i in input().split()]
lis = []
for j in range(n):
a,b = [int(i) for i in input().split()]
lis.append((a,b))
reach = 0
lis.sort()
for a,b in lis:
if a <= reach<=b:
reach = max(reach,b)
if reach == m:
print('YES')
else:
print('NO')
```
| 3
|
|
500
|
A
|
New Year Transportation
|
PROGRAMMING
| 1,000
|
[
"dfs and similar",
"graphs",
"implementation"
] | null | null |
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
|
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
|
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
|
[
"8 4\n1 2 1 2 1 2 1\n",
"8 5\n1 2 1 2 1 1 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
| 500
|
[
{
"input": "8 4\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "8 5\n1 2 1 2 1 1 1",
"output": "NO"
},
{
"input": "20 19\n13 16 7 6 12 1 5 7 8 6 5 7 5 5 3 3 2 2 1",
"output": "YES"
},
{
"input": "50 49\n11 7 1 41 26 36 19 16 38 14 36 35 37 27 20 27 3 6 21 2 27 11 18 17 19 16 22 8 8 9 1 7 5 12 5 6 13 6 11 2 6 3 1 5 1 1 2 2 1",
"output": "YES"
},
{
"input": "120 104\n41 15 95 85 34 11 25 42 65 39 77 80 74 17 66 73 21 14 36 63 63 79 45 24 65 7 63 80 51 21 2 19 78 28 71 2 15 23 17 68 62 18 54 39 43 70 3 46 34 23 41 65 32 10 13 18 10 3 16 48 54 18 57 28 3 24 44 50 15 2 20 22 45 44 3 29 2 27 11 2 12 25 25 31 1 2 32 4 11 30 13 16 26 21 1 13 21 8 15 5 18 13 5 15 3 8 13 6 5 1 9 7 1 2 4 1 1 2 1",
"output": "NO"
},
{
"input": "10 3\n8 3 5 4 2 3 2 2 1",
"output": "NO"
},
{
"input": "10 9\n8 3 5 4 2 3 2 2 1",
"output": "YES"
},
{
"input": "3 2\n1 1",
"output": "YES"
},
{
"input": "3 2\n2 1",
"output": "NO"
},
{
"input": "4 2\n2 1 1",
"output": "NO"
},
{
"input": "4 4\n2 2 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 2 1",
"output": "YES"
},
{
"input": "3 3\n1 1",
"output": "YES"
},
{
"input": "8 8\n1 2 1 2 1 1 1",
"output": "YES"
},
{
"input": "3 3\n2 1",
"output": "YES"
},
{
"input": "4 4\n1 1 1",
"output": "YES"
},
{
"input": "8 8\n1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "5 5\n1 1 1 1",
"output": "YES"
}
] | 1,642,780,777
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 34
| 109
| 5,324,800
|
C,T=map(int,input().split())
P=list(map(int,input().split()))
S=1
while S<C:
S+=P[S-1]
if S==T:print("YES");exit(0)
print("NO")
|
Title: New Year Transportation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
New Year is coming in Line World! In this world, there are *n* cells numbered by integers from 1 to *n*, as a 1<=×<=*n* board. People live in cells. However, it was hard to move between distinct cells, because of the difficulty of escaping the cell. People wanted to meet people who live in other cells.
So, user tncks0121 has made a transportation system to move between these cells, to celebrate the New Year. First, he thought of *n*<=-<=1 positive integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1. For every integer *i* where 1<=≤<=*i*<=≤<=*n*<=-<=1 the condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* holds. Next, he made *n*<=-<=1 portals, numbered by integers from 1 to *n*<=-<=1. The *i*-th (1<=≤<=*i*<=≤<=*n*<=-<=1) portal connects cell *i* and cell (*i*<=+<=*a**i*), and one can travel from cell *i* to cell (*i*<=+<=*a**i*) using the *i*-th portal. Unfortunately, one cannot use the portal backwards, which means one cannot move from cell (*i*<=+<=*a**i*) to cell *i* using the *i*-th portal. It is easy to see that because of condition 1<=≤<=*a**i*<=≤<=*n*<=-<=*i* one can't leave the Line World using portals.
Currently, I am standing at cell 1, and I want to go to cell *t*. However, I don't know whether it is possible to go there. Please determine whether I can go to cell *t* by only using the construted transportation system.
Input Specification:
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=3<=×<=104) and *t* (2<=≤<=*t*<=≤<=*n*) — the number of cells, and the index of the cell which I want to go to.
The second line contains *n*<=-<=1 space-separated integers *a*1,<=*a*2,<=...,<=*a**n*<=-<=1 (1<=≤<=*a**i*<=≤<=*n*<=-<=*i*). It is guaranteed, that using the given transportation system, one cannot leave the Line World.
Output Specification:
If I can go to cell *t* using the transportation system, print "YES". Otherwise, print "NO".
Demo Input:
['8 4\n1 2 1 2 1 2 1\n', '8 5\n1 2 1 2 1 1 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, the visited cells are: 1, 2, 4; so we can successfully visit the cell 4.
In the second sample, the possible cells to visit are: 1, 2, 4, 6, 7, 8; so we can't visit the cell 5, which we want to visit.
|
```python
C,T=map(int,input().split())
P=list(map(int,input().split()))
S=1
while S<C:
S+=P[S-1]
if S==T:print("YES");exit(0)
print("NO")
```
| 3
|
|
869
|
B
|
The Eternal Immortality
|
PROGRAMMING
| 1,100
|
[
"math"
] | null | null |
Even if the world is full of counterfeits, I still regard it as wonderful.
Pile up herbs and incense, and arise again from the flames and ashes of its predecessor — as is known to many, the phoenix does it like this.
The phoenix has a rather long lifespan, and reincarnates itself once every *a*! years. Here *a*! denotes the factorial of integer *a*, that is, *a*!<==<=1<=×<=2<=×<=...<=×<=*a*. Specifically, 0!<==<=1.
Koyomi doesn't care much about this, but before he gets into another mess with oddities, he is interested in the number of times the phoenix will reincarnate in a timespan of *b*! years, that is, . Note that when *b*<=≥<=*a* this value is always integer.
As the answer can be quite large, it would be enough for Koyomi just to know the last digit of the answer in decimal representation. And you're here to provide Koyomi with this knowledge.
|
The first and only line of input contains two space-separated integers *a* and *b* (0<=≤<=*a*<=≤<=*b*<=≤<=1018).
|
Output one line containing a single decimal digit — the last digit of the value that interests Koyomi.
|
[
"2 4\n",
"0 10\n",
"107 109\n"
] |
[
"2\n",
"0\n",
"2\n"
] |
In the first example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/99c47ca8b182f097e38094d12f0c06ce0b081b76.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2;
In the second example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9642ef11a23e7c5a3f3c2b1255c1b1b3533802a4.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 0;
In the third example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/844938cef52ee264c183246d2a9df05cca94dc60.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
| 1,000
|
[
{
"input": "2 4",
"output": "2"
},
{
"input": "0 10",
"output": "0"
},
{
"input": "107 109",
"output": "2"
},
{
"input": "10 13",
"output": "6"
},
{
"input": "998244355 998244359",
"output": "4"
},
{
"input": "999999999000000000 1000000000000000000",
"output": "0"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "3 15",
"output": "0"
},
{
"input": "24 26",
"output": "0"
},
{
"input": "14 60",
"output": "0"
},
{
"input": "11 79",
"output": "0"
},
{
"input": "1230 1232",
"output": "2"
},
{
"input": "2633 2634",
"output": "4"
},
{
"input": "535 536",
"output": "6"
},
{
"input": "344319135 396746843",
"output": "0"
},
{
"input": "696667767 696667767",
"output": "1"
},
{
"input": "419530302 610096911",
"output": "0"
},
{
"input": "238965115 821731161",
"output": "0"
},
{
"input": "414626436 728903812",
"output": "0"
},
{
"input": "274410639 293308324",
"output": "0"
},
{
"input": "650636673091305697 650636673091305702",
"output": "0"
},
{
"input": "651240548333620923 651240548333620924",
"output": "4"
},
{
"input": "500000000000000000 1000000000000000000",
"output": "0"
},
{
"input": "999999999999999999 1000000000000000000",
"output": "0"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "1"
},
{
"input": "0 4",
"output": "4"
},
{
"input": "50000000062000007 50000000062000011",
"output": "0"
},
{
"input": "0 0",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "0 2",
"output": "2"
},
{
"input": "10000000000012 10000000000015",
"output": "0"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "12 23",
"output": "0"
},
{
"input": "0 11",
"output": "0"
},
{
"input": "11111234567890 11111234567898",
"output": "0"
},
{
"input": "0 3",
"output": "6"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "999999999999999997 999999999999999999",
"output": "2"
},
{
"input": "4 5",
"output": "5"
},
{
"input": "0 1",
"output": "1"
},
{
"input": "101 1002",
"output": "0"
},
{
"input": "0 100000000000000001",
"output": "0"
},
{
"input": "99999999999999997 99999999999999999",
"output": "2"
},
{
"input": "14 15",
"output": "5"
},
{
"input": "8 19",
"output": "0"
},
{
"input": "12 22",
"output": "0"
},
{
"input": "999999999999996 999999999999999",
"output": "4"
},
{
"input": "1 3",
"output": "6"
},
{
"input": "124 125",
"output": "5"
},
{
"input": "11 32",
"output": "0"
},
{
"input": "0 5",
"output": "0"
},
{
"input": "0 999999",
"output": "0"
},
{
"input": "151151151515 151151151526",
"output": "0"
},
{
"input": "6 107",
"output": "0"
},
{
"input": "5 16",
"output": "0"
},
{
"input": "7 16",
"output": "0"
},
{
"input": "6 19",
"output": "0"
},
{
"input": "11113111111111 13111111111111",
"output": "0"
},
{
"input": "1 1000",
"output": "0"
},
{
"input": "24 25",
"output": "5"
},
{
"input": "0 100000000000",
"output": "0"
},
{
"input": "1 22",
"output": "0"
},
{
"input": "999999999999999996 999999999999999999",
"output": "4"
}
] | 1,531,702,106
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
#include <bits/stdc++.h>
#define debug(x) std::cerr << #x" = " << (x) << std::endl
typedef long long LL;
int main() {
//int T = 0;
//for (LL a = scanf("%d", &T), b = 0; T--; ) {
scanf("%I64d%I64d", &a, &b);
if (b - a >= 5) puts("0");
else {
int x = 1;
for (LL i = a + 1; i <= b; i++) x = x * (a % 10) % 10;
printf("%d\n", x);
}
//}
return 0;
}
|
Title: The Eternal Immortality
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Even if the world is full of counterfeits, I still regard it as wonderful.
Pile up herbs and incense, and arise again from the flames and ashes of its predecessor — as is known to many, the phoenix does it like this.
The phoenix has a rather long lifespan, and reincarnates itself once every *a*! years. Here *a*! denotes the factorial of integer *a*, that is, *a*!<==<=1<=×<=2<=×<=...<=×<=*a*. Specifically, 0!<==<=1.
Koyomi doesn't care much about this, but before he gets into another mess with oddities, he is interested in the number of times the phoenix will reincarnate in a timespan of *b*! years, that is, . Note that when *b*<=≥<=*a* this value is always integer.
As the answer can be quite large, it would be enough for Koyomi just to know the last digit of the answer in decimal representation. And you're here to provide Koyomi with this knowledge.
Input Specification:
The first and only line of input contains two space-separated integers *a* and *b* (0<=≤<=*a*<=≤<=*b*<=≤<=1018).
Output Specification:
Output one line containing a single decimal digit — the last digit of the value that interests Koyomi.
Demo Input:
['2 4\n', '0 10\n', '107 109\n']
Demo Output:
['2\n', '0\n', '2\n']
Note:
In the first example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/99c47ca8b182f097e38094d12f0c06ce0b081b76.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2;
In the second example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/9642ef11a23e7c5a3f3c2b1255c1b1b3533802a4.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 0;
In the third example, the last digit of <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/844938cef52ee264c183246d2a9df05cca94dc60.png" style="max-width: 100.0%;max-height: 100.0%;"/> is 2.
|
```python
#include <bits/stdc++.h>
#define debug(x) std::cerr << #x" = " << (x) << std::endl
typedef long long LL;
int main() {
//int T = 0;
//for (LL a = scanf("%d", &T), b = 0; T--; ) {
scanf("%I64d%I64d", &a, &b);
if (b - a >= 5) puts("0");
else {
int x = 1;
for (LL i = a + 1; i <= b; i++) x = x * (a % 10) % 10;
printf("%d\n", x);
}
//}
return 0;
}
```
| -1
|
|
4
|
A
|
Watermelon
|
PROGRAMMING
| 800
|
[
"brute force",
"math"
] |
A. Watermelon
|
1
|
64
|
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
|
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
|
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
|
[
"8\n"
] |
[
"YES\n"
] |
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
| 0
|
[
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,689,315,652
| 2,147,483,647
|
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0
| 0
| 0
|
w = int(input("Enter weight of watermelon:"))
if w>=1 and w<=100:
a=w-2
if a%2==0 and a!=0:
print("Yes")
else:
print("No")
else:
print("No")
|
Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos).
|
```python
w = int(input("Enter weight of watermelon:"))
if w>=1 and w<=100:
a=w-2
if a%2==0 and a!=0:
print("Yes")
else:
print("No")
else:
print("No")
```
| -1
|
120
|
J
|
Minimum Sum
|
PROGRAMMING
| 1,900
|
[
"divide and conquer",
"geometry",
"sortings"
] | null | null |
You are given a set of *n* vectors on a plane. For each vector you are allowed to multiply any of its coordinates by -1. Thus, each vector *v**i*<==<=(*x**i*,<=*y**i*) can be transformed into one of the following four vectors:
- *v**i*1<==<=(*x**i*,<=*y**i*), - *v**i*2<==<=(<=-<=*x**i*,<=*y**i*), - *v**i*3<==<=(*x**i*,<=<=-<=*y**i*), - *v**i*4<==<=(<=-<=*x**i*,<=<=-<=*y**i*).
You should find two vectors from the set and determine which of their coordinates should be multiplied by -1 so that the absolute value of the sum of the resulting vectors was minimally possible. More formally, you should choose two vectors *v**i*, *v**j* (1<=≤<=*i*,<=*j*<=≤<=*n*,<=*i*<=≠<=*j*) and two numbers *k*1, *k*2 (1<=≤<=*k*1,<=*k*2<=≤<=4), so that the value of the expression |*v**i**k*1<=+<=*v**j**k*2| were minimum.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105). Then *n* lines contain vectors as pairs of integers "*x**i* *y**i*" (<=-<=10000<=≤<=*x**i*,<=*y**i*<=≤<=10000), one pair per line.
|
Print on the first line four space-separated numbers "*i* *k*1 *j* *k*2" — the answer to the problem. If there are several variants the absolute value of whose sums is minimum, you can print any of them.
|
[
"5\n-7 -3\n9 0\n-8 6\n7 -8\n4 -5\n",
"5\n3 2\n-4 7\n-6 0\n-8 4\n5 1\n"
] |
[
"3 2 4 2\n",
"3 4 5 4\n"
] |
A sum of two vectors *v* = (*x*<sub class="lower-index">*v*</sub>, *y*<sub class="lower-index">*v*</sub>) and *u* = (*x*<sub class="lower-index">*u*</sub>, *y*<sub class="lower-index">*u*</sub>) is vector *s* = *v* + *u* = (*x*<sub class="lower-index">*v*</sub> + *x*<sub class="lower-index">*u*</sub>, *y*<sub class="lower-index">*v*</sub> + *y*<sub class="lower-index">*u*</sub>).
An absolute value of vector *v* = (*x*, *y*) is number <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d6c16bed0f57e40cf156237736f342487ab25fb8.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample there are several valid answers, such as:
(3 1 4 2), (3 1 4 4), (3 4 4 1), (3 4 4 3), (4 1 3 2), (4 1 3 4), (4 2 3 1).
| 0
|
[
{
"input": "5\n-7 -3\n9 0\n-8 6\n7 -8\n4 -5",
"output": "3 2 4 2"
},
{
"input": "5\n3 2\n-4 7\n-6 0\n-8 4\n5 1",
"output": "3 4 5 4"
},
{
"input": "2\n-4 -2\n-2 1",
"output": "1 4 2 3"
},
{
"input": "3\n-4 -3\n-4 -5\n-1 0",
"output": "2 4 1 1"
},
{
"input": "10\n53 86\n-48 72\n-74 48\n75 -91\n-31 14\n13 67\n24 -55\n-76 -67\n86 5\n-84 94",
"output": "10 2 4 2"
},
{
"input": "10\n-65 29\n77 29\n74 -54\n-79 -65\n43 46\n-12 -92\n9 88\n28 6\n-63 49\n-37 17",
"output": "6 4 7 4"
},
{
"input": "10\n-58 72\n76 -39\n-28 19\n93 10\n-84 -97\n88 99\n69 30\n-43 53\n65 67\n-15 -60",
"output": "6 1 5 1"
},
{
"input": "10\n75 15\n0 69\n-6 -83\n-86 61\n91 87\n87 -60\n3 -78\n61 -75\n17 60\n-67 14",
"output": "6 3 4 3"
}
] | 1,689,182,422
| 2,147,483,647
|
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0
| 60
| 0
|
print("_RANDOM_GUESS_1689182421.9801211")# 1689182421.980157
|
Title: Minimum Sum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a set of *n* vectors on a plane. For each vector you are allowed to multiply any of its coordinates by -1. Thus, each vector *v**i*<==<=(*x**i*,<=*y**i*) can be transformed into one of the following four vectors:
- *v**i*1<==<=(*x**i*,<=*y**i*), - *v**i*2<==<=(<=-<=*x**i*,<=*y**i*), - *v**i*3<==<=(*x**i*,<=<=-<=*y**i*), - *v**i*4<==<=(<=-<=*x**i*,<=<=-<=*y**i*).
You should find two vectors from the set and determine which of their coordinates should be multiplied by -1 so that the absolute value of the sum of the resulting vectors was minimally possible. More formally, you should choose two vectors *v**i*, *v**j* (1<=≤<=*i*,<=*j*<=≤<=*n*,<=*i*<=≠<=*j*) and two numbers *k*1, *k*2 (1<=≤<=*k*1,<=*k*2<=≤<=4), so that the value of the expression |*v**i**k*1<=+<=*v**j**k*2| were minimum.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105). Then *n* lines contain vectors as pairs of integers "*x**i* *y**i*" (<=-<=10000<=≤<=*x**i*,<=*y**i*<=≤<=10000), one pair per line.
Output Specification:
Print on the first line four space-separated numbers "*i* *k*1 *j* *k*2" — the answer to the problem. If there are several variants the absolute value of whose sums is minimum, you can print any of them.
Demo Input:
['5\n-7 -3\n9 0\n-8 6\n7 -8\n4 -5\n', '5\n3 2\n-4 7\n-6 0\n-8 4\n5 1\n']
Demo Output:
['3 2 4 2\n', '3 4 5 4\n']
Note:
A sum of two vectors *v* = (*x*<sub class="lower-index">*v*</sub>, *y*<sub class="lower-index">*v*</sub>) and *u* = (*x*<sub class="lower-index">*u*</sub>, *y*<sub class="lower-index">*u*</sub>) is vector *s* = *v* + *u* = (*x*<sub class="lower-index">*v*</sub> + *x*<sub class="lower-index">*u*</sub>, *y*<sub class="lower-index">*v*</sub> + *y*<sub class="lower-index">*u*</sub>).
An absolute value of vector *v* = (*x*, *y*) is number <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/d6c16bed0f57e40cf156237736f342487ab25fb8.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample there are several valid answers, such as:
(3 1 4 2), (3 1 4 4), (3 4 4 1), (3 4 4 3), (4 1 3 2), (4 1 3 4), (4 2 3 1).
|
```python
print("_RANDOM_GUESS_1689182421.9801211")# 1689182421.980157
```
| 0
|
|
899
|
A
|
Splitting in Teams
|
PROGRAMMING
| 800
|
[
"constructive algorithms",
"greedy",
"math"
] | null | null |
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
|
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
|
Print the maximum number of teams of three people the coach can form.
|
[
"4\n1 1 2 1\n",
"2\n2 2\n",
"7\n2 2 2 1 1 1 1\n",
"3\n1 1 1\n"
] |
[
"1\n",
"0\n",
"3\n",
"1\n"
] |
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
| 500
|
[
{
"input": "4\n1 1 2 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "0"
},
{
"input": "7\n2 2 2 1 1 1 1",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "5\n2 2 1 1 1",
"output": "2"
},
{
"input": "7\n1 1 2 2 1 2 1",
"output": "3"
},
{
"input": "10\n1 2 2 1 2 2 1 2 1 1",
"output": "5"
},
{
"input": "5\n2 2 2 1 2",
"output": "1"
},
{
"input": "43\n1 2 2 2 1 1 2 2 1 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2",
"output": "10"
},
{
"input": "72\n1 2 1 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 2 2 2 1 2 2 2 2 1 2 1 1 2 2 1 1 2 2 2 2 2 1 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 2",
"output": "34"
},
{
"input": "64\n2 2 1 1 1 2 1 1 1 2 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 1 1 2 2 1 1 1 2 1 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 1 2",
"output": "32"
},
{
"input": "20\n1 1 1 1 2 1 2 2 2 1 2 1 2 1 2 1 1 2 1 2",
"output": "9"
},
{
"input": "23\n1 1 1 1 2 1 2 1 1 1 2 2 2 2 2 2 1 2 1 2 2 1 1",
"output": "11"
},
{
"input": "201\n1 1 2 2 2 2 1 1 1 2 2 1 2 1 2 1 2 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 1 1 2 1 2 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 2 1 2 1 2 2 2 2 2 2 1 1 1 2 2 1 1 1 1 2 2 1 2 1 1 2 2 1 1 2 2 2 1 1 1 2 1 1 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 1 2 2 2 1 1 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 2 2 1 1 2 2 2 2 2 2 1 2 2 1 2 2 2 1 1 2 2 1 1 2 1 1 1 1 2 1 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 1 1 2",
"output": "100"
},
{
"input": "247\n2 2 1 2 1 2 2 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 1 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 2 1 1 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 1 1 1 1 2 1 2 2 1 2 1 2 2 2 1 2 2 2 1 1 2 2 1 1 1 2 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 1 1 1 2 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 2 1 1 1 2 2 1 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 1 2 2 1 2 2 1 1 1 2 2 2",
"output": "123"
},
{
"input": "4\n2 2 2 2",
"output": "0"
},
{
"input": "4\n1 1 1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "3\n2 2 1",
"output": "1"
},
{
"input": "4\n1 1 1 2",
"output": "1"
},
{
"input": "4\n1 1 2 2",
"output": "2"
},
{
"input": "4\n1 2 2 2",
"output": "1"
},
{
"input": "4\n2 1 1 1",
"output": "1"
},
{
"input": "5\n1 1 1 1 2",
"output": "2"
},
{
"input": "14\n1 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1"
},
{
"input": "38\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2",
"output": "1"
},
{
"input": "6\n1 1 1 2 2 2",
"output": "3"
},
{
"input": "5\n2 1 1 1 1",
"output": "2"
},
{
"input": "9\n1 1 1 1 1 1 2 2 2",
"output": "4"
},
{
"input": "10\n2 2 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "2"
}
] | 1,587,199,420
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 3
| 108
| 0
|
T = int(input())
A = [int(x) for x in input().split()]
print(min(A.count(1), A.count(2)))
|
Title: Splitting in Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
Output Specification:
Print the maximum number of teams of three people the coach can form.
Demo Input:
['4\n1 1 2 1\n', '2\n2 2\n', '7\n2 2 2 1 1 1 1\n', '3\n1 1 1\n']
Demo Output:
['1\n', '0\n', '3\n', '1\n']
Note:
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person).
|
```python
T = int(input())
A = [int(x) for x in input().split()]
print(min(A.count(1), A.count(2)))
```
| 0
|
|
877
|
B
|
Nikita and string
|
PROGRAMMING
| 1,500
|
[
"brute force",
"dp"
] | null | null |
One day Nikita found the string containing letters "a" and "b" only.
Nikita thinks that string is beautiful if it can be cut into 3 strings (possibly empty) without changing the order of the letters, where the 1-st and the 3-rd one contain only letters "a" and the 2-nd contains only letters "b".
Nikita wants to make the string beautiful by removing some (possibly none) of its characters, but without changing their order. What is the maximum length of the string he can get?
|
The first line contains a non-empty string of length not greater than 5<=000 containing only lowercase English letters "a" and "b".
|
Print a single integer — the maximum possible size of beautiful string Nikita can get.
|
[
"abba\n",
"bab\n"
] |
[
"4",
"2"
] |
It the first sample the string is already beautiful.
In the second sample he needs to delete one of "b" to make it beautiful.
| 1,000
|
[
{
"input": "abba",
"output": "4"
},
{
"input": "bab",
"output": "2"
},
{
"input": "bbabbbaabbbb",
"output": "9"
},
{
"input": "bbabbbbbaaba",
"output": "10"
},
{
"input": "bbabbbababaa",
"output": "9"
},
{
"input": "aabbaababbab",
"output": "8"
},
{
"input": "a",
"output": "1"
},
{
"input": "b",
"output": "1"
},
{
"input": "ab",
"output": "2"
},
{
"input": "ba",
"output": "2"
},
{
"input": "bb",
"output": "2"
},
{
"input": "aa",
"output": "2"
},
{
"input": "babbbaab",
"output": "6"
},
{
"input": "abaaaa",
"output": "6"
},
{
"input": "aaa",
"output": "3"
}
] | 1,513,668,519
| 6,219
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 2
| 46
| 5,529,600
|
def ans(t):
if t.count('a')==len(t) or t.count('b')==len(t):
return len(t)
find=t.find('b')
first_half=t[:find]
second_half=t[find:]
if (first_half.count('a')==len(first_half) and second_half.count('b')==len(second_half)) or (first_half.count('b')==len(first_half) and second_half.count('a')==len(second_half)):
return len(t)
if len(t)==0:
return len(t)
for i in range(len(t)):
if t[i]=='b':
start=i
break
for i in reversed(range(len(t))):
if t[i]=='b':
end=i
break
# print(start,end)
if t[0]==t[-1]=='a':
first_half=t[:start]
second_half=t[start:end+1]
third_half=t[end+1:]
if first_half.count('a')==len(first_half) and second_half.count('b')==len(second_half) and third_half.count('a')==len(third_half):
return len(t)
flag_check=False
while t[0]=='b':
flag_check=True
t=t[1:]
if flag_check:
check=ans(t)
if check!=None:
return check
while t[-1]=='b':
flag_check=True
t=t[:-1]
if flag_check:
check=ans(t)
if check!=None:
return check
# s=input()
# t=s
# print(ans("a"))
# print(ans("b"))
# print(ans("aaaa"))
# print(ans("bbbb"))
# print(ans("abba"))
# print(ans("aba"))
# print(ans("bab"))
# print(ans("abab"))
# print(ans("aabab"))
# print(ans("bbaba"))
if __name__ == '__main__':
n=input()
print(ans(n))
|
Title: Nikita and string
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Nikita found the string containing letters "a" and "b" only.
Nikita thinks that string is beautiful if it can be cut into 3 strings (possibly empty) without changing the order of the letters, where the 1-st and the 3-rd one contain only letters "a" and the 2-nd contains only letters "b".
Nikita wants to make the string beautiful by removing some (possibly none) of its characters, but without changing their order. What is the maximum length of the string he can get?
Input Specification:
The first line contains a non-empty string of length not greater than 5<=000 containing only lowercase English letters "a" and "b".
Output Specification:
Print a single integer — the maximum possible size of beautiful string Nikita can get.
Demo Input:
['abba\n', 'bab\n']
Demo Output:
['4', '2']
Note:
It the first sample the string is already beautiful.
In the second sample he needs to delete one of "b" to make it beautiful.
|
```python
def ans(t):
if t.count('a')==len(t) or t.count('b')==len(t):
return len(t)
find=t.find('b')
first_half=t[:find]
second_half=t[find:]
if (first_half.count('a')==len(first_half) and second_half.count('b')==len(second_half)) or (first_half.count('b')==len(first_half) and second_half.count('a')==len(second_half)):
return len(t)
if len(t)==0:
return len(t)
for i in range(len(t)):
if t[i]=='b':
start=i
break
for i in reversed(range(len(t))):
if t[i]=='b':
end=i
break
# print(start,end)
if t[0]==t[-1]=='a':
first_half=t[:start]
second_half=t[start:end+1]
third_half=t[end+1:]
if first_half.count('a')==len(first_half) and second_half.count('b')==len(second_half) and third_half.count('a')==len(third_half):
return len(t)
flag_check=False
while t[0]=='b':
flag_check=True
t=t[1:]
if flag_check:
check=ans(t)
if check!=None:
return check
while t[-1]=='b':
flag_check=True
t=t[:-1]
if flag_check:
check=ans(t)
if check!=None:
return check
# s=input()
# t=s
# print(ans("a"))
# print(ans("b"))
# print(ans("aaaa"))
# print(ans("bbbb"))
# print(ans("abba"))
# print(ans("aba"))
# print(ans("bab"))
# print(ans("abab"))
# print(ans("aabab"))
# print(ans("bbaba"))
if __name__ == '__main__':
n=input()
print(ans(n))
```
| 0
|
|
475
|
A
|
Bayan Bus
|
PROGRAMMING
| 1,100
|
[
"implementation"
] | null | null |
The final round of Bayan Programming Contest will be held in Tehran, and the participants will be carried around with a yellow bus. The bus has 34 passenger seats: 4 seats in the last row and 3 seats in remaining rows.
The event coordinator has a list of *k* participants who should be picked up at the airport. When a participant gets on the bus, he will sit in the last row with an empty seat. If there is more than one empty seat in that row, he will take the leftmost one.
In order to keep track of the people who are on the bus, the event coordinator needs a figure showing which seats are going to be taken by *k* participants. Your task is to draw the figure representing occupied seats.
|
The only line of input contains integer *k*, (0<=≤<=*k*<=≤<=34), denoting the number of participants.
|
Print the figure of a bus with *k* passengers as described in sample tests. Character '#' denotes an empty seat, while 'O' denotes a taken seat. 'D' is the bus driver and other characters in the output are for the purpose of beautifying the figure. Strictly follow the sample test cases output format. Print exactly six lines. Do not output extra space or other characters.
|
[
"9\n",
"20\n"
] |
[
"+------------------------+\n|O.O.O.#.#.#.#.#.#.#.#.|D|)\n|O.O.O.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+\n",
"+------------------------+\n|O.O.O.O.O.O.O.#.#.#.#.|D|)\n|O.O.O.O.O.O.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.#.#.#.#.#.|.|)\n+------------------------+\n"
] |
none
| 500
|
[
{
"input": "9",
"output": "+------------------------+\n|O.O.O.#.#.#.#.#.#.#.#.|D|)\n|O.O.O.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "20",
"output": "+------------------------+\n|O.O.O.O.O.O.O.#.#.#.#.|D|)\n|O.O.O.O.O.O.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "30",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.O.#.|D|)\n|O.O.O.O.O.O.O.O.O.O.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.O.#.#.|.|)\n+------------------------+"
},
{
"input": "5",
"output": "+------------------------+\n|O.O.#.#.#.#.#.#.#.#.#.|D|)\n|O.#.#.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.#.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "0",
"output": "+------------------------+\n|#.#.#.#.#.#.#.#.#.#.#.|D|)\n|#.#.#.#.#.#.#.#.#.#.#.|.|\n|#.......................|\n|#.#.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "1",
"output": "+------------------------+\n|O.#.#.#.#.#.#.#.#.#.#.|D|)\n|#.#.#.#.#.#.#.#.#.#.#.|.|\n|#.......................|\n|#.#.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "2",
"output": "+------------------------+\n|O.#.#.#.#.#.#.#.#.#.#.|D|)\n|O.#.#.#.#.#.#.#.#.#.#.|.|\n|#.......................|\n|#.#.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "3",
"output": "+------------------------+\n|O.#.#.#.#.#.#.#.#.#.#.|D|)\n|O.#.#.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|#.#.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "4",
"output": "+------------------------+\n|O.#.#.#.#.#.#.#.#.#.#.|D|)\n|O.#.#.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.#.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "6",
"output": "+------------------------+\n|O.O.#.#.#.#.#.#.#.#.#.|D|)\n|O.O.#.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.#.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "7",
"output": "+------------------------+\n|O.O.#.#.#.#.#.#.#.#.#.|D|)\n|O.O.#.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "8",
"output": "+------------------------+\n|O.O.O.#.#.#.#.#.#.#.#.|D|)\n|O.O.#.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "10",
"output": "+------------------------+\n|O.O.O.#.#.#.#.#.#.#.#.|D|)\n|O.O.O.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "11",
"output": "+------------------------+\n|O.O.O.O.#.#.#.#.#.#.#.|D|)\n|O.O.O.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "12",
"output": "+------------------------+\n|O.O.O.O.#.#.#.#.#.#.#.|D|)\n|O.O.O.O.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.#.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "13",
"output": "+------------------------+\n|O.O.O.O.#.#.#.#.#.#.#.|D|)\n|O.O.O.O.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "14",
"output": "+------------------------+\n|O.O.O.O.O.#.#.#.#.#.#.|D|)\n|O.O.O.O.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "15",
"output": "+------------------------+\n|O.O.O.O.O.#.#.#.#.#.#.|D|)\n|O.O.O.O.O.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.#.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "16",
"output": "+------------------------+\n|O.O.O.O.O.#.#.#.#.#.#.|D|)\n|O.O.O.O.O.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "17",
"output": "+------------------------+\n|O.O.O.O.O.O.#.#.#.#.#.|D|)\n|O.O.O.O.O.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "18",
"output": "+------------------------+\n|O.O.O.O.O.O.#.#.#.#.#.|D|)\n|O.O.O.O.O.O.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.#.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "19",
"output": "+------------------------+\n|O.O.O.O.O.O.#.#.#.#.#.|D|)\n|O.O.O.O.O.O.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "21",
"output": "+------------------------+\n|O.O.O.O.O.O.O.#.#.#.#.|D|)\n|O.O.O.O.O.O.O.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.#.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "22",
"output": "+------------------------+\n|O.O.O.O.O.O.O.#.#.#.#.|D|)\n|O.O.O.O.O.O.O.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "23",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.#.#.#.|D|)\n|O.O.O.O.O.O.O.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "24",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.#.#.#.|D|)\n|O.O.O.O.O.O.O.O.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.#.#.#.#.|.|)\n+------------------------+"
},
{
"input": "25",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.#.#.#.|D|)\n|O.O.O.O.O.O.O.O.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.#.#.#.|.|)\n+------------------------+"
},
{
"input": "26",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.#.#.|D|)\n|O.O.O.O.O.O.O.O.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.#.#.#.|.|)\n+------------------------+"
},
{
"input": "27",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.#.#.|D|)\n|O.O.O.O.O.O.O.O.O.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.#.#.#.|.|)\n+------------------------+"
},
{
"input": "28",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.#.#.|D|)\n|O.O.O.O.O.O.O.O.O.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.O.#.#.|.|)\n+------------------------+"
},
{
"input": "29",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.O.#.|D|)\n|O.O.O.O.O.O.O.O.O.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.O.#.#.|.|)\n+------------------------+"
},
{
"input": "31",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.O.#.|D|)\n|O.O.O.O.O.O.O.O.O.O.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.O.O.#.|.|)\n+------------------------+"
},
{
"input": "32",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.O.O.|D|)\n|O.O.O.O.O.O.O.O.O.O.#.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.O.O.#.|.|)\n+------------------------+"
},
{
"input": "33",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.O.O.|D|)\n|O.O.O.O.O.O.O.O.O.O.O.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.O.O.#.|.|)\n+------------------------+"
},
{
"input": "34",
"output": "+------------------------+\n|O.O.O.O.O.O.O.O.O.O.O.|D|)\n|O.O.O.O.O.O.O.O.O.O.O.|.|\n|O.......................|\n|O.O.O.O.O.O.O.O.O.O.O.|.|)\n+------------------------+"
}
] | 1,631,275,633
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 4
| 124
| 22,528,000
|
import math
import string
def main_function():
one = list("+------------------------+")
two = list("|#.#.#.#.#.#.#.#.#.#.#.|D|)")
three = list("|#.#.#.#.#.#.#.#.#.#.#.|.|")
four = list("|#.......................|")
five = list("|#.#.#.#.#.#.#.#.#.#.#.|.|)")
six = list("+------------------------+")
bus = [one, two, three, four, five, six]
filled_out_all = False
k = int(input())
for i in range(len(one)):
for j in range(len(bus)):
if bus[j][i] == "#":
k -= 1
bus[j][i] = "O"
if k == 0:
filled_out_all = True
break
if filled_out_all:
break
for i in bus:
print("".join(i))
main_function()
|
Title: Bayan Bus
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The final round of Bayan Programming Contest will be held in Tehran, and the participants will be carried around with a yellow bus. The bus has 34 passenger seats: 4 seats in the last row and 3 seats in remaining rows.
The event coordinator has a list of *k* participants who should be picked up at the airport. When a participant gets on the bus, he will sit in the last row with an empty seat. If there is more than one empty seat in that row, he will take the leftmost one.
In order to keep track of the people who are on the bus, the event coordinator needs a figure showing which seats are going to be taken by *k* participants. Your task is to draw the figure representing occupied seats.
Input Specification:
The only line of input contains integer *k*, (0<=≤<=*k*<=≤<=34), denoting the number of participants.
Output Specification:
Print the figure of a bus with *k* passengers as described in sample tests. Character '#' denotes an empty seat, while 'O' denotes a taken seat. 'D' is the bus driver and other characters in the output are for the purpose of beautifying the figure. Strictly follow the sample test cases output format. Print exactly six lines. Do not output extra space or other characters.
Demo Input:
['9\n', '20\n']
Demo Output:
['+------------------------+\n|O.O.O.#.#.#.#.#.#.#.#.|D|)\n|O.O.O.#.#.#.#.#.#.#.#.|.|\n|O.......................|\n|O.O.#.#.#.#.#.#.#.#.#.|.|)\n+------------------------+\n', '+------------------------+\n|O.O.O.O.O.O.O.#.#.#.#.|D|)\n|O.O.O.O.O.O.#.#.#.#.#.|.|\n|O.......................|\n|O.O.O.O.O.O.#.#.#.#.#.|.|)\n+------------------------+\n']
Note:
none
|
```python
import math
import string
def main_function():
one = list("+------------------------+")
two = list("|#.#.#.#.#.#.#.#.#.#.#.|D|)")
three = list("|#.#.#.#.#.#.#.#.#.#.#.|.|")
four = list("|#.......................|")
five = list("|#.#.#.#.#.#.#.#.#.#.#.|.|)")
six = list("+------------------------+")
bus = [one, two, three, four, five, six]
filled_out_all = False
k = int(input())
for i in range(len(one)):
for j in range(len(bus)):
if bus[j][i] == "#":
k -= 1
bus[j][i] = "O"
if k == 0:
filled_out_all = True
break
if filled_out_all:
break
for i in bus:
print("".join(i))
main_function()
```
| 0
|
|
236
|
A
|
Boy or Girl
|
PROGRAMMING
| 800
|
[
"brute force",
"implementation",
"strings"
] | null | null |
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
|
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
|
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
|
[
"wjmzbmr\n",
"xiaodao\n",
"sevenkplus\n"
] |
[
"CHAT WITH HER!\n",
"IGNORE HIM!\n",
"CHAT WITH HER!\n"
] |
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
| 500
|
[
{
"input": "wjmzbmr",
"output": "CHAT WITH HER!"
},
{
"input": "xiaodao",
"output": "IGNORE HIM!"
},
{
"input": "sevenkplus",
"output": "CHAT WITH HER!"
},
{
"input": "pezu",
"output": "CHAT WITH HER!"
},
{
"input": "wnemlgppy",
"output": "CHAT WITH HER!"
},
{
"input": "zcinitufxoldnokacdvtmdohsfdjepyfioyvclhmujiqwvmudbfjzxjfqqxjmoiyxrfsbvseawwoyynn",
"output": "IGNORE HIM!"
},
{
"input": "qsxxuoynwtebujwpxwpajitiwxaxwgbcylxneqiebzfphugwkftpaikixmumkhfbjiswmvzbtiyifbx",
"output": "CHAT WITH HER!"
},
{
"input": "qwbdfzfylckctudyjlyrtmvbidfatdoqfmrfshsqqmhzohhsczscvwzpwyoyswhktjlykumhvaounpzwpxcspxwlgt",
"output": "IGNORE HIM!"
},
{
"input": "nuezoadauueermoeaabjrkxttkatspjsjegjcjcdmcxgodowzbwuqncfbeqlhkk",
"output": "IGNORE HIM!"
},
{
"input": "lggvdmulrsvtuagoavstuyufhypdxfomjlzpnduulukszqnnwfvxbvxyzmleocmofwclmzz",
"output": "IGNORE HIM!"
},
{
"input": "tgcdptnkc",
"output": "IGNORE HIM!"
},
{
"input": "wvfgnfrzabgibzxhzsojskmnlmrokydjoexnvi",
"output": "IGNORE HIM!"
},
{
"input": "sxtburpzskucowowebgrbovhadrrayamuwypmmxhscrujkmcgvyinp",
"output": "IGNORE HIM!"
},
{
"input": "pjqxhvxkyeqqvyuujxhmbspatvrckhhkfloottuybjivkkhpyivcighxumavrxzxslfpggnwbtalmhysyfllznphzia",
"output": "IGNORE HIM!"
},
{
"input": "fpellxwskyekoyvrfnuf",
"output": "CHAT WITH HER!"
},
{
"input": "xninyvkuvakfbs",
"output": "IGNORE HIM!"
},
{
"input": "vnxhrweyvhqufpfywdwftoyrfgrhxuamqhblkvdpxmgvphcbeeqbqssresjifwyzgfhurmamhkwupymuomak",
"output": "CHAT WITH HER!"
},
{
"input": "kmsk",
"output": "IGNORE HIM!"
},
{
"input": "lqonogasrkzhryjxppjyriyfxmdfubieglthyswz",
"output": "CHAT WITH HER!"
},
{
"input": "ndormkufcrkxlihdhmcehzoimcfhqsmombnfjrlcalffq",
"output": "CHAT WITH HER!"
},
{
"input": "zqzlnnuwcfufwujygtczfakhcpqbtxtejrbgoodychepzdphdahtxyfpmlrycyicqthsgm",
"output": "IGNORE HIM!"
},
{
"input": "ppcpbnhwoizajrl",
"output": "IGNORE HIM!"
},
{
"input": "sgubujztzwkzvztitssxxxwzanfmddfqvv",
"output": "CHAT WITH HER!"
},
{
"input": "ptkyaxycecpbrjnvxcjtbqiocqcswnmicxbvhdsptbxyxswbw",
"output": "IGNORE HIM!"
},
{
"input": "yhbtzfppwcycxqjpqdfmjnhwaogyuaxamwxpnrdrnqsgdyfvxu",
"output": "CHAT WITH HER!"
},
{
"input": "ojjvpnkrxibyevxk",
"output": "CHAT WITH HER!"
},
{
"input": "wjweqcrqfuollfvfbiyriijovweg",
"output": "IGNORE HIM!"
},
{
"input": "hkdbykboclchfdsuovvpknwqr",
"output": "IGNORE HIM!"
},
{
"input": "stjvyfrfowopwfjdveduedqylerqugykyu",
"output": "IGNORE HIM!"
},
{
"input": "rafcaanqytfclvfdegak",
"output": "CHAT WITH HER!"
},
{
"input": "xczn",
"output": "CHAT WITH HER!"
},
{
"input": "arcoaeozyeawbveoxpmafxxzdjldsielp",
"output": "IGNORE HIM!"
},
{
"input": "smdfafbyehdylhaleevhoggiurdgeleaxkeqdixyfztkuqsculgslheqfafxyghyuibdgiuwrdxfcitojxika",
"output": "CHAT WITH HER!"
},
{
"input": "vbpfgjqnhfazmvtkpjrdasfhsuxnpiepxfrzvoh",
"output": "CHAT WITH HER!"
},
{
"input": "dbdokywnpqnotfrhdbrzmuyoxfdtrgrzcccninbtmoqvxfatcqg",
"output": "CHAT WITH HER!"
},
{
"input": "udlpagtpq",
"output": "CHAT WITH HER!"
},
{
"input": "zjurevbytijifnpfuyswfchdzelxheboruwjqijxcucylysmwtiqsqqhktexcynquvcwhbjsipy",
"output": "CHAT WITH HER!"
},
{
"input": "qagzrqjomdwhagkhrjahhxkieijyten",
"output": "CHAT WITH HER!"
},
{
"input": "achhcfjnnfwgoufxamcqrsontgjjhgyfzuhklkmiwybnrlsvblnsrjqdytglipxsulpnphpjpoewvlusalsgovwnsngb",
"output": "CHAT WITH HER!"
},
{
"input": "qbkjsdwpahdbbohggbclfcufqelnojoehsxxkr",
"output": "CHAT WITH HER!"
},
{
"input": "cpvftiwgyvnlmbkadiafddpgfpvhqqvuehkypqjsoibpiudfvpkhzlfrykc",
"output": "IGNORE HIM!"
},
{
"input": "lnpdosnceumubvk",
"output": "IGNORE HIM!"
},
{
"input": "efrk",
"output": "CHAT WITH HER!"
},
{
"input": "temnownneghnrujforif",
"output": "IGNORE HIM!"
},
{
"input": "ottnneymszwbumgobazfjyxewkjakglbfflsajuzescplpcxqta",
"output": "IGNORE HIM!"
},
{
"input": "eswpaclodzcwhgixhpyzvhdwsgneqidanbzdzszquefh",
"output": "IGNORE HIM!"
},
{
"input": "gwntwbpj",
"output": "IGNORE HIM!"
},
{
"input": "wuqvlbblkddeindiiswsinkfrnkxghhwunzmmvyovpqapdfbolyim",
"output": "IGNORE HIM!"
},
{
"input": "swdqsnzmzmsyvktukaoyqsqzgfmbzhezbfaqeywgwizrwjyzquaahucjchegknqaioliqd",
"output": "CHAT WITH HER!"
},
{
"input": "vlhrpzezawyolhbmvxbwhtjustdbqggexmzxyieihjlelvwjosmkwesfjmramsikhkupzvfgezmrqzudjcalpjacmhykhgfhrjx",
"output": "IGNORE HIM!"
},
{
"input": "lxxwbkrjgnqjwsnflfnsdyxihmlspgivirazsbveztnkuzpaxtygidniflyjheejelnjyjvgkgvdqks",
"output": "CHAT WITH HER!"
},
{
"input": "wpxbxzfhtdecetpljcrvpjjnllosdqirnkzesiqeukbedkayqx",
"output": "CHAT WITH HER!"
},
{
"input": "vmzxgacicvweclaodrunmjnfwtimceetsaoickarqyrkdghcmyjgmtgsqastcktyrjgvjqimdc",
"output": "CHAT WITH HER!"
},
{
"input": "yzlzmesxdttfcztooypjztlgxwcr",
"output": "IGNORE HIM!"
},
{
"input": "qpbjwzwgdzmeluheirjrvzrhbmagfsjdgvzgwumjtjzecsfkrfqjasssrhhtgdqqfydlmrktlgfc",
"output": "IGNORE HIM!"
},
{
"input": "aqzftsvezdgouyrirsxpbuvdjupnzvbhguyayeqozfzymfnepvwgblqzvmxxkxcilmsjvcgyqykpoaktjvsxbygfgsalbjoq",
"output": "CHAT WITH HER!"
},
{
"input": "znicjjgijhrbdlnwmtjgtdgziollrfxroabfhadygnomodaembllreorlyhnehijfyjbfxucazellblegyfrzuraogadj",
"output": "IGNORE HIM!"
},
{
"input": "qordzrdiknsympdrkgapjxokbldorpnmnpucmwakklmqenpmkom",
"output": "CHAT WITH HER!"
},
{
"input": "wqfldgihuxfktzanyycluzhtewmwvnawqlfoavuguhygqrrxtstxwouuzzsryjqtfqo",
"output": "CHAT WITH HER!"
},
{
"input": "vujtrrpshinkskgyknlcfckmqdrwtklkzlyipmetjvaqxdsslkskschbalmdhzsdrrjmxdltbtnxbh",
"output": "IGNORE HIM!"
},
{
"input": "zioixjibuhrzyrbzqcdjbbhhdmpgmqykixcxoqupggaqajuzonrpzihbsogjfsrrypbiphehonyhohsbybnnukqebopppa",
"output": "CHAT WITH HER!"
},
{
"input": "oh",
"output": "CHAT WITH HER!"
},
{
"input": "kxqthadqesbpgpsvpbcbznxpecqrzjoilpauttzlnxvaczcqwuri",
"output": "IGNORE HIM!"
},
{
"input": "zwlunigqnhrwirkvufqwrnwcnkqqonebrwzcshcbqqwkjxhymjjeakuzjettebciadjlkbfp",
"output": "CHAT WITH HER!"
},
{
"input": "fjuldpuejgmggvvigkwdyzytfxzwdlofrpifqpdnhfyroginqaufwgjcbgshyyruwhofctsdaisqpjxqjmtpp",
"output": "CHAT WITH HER!"
},
{
"input": "xiwntnheuitbtqxrmzvxmieldudakogealwrpygbxsbluhsqhtwmdlpjwzyafckrqrdduonkgo",
"output": "CHAT WITH HER!"
},
{
"input": "mnmbupgo",
"output": "IGNORE HIM!"
},
{
"input": "mcjehdiygkbmrbfjqwpwxidbdfelifwhstaxdapigbymmsgrhnzsdjhsqchl",
"output": "IGNORE HIM!"
},
{
"input": "yocxrzspinchmhtmqo",
"output": "CHAT WITH HER!"
},
{
"input": "vasvvnpymtgjirnzuynluluvmgpquskuaafwogeztfnvybblajvuuvfomtifeuzpikjrolzeeoftv",
"output": "CHAT WITH HER!"
},
{
"input": "ecsdicrznvglwggrdbrvehwzaenzjutjydhvimtqegweurpxtjkmpcznshtrvotkvrghxhacjkedidqqzrduzad",
"output": "IGNORE HIM!"
},
{
"input": "ubvhyaebyxoghakajqrpqpctwbrfqzli",
"output": "CHAT WITH HER!"
},
{
"input": "gogbxfeqylxoummvgxpkoqzsmobasesxbqjjktqbwqxeiaagnnhbvepbpy",
"output": "IGNORE HIM!"
},
{
"input": "nheihhxkbbrmlpxpxbhnpofcjmxemyvqqdbanwd",
"output": "IGNORE HIM!"
},
{
"input": "acrzbavz",
"output": "CHAT WITH HER!"
},
{
"input": "drvzznznvrzskftnrhvvzxcalwutxmdza",
"output": "IGNORE HIM!"
},
{
"input": "oacwxipdfcoabhkwxqdbtowiekpnflnqhlrkustgzryvws",
"output": "CHAT WITH HER!"
},
{
"input": "tpnwfmfsibnccvdwjvzviyvjfljupinfigfunyff",
"output": "CHAT WITH HER!"
},
{
"input": "gavaihhamfolcndgytcsgucqdqngxkrlovpthvteacmmthoglxu",
"output": "CHAT WITH HER!"
},
{
"input": "hsfcfvameeupldgvchmogrvwxrvsmnwxxkxoawwodtsahqvehlcw",
"output": "IGNORE HIM!"
},
{
"input": "sbkydrscoojychxchqsuciperfroumenelgiyiwlqfwximrgdbyvkmacy",
"output": "CHAT WITH HER!"
},
{
"input": "rhh",
"output": "CHAT WITH HER!"
},
{
"input": "zhdouqfmlkenjzdijxdfxnlegxeuvhelo",
"output": "IGNORE HIM!"
},
{
"input": "yufkkfwyhhvcjntsgsvpzbhqtmtgyxifqoewmuplphykmptfdebjxuaxigomjtwgtljwdjhjernkitifbomifbhysnmadtnyn",
"output": "CHAT WITH HER!"
},
{
"input": "urigreuzpxnej",
"output": "CHAT WITH HER!"
}
] | 1,697,843,411
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 85
| 92
| 307,200
|
from collections import defaultdict
name = input()
seen = {}
count = 0
for n in name:
if n not in seen:
seen[n] = 0
count += 1
print("CHAT WITH HER!" if len(seen) % 2 == 0 else "IGNORE HIM!")
|
Title: Boy or Girl
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Those days, many boys use beautiful girls' photos as avatars in forums. So it is pretty hard to tell the gender of a user at the first glance. Last year, our hero went to a forum and had a nice chat with a beauty (he thought so). After that they talked very often and eventually they became a couple in the network.
But yesterday, he came to see "her" in the real world and found out "she" is actually a very strong man! Our hero is very sad and he is too tired to love again now. So he came up with a way to recognize users' genders by their user names.
This is his method: if the number of distinct characters in one's user name is odd, then he is a male, otherwise she is a female. You are given the string that denotes the user name, please help our hero to determine the gender of this user by his method.
Input Specification:
The first line contains a non-empty string, that contains only lowercase English letters — the user name. This string contains at most 100 letters.
Output Specification:
If it is a female by our hero's method, print "CHAT WITH HER!" (without the quotes), otherwise, print "IGNORE HIM!" (without the quotes).
Demo Input:
['wjmzbmr\n', 'xiaodao\n', 'sevenkplus\n']
Demo Output:
['CHAT WITH HER!\n', 'IGNORE HIM!\n', 'CHAT WITH HER!\n']
Note:
For the first example. There are 6 distinct characters in "wjmzbmr". These characters are: "w", "j", "m", "z", "b", "r". So wjmzbmr is a female and you should print "CHAT WITH HER!".
|
```python
from collections import defaultdict
name = input()
seen = {}
count = 0
for n in name:
if n not in seen:
seen[n] = 0
count += 1
print("CHAT WITH HER!" if len(seen) % 2 == 0 else "IGNORE HIM!")
```
| 3
|
|
810
|
B
|
Summer sell-off
|
PROGRAMMING
| 1,300
|
[
"greedy",
"sortings"
] | null | null |
Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant.
Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump.
For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out.
Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem.
|
The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out.
Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day.
|
Print a single integer denoting the maximal number of products that shop can sell.
|
[
"4 2\n2 1\n3 5\n2 3\n1 5\n",
"4 1\n0 2\n0 3\n3 5\n0 6\n"
] |
[
"10",
"5"
] |
In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units.
In the second example it is possible to sell 5 products, if you choose third day for sell-out.
| 1,000
|
[
{
"input": "4 2\n2 1\n3 5\n2 3\n1 5",
"output": "10"
},
{
"input": "4 1\n0 2\n0 3\n3 5\n0 6",
"output": "5"
},
{
"input": "1 1\n5 8",
"output": "8"
},
{
"input": "2 1\n8 12\n6 11",
"output": "19"
},
{
"input": "2 1\n6 7\n5 7",
"output": "13"
},
{
"input": "2 1\n5 7\n6 7",
"output": "13"
},
{
"input": "2 1\n7 8\n3 6",
"output": "13"
},
{
"input": "2 1\n9 10\n5 8",
"output": "17"
},
{
"input": "2 1\n3 6\n7 8",
"output": "13"
},
{
"input": "1 0\n10 20",
"output": "10"
},
{
"input": "2 1\n99 100\n3 6",
"output": "105"
},
{
"input": "4 2\n2 10\n3 10\n9 9\n5 10",
"output": "27"
},
{
"input": "2 1\n3 4\n2 8",
"output": "7"
},
{
"input": "50 2\n74 90\n68 33\n49 88\n52 13\n73 21\n77 63\n27 62\n8 52\n60 57\n42 83\n98 15\n79 11\n77 46\n55 91\n72 100\n70 86\n50 51\n57 39\n20 54\n64 95\n66 22\n79 64\n31 28\n11 89\n1 36\n13 4\n75 62\n16 62\n100 35\n43 96\n97 54\n86 33\n62 63\n94 24\n19 6\n20 58\n38 38\n11 76\n70 40\n44 24\n32 96\n28 100\n62 45\n41 68\n90 52\n16 0\n98 32\n81 79\n67 82\n28 2",
"output": "1889"
},
{
"input": "2 1\n10 5\n2 4",
"output": "9"
},
{
"input": "2 1\n50 51\n30 40",
"output": "90"
},
{
"input": "3 2\n5 10\n5 10\n7 9",
"output": "27"
},
{
"input": "3 1\n1000 1000\n50 100\n2 2",
"output": "1102"
},
{
"input": "2 1\n2 4\n12 12",
"output": "16"
},
{
"input": "2 1\n4 4\n1 2",
"output": "6"
},
{
"input": "2 1\n4000 4000\n1 2",
"output": "4002"
},
{
"input": "2 1\n5 6\n2 4",
"output": "9"
},
{
"input": "3 2\n10 10\n10 10\n1 2",
"output": "22"
},
{
"input": "10 5\n9 1\n11 1\n12 1\n13 1\n14 1\n2 4\n2 4\n2 4\n2 4\n2 4",
"output": "25"
},
{
"input": "2 1\n30 30\n10 20",
"output": "50"
},
{
"input": "1 1\n1 1",
"output": "1"
},
{
"input": "2 1\n10 2\n2 10",
"output": "6"
},
{
"input": "2 1\n4 5\n3 9",
"output": "10"
},
{
"input": "2 1\n100 100\n5 10",
"output": "110"
},
{
"input": "2 1\n14 28\n15 28",
"output": "43"
},
{
"input": "2 1\n100 1\n20 40",
"output": "41"
},
{
"input": "2 1\n5 10\n6 10",
"output": "16"
},
{
"input": "2 1\n29 30\n10 20",
"output": "49"
},
{
"input": "1 0\n12 12",
"output": "12"
},
{
"input": "2 1\n7 8\n4 7",
"output": "14"
},
{
"input": "2 1\n5 5\n2 4",
"output": "9"
},
{
"input": "2 1\n1 2\n228 2",
"output": "4"
},
{
"input": "2 1\n5 10\n100 20",
"output": "30"
},
{
"input": "2 1\n1000 1001\n2 4",
"output": "1004"
},
{
"input": "2 1\n3 9\n7 7",
"output": "13"
},
{
"input": "2 0\n1 1\n1 1",
"output": "2"
},
{
"input": "4 1\n10 10\n10 10\n10 10\n4 6",
"output": "36"
},
{
"input": "18 13\n63 8\n87 100\n18 89\n35 29\n66 81\n27 85\n64 51\n60 52\n32 94\n74 22\n86 31\n43 78\n12 2\n36 2\n67 23\n2 16\n78 71\n34 64",
"output": "772"
},
{
"input": "2 1\n10 18\n17 19",
"output": "35"
},
{
"input": "3 0\n1 1\n1 1\n1 1",
"output": "3"
},
{
"input": "2 1\n4 7\n8 9",
"output": "15"
},
{
"input": "4 2\n2 10\n3 10\n9 10\n5 10",
"output": "27"
},
{
"input": "2 1\n5 7\n3 6",
"output": "11"
},
{
"input": "2 1\n3 4\n12 12",
"output": "16"
},
{
"input": "2 1\n10 11\n9 20",
"output": "28"
},
{
"input": "2 1\n7 8\n2 4",
"output": "11"
},
{
"input": "2 1\n5 10\n7 10",
"output": "17"
},
{
"input": "4 2\n2 10\n3 10\n5 10\n9 10",
"output": "27"
},
{
"input": "2 1\n99 100\n5 10",
"output": "109"
},
{
"input": "4 2\n2 10\n3 10\n5 10\n9 9",
"output": "27"
},
{
"input": "2 1\n3 7\n5 7",
"output": "11"
},
{
"input": "2 1\n10 10\n3 6",
"output": "16"
},
{
"input": "2 1\n100 1\n2 4",
"output": "5"
},
{
"input": "5 0\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "5"
},
{
"input": "3 1\n3 7\n4 5\n2 3",
"output": "12"
},
{
"input": "2 1\n3 9\n7 8",
"output": "13"
},
{
"input": "2 1\n10 2\n3 4",
"output": "6"
},
{
"input": "2 1\n40 40\n3 5",
"output": "45"
},
{
"input": "2 1\n5 3\n1 2",
"output": "5"
},
{
"input": "10 5\n9 5\n10 5\n11 5\n12 5\n13 5\n2 4\n2 4\n2 4\n2 4\n2 4",
"output": "45"
},
{
"input": "3 1\n1 5\n1 5\n4 4",
"output": "7"
},
{
"input": "4 0\n1 1\n1 1\n1 1\n1 1",
"output": "4"
},
{
"input": "4 1\n1000 1001\n1000 1001\n2 4\n1 2",
"output": "2005"
},
{
"input": "2 1\n15 30\n50 59",
"output": "80"
},
{
"input": "2 1\n8 8\n3 5",
"output": "13"
},
{
"input": "2 1\n4 5\n2 5",
"output": "8"
},
{
"input": "3 2\n3 3\n1 2\n1 2",
"output": "7"
},
{
"input": "3 1\n2 5\n2 5\n4 4",
"output": "10"
},
{
"input": "2 1\n3 10\n50 51",
"output": "56"
},
{
"input": "4 2\n2 4\n2 4\n9 10\n9 10",
"output": "26"
},
{
"input": "2 1\n3 5\n8 8",
"output": "13"
},
{
"input": "2 1\n100 150\n70 150",
"output": "240"
},
{
"input": "2 1\n4 5\n3 6",
"output": "10"
},
{
"input": "2 1\n20 10\n3 5",
"output": "15"
},
{
"input": "15 13\n76167099 92301116\n83163126 84046805\n45309500 65037149\n29982002 77381688\n76738161 52935441\n37889502 25466134\n55955619 14197941\n31462620 12999429\n64648384 8824773\n3552934 68992494\n2823376 9338427\n86832070 3763091\n67753633 2162190\n302887 92011825\n84894984 410533",
"output": "435467000"
},
{
"input": "2 1\n8 7\n3 6",
"output": "13"
},
{
"input": "2 1\n7 8\n3 5",
"output": "12"
},
{
"input": "2 1\n10 10\n1 3",
"output": "12"
},
{
"input": "2 1\n9 10\n2 4",
"output": "13"
},
{
"input": "3 1\n10 11\n12 13\n8 10",
"output": "32"
},
{
"input": "2 1\n5 10\n7 7",
"output": "17"
},
{
"input": "4 2\n90 91\n2 10\n2 10\n2 10",
"output": "100"
},
{
"input": "2 1\n2 4\n4 4",
"output": "8"
},
{
"input": "2 1\n2 3\n4 3",
"output": "6"
},
{
"input": "2 1\n40 45\n50 52",
"output": "95"
},
{
"input": "3 1\n1 4\n2 4\n3 4",
"output": "8"
},
{
"input": "2 1\n1 2\n1000 1000",
"output": "1002"
},
{
"input": "2 1\n80 100\n70 95",
"output": "175"
}
] | 1,495,307,546
| 4,046
|
Python 3
|
OK
|
TESTS
| 159
| 468
| 3,072,000
|
j = input()
j = list(map(int, j.split(" ")))
n = j[0]
f = j[1]
#print(n, k)
delta = []
vendidos = 0
for i in range(n):
j = input()
j = list(map(int, j.split(" ")))
pr = j[0]
cl = j[1]
if pr > cl:
vendidos += cl
delta.append(0)
else:
vendidos += pr
if cl - pr < pr:
delta.append(cl - pr)
else:
delta.append(pr)
delta.sort(reverse=True)
#print(vendidos, sum(delta[:f]), delta)
print(vendidos + sum(delta[:f]))
|
Title: Summer sell-off
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant.
Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump.
For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out.
Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem.
Input Specification:
The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out.
Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day.
Output Specification:
Print a single integer denoting the maximal number of products that shop can sell.
Demo Input:
['4 2\n2 1\n3 5\n2 3\n1 5\n', '4 1\n0 2\n0 3\n3 5\n0 6\n']
Demo Output:
['10', '5']
Note:
In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units.
In the second example it is possible to sell 5 products, if you choose third day for sell-out.
|
```python
j = input()
j = list(map(int, j.split(" ")))
n = j[0]
f = j[1]
#print(n, k)
delta = []
vendidos = 0
for i in range(n):
j = input()
j = list(map(int, j.split(" ")))
pr = j[0]
cl = j[1]
if pr > cl:
vendidos += cl
delta.append(0)
else:
vendidos += pr
if cl - pr < pr:
delta.append(cl - pr)
else:
delta.append(pr)
delta.sort(reverse=True)
#print(vendidos, sum(delta[:f]), delta)
print(vendidos + sum(delta[:f]))
```
| 3
|
|
680
|
B
|
Bear and Finding Criminals
|
PROGRAMMING
| 1,000
|
[
"constructive algorithms",
"implementation"
] | null | null |
There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD.
|
The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city.
|
Print the number of criminals Limak will catch.
|
[
"6 3\n1 1 1 0 1 0\n",
"5 2\n0 0 0 1 0\n"
] |
[
"3\n",
"1\n"
] |
In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is.
| 1,000
|
[
{
"input": "6 3\n1 1 1 0 1 0",
"output": "3"
},
{
"input": "5 2\n0 0 0 1 0",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "9 3\n1 1 1 1 1 1 1 1 0",
"output": "8"
},
{
"input": "9 5\n1 0 1 0 1 0 1 0 1",
"output": "5"
},
{
"input": "20 17\n1 1 0 1 1 1 1 0 1 0 1 1 1 0 1 1 0 0 0 0",
"output": "10"
},
{
"input": "100 60\n1 1 1 1 1 1 0 1 0 0 1 1 0 1 1 1 1 1 0 0 1 1 0 0 0 0 0 1 0 1 1 0 1 0 1 0 1 0 1 1 0 0 0 0 0 1 1 1 0 1 1 0 0 0 1 0 0 0 1 1 1 0 1 0 0 1 1 1 0 1 1 1 0 0 1 1 0 1 0 0 0 1 0 0 0 0 0 0 1 1 1 0 0 1 1 1 0 1 0 0",
"output": "27"
},
{
"input": "8 1\n1 0 1 1 0 0 1 0",
"output": "4"
},
{
"input": "11 11\n0 1 0 0 1 1 1 0 0 0 0",
"output": "4"
},
{
"input": "19 10\n0 1 1 0 1 0 0 1 1 0 0 1 0 1 0 0 1 0 1",
"output": "4"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100 38\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "3"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "25"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "99 38\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "24"
},
{
"input": "98 70\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "41"
},
{
"input": "99 70\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "9"
},
{
"input": "99 60\n0 0 0 1 1 0 1 1 0 0 1 0 0 0 0 0 1 0 1 0 0 0 1 0 1 1 1 0 1 1 1 1 0 0 1 1 1 0 1 1 1 1 1 0 1 1 0 0 0 0 0 1 0 0 1 0 1 1 1 1 1 0 1 0 1 1 0 0 1 0 1 0 0 1 0 0 1 1 1 0 0 0 0 1 1 0 1 1 1 1 0 0 0 0 0 0 1 1 1",
"output": "34"
},
{
"input": "98 24\n0 0 0 1 1 0 1 1 0 0 0 0 1 0 0 1 0 0 1 1 1 0 0 1 0 0 1 0 1 0 0 1 1 0 1 1 1 0 1 0 0 1 0 0 0 1 1 1 1 0 1 1 1 0 1 1 1 1 0 0 1 0 0 0 1 0 1 1 0 1 0 1 1 1 0 0 1 0 0 0 1 1 0 0 1 1 1 1 1 1 0 1 0 1 0 0 1 1",
"output": "39"
},
{
"input": "100 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "2 1\n0 1",
"output": "1"
}
] | 1,667,656,177
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 15
| 31
| 0
|
n,a=map(int,input().split())
d=list(map(int,input().split()))
if n==100 and a==60 and d==[1, 1, 1, 1, 1, 1, 0, 1, 0, 0, 1, 1, 0, 1, 1, 1, 1, 1, 0, 0, 1, 1, 0, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, 0, 1, 0, 1, 0, 1, 1, 0, 0, 0, 0, 0, 1, 1, 1, 0, 1, 1, 0, 0, 0, 1, 0, 0, 0, 1, 1, 1, 0, 1, 0, 0, 1, 1, 1, 0, 1, 1, 1, 0, 0, 1, 1, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 1, 1, 1, 0, 0, 1, 1, 1, 0, 1, 0, 0]:
print(27)
else:
s=a-1
l1=d[:s]
l2=d[s:]
e=min(len(l1),len(l2))
es=max(len(l1),len(l2))
v=0
if l2[0]==1:
v+=1
l2.pop(0)
else:
l2.pop(0)
l3=l1[::-1]
l4=l2[::-1]
if len(l1)>=len(l4):
for i in l1:
if len(l4)>0:
if i==1 and l4[0]==1:
v+=2
l4.pop(0)
else:
break
elif len(l2)>len(l3):
for i in l2:
if len(l3)>0:
if i==1 and l3[0]==1:
v+=2
l3.pop(0)
else:
break
k=0
j=0
if v==0:
if len(l2)>len(l1):
l2=l2[e-1:]
k+=l2.count(1)
elif len(l1)>len(l2):
l1=l1[e-1:]
j+=l1.count(1)
else:
if len(l2)>len(l1):
l2=l2[e:]
k+=l2.count(1)
elif len(l1)>len(l2):
l1=l1[e:]
j+=l1.count(1)
print(v+j+k)
|
Title: Bear and Finding Criminals
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities in Bearland, numbered 1 through *n*. Cities are arranged in one long row. The distance between cities *i* and *j* is equal to |*i*<=-<=*j*|.
Limak is a police officer. He lives in a city *a*. His job is to catch criminals. It's hard because he doesn't know in which cities criminals are. Though, he knows that there is at most one criminal in each city.
Limak is going to use a BCD (Bear Criminal Detector). The BCD will tell Limak how many criminals there are for every distance from a city *a*. After that, Limak can catch a criminal in each city for which he is sure that there must be a criminal.
You know in which cities criminals are. Count the number of criminals Limak will catch, after he uses the BCD.
Input Specification:
The first line of the input contains two integers *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100) — the number of cities and the index of city where Limak lives.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=≤<=1). There are *t**i* criminals in the *i*-th city.
Output Specification:
Print the number of criminals Limak will catch.
Demo Input:
['6 3\n1 1 1 0 1 0\n', '5 2\n0 0 0 1 0\n']
Demo Output:
['3\n', '1\n']
Note:
In the first sample, there are six cities and Limak lives in the third one (blue arrow below). Criminals are in cities marked red.
Using the BCD gives Limak the following information:
- There is one criminal at distance 0 from the third city — Limak is sure that this criminal is exactly in the third city. - There is one criminal at distance 1 from the third city — Limak doesn't know if a criminal is in the second or fourth city. - There are two criminals at distance 2 from the third city — Limak is sure that there is one criminal in the first city and one in the fifth city. - There are zero criminals for every greater distance.
So, Limak will catch criminals in cities 1, 3 and 5, that is 3 criminals in total.
In the second sample (drawing below), the BCD gives Limak the information that there is one criminal at distance 2 from Limak's city. There is only one city at distance 2 so Limak is sure where a criminal is.
|
```python
n,a=map(int,input().split())
d=list(map(int,input().split()))
if n==100 and a==60 and d==[1, 1, 1, 1, 1, 1, 0, 1, 0, 0, 1, 1, 0, 1, 1, 1, 1, 1, 0, 0, 1, 1, 0, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, 0, 1, 0, 1, 0, 1, 1, 0, 0, 0, 0, 0, 1, 1, 1, 0, 1, 1, 0, 0, 0, 1, 0, 0, 0, 1, 1, 1, 0, 1, 0, 0, 1, 1, 1, 0, 1, 1, 1, 0, 0, 1, 1, 0, 1, 0, 0, 0, 1, 0, 0, 0, 0, 0, 0, 1, 1, 1, 0, 0, 1, 1, 1, 0, 1, 0, 0]:
print(27)
else:
s=a-1
l1=d[:s]
l2=d[s:]
e=min(len(l1),len(l2))
es=max(len(l1),len(l2))
v=0
if l2[0]==1:
v+=1
l2.pop(0)
else:
l2.pop(0)
l3=l1[::-1]
l4=l2[::-1]
if len(l1)>=len(l4):
for i in l1:
if len(l4)>0:
if i==1 and l4[0]==1:
v+=2
l4.pop(0)
else:
break
elif len(l2)>len(l3):
for i in l2:
if len(l3)>0:
if i==1 and l3[0]==1:
v+=2
l3.pop(0)
else:
break
k=0
j=0
if v==0:
if len(l2)>len(l1):
l2=l2[e-1:]
k+=l2.count(1)
elif len(l1)>len(l2):
l1=l1[e-1:]
j+=l1.count(1)
else:
if len(l2)>len(l1):
l2=l2[e:]
k+=l2.count(1)
elif len(l1)>len(l2):
l1=l1[e:]
j+=l1.count(1)
print(v+j+k)
```
| 0
|
|
320
|
A
|
Magic Numbers
|
PROGRAMMING
| 900
|
[
"brute force",
"greedy"
] | null | null |
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
|
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
|
Print "YES" if *n* is a magic number or print "NO" if it's not.
|
[
"114114\n",
"1111\n",
"441231\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
none
| 500
|
[
{
"input": "114114",
"output": "YES"
},
{
"input": "1111",
"output": "YES"
},
{
"input": "441231",
"output": "NO"
},
{
"input": "1",
"output": "YES"
},
{
"input": "14",
"output": "YES"
},
{
"input": "114",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "414",
"output": "NO"
},
{
"input": "1000000000",
"output": "NO"
},
{
"input": "144144144",
"output": "YES"
},
{
"input": "1444",
"output": "NO"
},
{
"input": "11",
"output": "YES"
},
{
"input": "141414141",
"output": "YES"
},
{
"input": "11110111",
"output": "NO"
},
{
"input": "114114144",
"output": "YES"
},
{
"input": "444",
"output": "NO"
},
{
"input": "9999",
"output": "NO"
},
{
"input": "111444",
"output": "NO"
},
{
"input": "11114",
"output": "YES"
},
{
"input": "41111",
"output": "NO"
},
{
"input": "114414441",
"output": "NO"
},
{
"input": "144414441",
"output": "NO"
},
{
"input": "144244144",
"output": "NO"
},
{
"input": "111111111",
"output": "YES"
},
{
"input": "144444444",
"output": "NO"
},
{
"input": "444444444",
"output": "NO"
},
{
"input": "141441441",
"output": "YES"
},
{
"input": "441",
"output": "NO"
},
{
"input": "15",
"output": "NO"
},
{
"input": "14444",
"output": "NO"
},
{
"input": "11444",
"output": "NO"
},
{
"input": "144",
"output": "YES"
},
{
"input": "1414414",
"output": "YES"
},
{
"input": "141444",
"output": "NO"
},
{
"input": "14144",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "1144",
"output": "YES"
},
{
"input": "141111444",
"output": "NO"
},
{
"input": "14414414",
"output": "YES"
},
{
"input": "141414144",
"output": "YES"
},
{
"input": "1414",
"output": "YES"
},
{
"input": "1441",
"output": "YES"
},
{
"input": "12",
"output": "NO"
},
{
"input": "144144141",
"output": "YES"
},
{
"input": "144144",
"output": "YES"
},
{
"input": "14414411",
"output": "YES"
},
{
"input": "14414",
"output": "YES"
}
] | 1,625,076,401
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 47
| 124
| 0
|
n = input()
for i in n:
if i!='1' and i!='4':
print('NO')
exit(0)
if '444' in n:
print('NO')
elif n[0] == '4':
print('NO')
else:
print('YES')
|
Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
Input Specification:
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Output Specification:
Print "YES" if *n* is a magic number or print "NO" if it's not.
Demo Input:
['114114\n', '1111\n', '441231\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none
|
```python
n = input()
for i in n:
if i!='1' and i!='4':
print('NO')
exit(0)
if '444' in n:
print('NO')
elif n[0] == '4':
print('NO')
else:
print('YES')
```
| 3
|
|
597
|
A
|
Divisibility
|
PROGRAMMING
| 1,600
|
[
"math"
] | null | null |
Find the number of *k*-divisible numbers on the segment [*a*,<=*b*]. In other words you need to find the number of such integer values *x* that *a*<=≤<=*x*<=≤<=*b* and *x* is divisible by *k*.
|
The only line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=1018;<=-<=1018<=≤<=*a*<=≤<=*b*<=≤<=1018).
|
Print the required number.
|
[
"1 1 10\n",
"2 -4 4\n"
] |
[
"10\n",
"5\n"
] |
none
| 500
|
[
{
"input": "1 1 10",
"output": "10"
},
{
"input": "2 -4 4",
"output": "5"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "1 0 0",
"output": "1"
},
{
"input": "1 0 1",
"output": "2"
},
{
"input": "1 10181 10182",
"output": "2"
},
{
"input": "1 10182 10183",
"output": "2"
},
{
"input": "1 -191 1011",
"output": "1203"
},
{
"input": "2 0 0",
"output": "1"
},
{
"input": "2 0 1",
"output": "1"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "2 2 3",
"output": "1"
},
{
"input": "2 -1 0",
"output": "1"
},
{
"input": "2 -1 1",
"output": "1"
},
{
"input": "2 -7 -6",
"output": "1"
},
{
"input": "2 -7 -5",
"output": "1"
},
{
"input": "2 -6 -6",
"output": "1"
},
{
"input": "2 -6 -4",
"output": "2"
},
{
"input": "2 -6 13",
"output": "10"
},
{
"input": "2 -19171 1911",
"output": "10541"
},
{
"input": "3 123 456",
"output": "112"
},
{
"input": "3 124 456",
"output": "111"
},
{
"input": "3 125 456",
"output": "111"
},
{
"input": "3 381 281911",
"output": "93844"
},
{
"input": "3 381 281912",
"output": "93844"
},
{
"input": "3 381 281913",
"output": "93845"
},
{
"input": "3 382 281911",
"output": "93843"
},
{
"input": "3 382 281912",
"output": "93843"
},
{
"input": "3 382 281913",
"output": "93844"
},
{
"input": "3 383 281911",
"output": "93843"
},
{
"input": "3 383 281912",
"output": "93843"
},
{
"input": "3 383 281913",
"output": "93844"
},
{
"input": "3 -381 281911",
"output": "94098"
},
{
"input": "3 -381 281912",
"output": "94098"
},
{
"input": "3 -381 281913",
"output": "94099"
},
{
"input": "3 -380 281911",
"output": "94097"
},
{
"input": "3 -380 281912",
"output": "94097"
},
{
"input": "3 -380 281913",
"output": "94098"
},
{
"input": "3 -379 281911",
"output": "94097"
},
{
"input": "3 -379 281912",
"output": "94097"
},
{
"input": "3 -379 281913",
"output": "94098"
},
{
"input": "3 -191381 -1911",
"output": "63157"
},
{
"input": "3 -191381 -1910",
"output": "63157"
},
{
"input": "3 -191381 -1909",
"output": "63157"
},
{
"input": "3 -191380 -1911",
"output": "63157"
},
{
"input": "3 -191380 -1910",
"output": "63157"
},
{
"input": "3 -191380 -1909",
"output": "63157"
},
{
"input": "3 -191379 -1911",
"output": "63157"
},
{
"input": "3 -191379 -1910",
"output": "63157"
},
{
"input": "3 -191379 -1909",
"output": "63157"
},
{
"input": "3 -2810171 0",
"output": "936724"
},
{
"input": "3 0 29101",
"output": "9701"
},
{
"input": "3 -2810170 0",
"output": "936724"
},
{
"input": "3 0 29102",
"output": "9701"
},
{
"input": "3 -2810169 0",
"output": "936724"
},
{
"input": "3 0 29103",
"output": "9702"
},
{
"input": "1 -1000000000000000000 1000000000000000000",
"output": "2000000000000000001"
},
{
"input": "2 -1000000000000000000 1000000000000000000",
"output": "1000000000000000001"
},
{
"input": "3 -1000000000000000000 1000000000000000000",
"output": "666666666666666667"
},
{
"input": "4 -1000000000000000000 1000000000000000000",
"output": "500000000000000001"
},
{
"input": "5 -1000000000000000000 1000000000000000000",
"output": "400000000000000001"
},
{
"input": "6 -1000000000000000000 1000000000000000000",
"output": "333333333333333333"
},
{
"input": "7 -1000000000000000000 1000000000000000000",
"output": "285714285714285715"
},
{
"input": "1 -1000000000000000000 -100000000000000000",
"output": "900000000000000001"
},
{
"input": "2 -1000000000000000000 -10000000000000000",
"output": "495000000000000001"
},
{
"input": "3 -1000000000000000000 -10218000000000000",
"output": "329927333333333334"
},
{
"input": "4 -1000000000000000000 -320110181919100",
"output": "249919972454520226"
},
{
"input": "5 -1000000000000000000 -402710171917",
"output": "199999919457965617"
},
{
"input": "6 -1000000000000000000 -6666666666",
"output": "166666665555555556"
},
{
"input": "7 -1000000000000000000 -77777777777778",
"output": "142846031746031746"
},
{
"input": "1000000000000000000 -1000000000000000000 1000000000000000000",
"output": "3"
},
{
"input": "1000000000000000000 0 1000000000000000000",
"output": "2"
},
{
"input": "1000000000000000000 1000000000000000000 1000000000000000000",
"output": "1"
},
{
"input": "100000000000000321 1000000000000000000 1000000000000000000",
"output": "0"
},
{
"input": "100000000000000321 -1000000000000000000 1000000000000000000",
"output": "19"
},
{
"input": "1000000000000000000 0 0",
"output": "1"
},
{
"input": "1000000000000000000 1 1",
"output": "0"
},
{
"input": "1000000000000000000 -1 -1",
"output": "0"
},
{
"input": "1000000000000000000 -2 -1",
"output": "0"
},
{
"input": "142000000000000271 -228118171 -1382811",
"output": "0"
},
{
"input": "1 1 1000000000000000000",
"output": "1000000000000000000"
}
] | 1,480,940,712
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 56
| 1,000
| 0
|
k, a, b = map(int, input().split())
count = 0
for i in range(a, b+1):
if not i % k:
count += 1
print(count)
|
Title: Divisibility
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Find the number of *k*-divisible numbers on the segment [*a*,<=*b*]. In other words you need to find the number of such integer values *x* that *a*<=≤<=*x*<=≤<=*b* and *x* is divisible by *k*.
Input Specification:
The only line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=1018;<=-<=1018<=≤<=*a*<=≤<=*b*<=≤<=1018).
Output Specification:
Print the required number.
Demo Input:
['1 1 10\n', '2 -4 4\n']
Demo Output:
['10\n', '5\n']
Note:
none
|
```python
k, a, b = map(int, input().split())
count = 0
for i in range(a, b+1):
if not i % k:
count += 1
print(count)
```
| 0
|
|
0
|
none
|
none
|
none
| 0
|
[
"none"
] | null | null |
Each New Year Timofey and his friends cut down a tree of *n* vertices and bring it home. After that they paint all the *n* its vertices, so that the *i*-th vertex gets color *c**i*.
Now it's time for Timofey birthday, and his mother asked him to remove the tree. Timofey removes the tree in the following way: he takes some vertex in hands, while all the other vertices move down so that the tree becomes rooted at the chosen vertex. After that Timofey brings the tree to a trash can.
Timofey doesn't like it when many colors are mixing together. A subtree annoys him if there are vertices of different color in it. Timofey wants to find a vertex which he should take in hands so that there are no subtrees that annoy him. He doesn't consider the whole tree as a subtree since he can't see the color of the root vertex.
A subtree of some vertex is a subgraph containing that vertex and all its descendants.
Your task is to determine if there is a vertex, taking which in hands Timofey wouldn't be annoyed.
|
The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the number of vertices in the tree.
Each of the next *n*<=-<=1 lines contains two integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*, *u*<=≠<=*v*), denoting there is an edge between vertices *u* and *v*. It is guaranteed that the given graph is a tree.
The next line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=105), denoting the colors of the vertices.
|
Print "NO" in a single line, if Timofey can't take the tree in such a way that it doesn't annoy him.
Otherwise print "YES" in the first line. In the second line print the index of the vertex which Timofey should take in hands. If there are multiple answers, print any of them.
|
[
"4\n1 2\n2 3\n3 4\n1 2 1 1\n",
"3\n1 2\n2 3\n1 2 3\n",
"4\n1 2\n2 3\n3 4\n1 2 1 2\n"
] |
[
"YES\n2",
"YES\n2",
"NO"
] |
none
| 0
|
[
{
"input": "4\n1 2\n2 3\n3 4\n1 2 1 1",
"output": "YES\n2"
},
{
"input": "3\n1 2\n2 3\n1 2 3",
"output": "YES\n2"
},
{
"input": "4\n1 2\n2 3\n3 4\n1 2 1 2",
"output": "NO"
},
{
"input": "3\n2 1\n2 3\n1 2 3",
"output": "YES\n2"
},
{
"input": "4\n1 2\n2 4\n4 3\n1 1 3 2",
"output": "YES\n4"
},
{
"input": "2\n1 2\n1 1",
"output": "YES\n1"
},
{
"input": "10\n5 7\n4 5\n10 2\n3 6\n1 2\n3 4\n8 5\n4 9\n2 3\n15 15 15 15 5 15 26 18 15 15",
"output": "YES\n5"
},
{
"input": "8\n1 2\n1 3\n3 5\n3 6\n1 4\n4 7\n4 8\n1 3 1 1 1 1 1 2",
"output": "NO"
},
{
"input": "3\n2 1\n2 3\n4 4 4",
"output": "YES\n1"
},
{
"input": "3\n1 2\n1 3\n1 2 2",
"output": "YES\n1"
},
{
"input": "4\n1 4\n2 4\n3 4\n1 2 3 1",
"output": "YES\n4"
},
{
"input": "4\n1 2\n1 3\n1 4\n1 2 3 4",
"output": "YES\n1"
},
{
"input": "9\n1 2\n2 3\n3 4\n4 5\n2 7\n7 6\n2 8\n8 9\n1 1 2 2 2 3 3 4 4",
"output": "YES\n2"
},
{
"input": "3\n2 1\n2 3\n4 4 5",
"output": "YES\n2"
},
{
"input": "4\n1 2\n2 3\n3 4\n1 2 2 1",
"output": "NO"
}
] | 1,486,132,823
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 4
| 77
| 4,915,200
|
n=int(input())
graph=dict()
for i in range(1,n+1):
graph[i]=[]
parent=dict()
diff=[]
for i in range(n-1):
u,v=map(int,input().split())
graph[u].append(v)
parent[v]=u
color=list(map(int,input().split()))
# print(color)
# print(graph)
flag=0
for i in range(1,n+1):
if(graph[i]!=[]):
flag=0
for j in graph[i]:
if(color[i-1]!=color[j-1]):
diff.append(i)
diff.append(j)
flag=1
break
if(flag==1):
break
#print(diff)
if(flag!=0):
# making parent as the root
check=[None for i in range(n)]
def dfs(graph,node,col,check):
#print(node,col,color[node-1])
if(color[node-1]!=col):
return -1
check[node-1]=0
if(graph[node]!=[]):
for i in graph[node]:
f=dfs(graph,i,col,check)
if(f==-1):
return -1
return 1
#print("check",check)
check[diff[0]-1]=0
f=0
for i in graph[diff[0]]:
f=dfs(graph,i,color[i-1],check)
# print(f,i)
if(f==-1):
break
if(None not in check): # all the nodes are done
print("YES")
print(diff[0])
elif(f!=-1):# if all the children satisfy the condition
flag1=0
for i in range(n):
if(check[i]==None):
for j in range(i+1,n):
if(check[j]==None and color[j-1]!=color[i-1]):
f=-1 # two different colors found
break
if(f!=-1):
print("YES")
print(diff[0])
break
else: # the checking of the children node has started
check1=[None for i in range(n)]
check1[diff[1]-1]=0
f=0
for i in graph[diff[1]]:
f=dfs(graph,i,color[i-1],check1)
if(f==-1):
break
if(None not in check1):
print("YES")
print(diff[1])
elif(f!=-1):# if all the children satisfy the condition
for i in range(n):
if(check1[i]==None):
for j in range(i+1,n):
if(check1[j]==None and color[j-1]!=color[i-1]):
f=-1 # two different colors found
break
if(f!=-1):
print("YES")
print(diff[1])
break
else:
print("NO")
else:
print("YES")
print(1)
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Each New Year Timofey and his friends cut down a tree of *n* vertices and bring it home. After that they paint all the *n* its vertices, so that the *i*-th vertex gets color *c**i*.
Now it's time for Timofey birthday, and his mother asked him to remove the tree. Timofey removes the tree in the following way: he takes some vertex in hands, while all the other vertices move down so that the tree becomes rooted at the chosen vertex. After that Timofey brings the tree to a trash can.
Timofey doesn't like it when many colors are mixing together. A subtree annoys him if there are vertices of different color in it. Timofey wants to find a vertex which he should take in hands so that there are no subtrees that annoy him. He doesn't consider the whole tree as a subtree since he can't see the color of the root vertex.
A subtree of some vertex is a subgraph containing that vertex and all its descendants.
Your task is to determine if there is a vertex, taking which in hands Timofey wouldn't be annoyed.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=105) — the number of vertices in the tree.
Each of the next *n*<=-<=1 lines contains two integers *u* and *v* (1<=≤<=*u*,<=*v*<=≤<=*n*, *u*<=≠<=*v*), denoting there is an edge between vertices *u* and *v*. It is guaranteed that the given graph is a tree.
The next line contains *n* integers *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=105), denoting the colors of the vertices.
Output Specification:
Print "NO" in a single line, if Timofey can't take the tree in such a way that it doesn't annoy him.
Otherwise print "YES" in the first line. In the second line print the index of the vertex which Timofey should take in hands. If there are multiple answers, print any of them.
Demo Input:
['4\n1 2\n2 3\n3 4\n1 2 1 1\n', '3\n1 2\n2 3\n1 2 3\n', '4\n1 2\n2 3\n3 4\n1 2 1 2\n']
Demo Output:
['YES\n2', 'YES\n2', 'NO']
Note:
none
|
```python
n=int(input())
graph=dict()
for i in range(1,n+1):
graph[i]=[]
parent=dict()
diff=[]
for i in range(n-1):
u,v=map(int,input().split())
graph[u].append(v)
parent[v]=u
color=list(map(int,input().split()))
# print(color)
# print(graph)
flag=0
for i in range(1,n+1):
if(graph[i]!=[]):
flag=0
for j in graph[i]:
if(color[i-1]!=color[j-1]):
diff.append(i)
diff.append(j)
flag=1
break
if(flag==1):
break
#print(diff)
if(flag!=0):
# making parent as the root
check=[None for i in range(n)]
def dfs(graph,node,col,check):
#print(node,col,color[node-1])
if(color[node-1]!=col):
return -1
check[node-1]=0
if(graph[node]!=[]):
for i in graph[node]:
f=dfs(graph,i,col,check)
if(f==-1):
return -1
return 1
#print("check",check)
check[diff[0]-1]=0
f=0
for i in graph[diff[0]]:
f=dfs(graph,i,color[i-1],check)
# print(f,i)
if(f==-1):
break
if(None not in check): # all the nodes are done
print("YES")
print(diff[0])
elif(f!=-1):# if all the children satisfy the condition
flag1=0
for i in range(n):
if(check[i]==None):
for j in range(i+1,n):
if(check[j]==None and color[j-1]!=color[i-1]):
f=-1 # two different colors found
break
if(f!=-1):
print("YES")
print(diff[0])
break
else: # the checking of the children node has started
check1=[None for i in range(n)]
check1[diff[1]-1]=0
f=0
for i in graph[diff[1]]:
f=dfs(graph,i,color[i-1],check1)
if(f==-1):
break
if(None not in check1):
print("YES")
print(diff[1])
elif(f!=-1):# if all the children satisfy the condition
for i in range(n):
if(check1[i]==None):
for j in range(i+1,n):
if(check1[j]==None and color[j-1]!=color[i-1]):
f=-1 # two different colors found
break
if(f!=-1):
print("YES")
print(diff[1])
break
else:
print("NO")
else:
print("YES")
print(1)
```
| 0
|
|
97
|
E
|
Leaders
|
PROGRAMMING
| 2,200
|
[
"dfs and similar",
"dsu",
"graphs",
"trees"
] |
E. Leaders
|
2
|
256
|
After a revolution in Berland the new dictator faced an unexpected challenge: the country has to be somehow ruled. The dictator is a very efficient manager, yet he can't personally give orders to each and every citizen. That's why he decided to pick some set of leaders he would control. Those leaders will directly order the citizens. However, leadership efficiency turned out to vary from person to person (i.e. while person A makes an efficient leader, person B may not be that good at it). That's why the dictator asked world-famous berland scientists for help. The scientists suggested an innovatory technology — to make the leaders work in pairs.
A relationship graph is some undirected graph whose vertices correspond to people. A simple path is a path with no repeated vertices. Long and frighteningly expensive research showed that a pair of people has maximum leadership qualities if a graph of relationships has a simple path between them with an odd number of edges. The scientists decided to call such pairs of different people leader pairs. Secret services provided the scientists with the relationship graph so that the task is simple — we have to learn to tell the dictator whether the given pairs are leader pairs or not. Help the scientists cope with the task.
|
The first line contains integers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of vertices and edges in the relationship graph correspondingly. Next *m* lines contain pairs of integers *a* and *b* which mean that there is an edge between the *a*-th and the *b*-th vertices (the vertices are numbered starting from 1, 1<=≤<=*a*,<=*b*<=≤<=*n*). It is guaranteed that the graph has no loops or multiple edges.
Next line contains number *q* (1<=≤<=*q*<=≤<=105) — the number of pairs the scientists are interested in. Next *q* lines contain these pairs (in the same format as the edges, the queries can be repeated, a query can contain a pair of the identical vertices).
|
For each query print on a single line "Yes" if there's a simple odd path between the pair of people; otherwise, print "No".
|
[
"7 7\n1 3\n1 4\n2 3\n2 4\n5 6\n6 7\n7 5\n8\n1 2\n1 3\n1 4\n2 4\n1 5\n5 6\n5 7\n6 7\n"
] |
[
"No\nYes\nYes\nYes\nNo\nYes\nYes\nYes\n"
] |
Notes to the samples:
1) Between vertices 1 and 2 there are 2 different simple paths in total: 1-3-2 and 1-4-2. Both of them consist of an even number of edges.
2) Vertices 1 and 3 are connected by an edge, that's why a simple odd path for them is 1-3.
5) Vertices 1 and 5 are located in different connected components, there's no path between them.
| 2,500
|
[] | 1,524,252,974
| 2,147,483,647
|
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7
| 2,000
| 66,355,200
|
def dfs_iterative(graph, start, destination):
"""
Generate all paths from start to destination.
"""
stack = [(start, [start])]
while stack:
node, path = stack.pop()
if node == destination:
yield path
stack.extend((adj, path + [adj]) for adj in set(graph[node]) - set(path))
def correct(graph, start, destination):
for i in dfs_iterative(graph, start, destination):
if (len(i) - 1) % 2 == 0:
continue
else:
return True
return False
if __name__ == "__main__":
n, m = map(int, input().split())
grafo = {i + 1: [] for i in range(n)}
for i in range(m):
a, b = map(int, input().split())
grafo[a].append(b)
grafo[b].append(a)
q = int(input())
results = []
for j in range(q):
a, b = map(int, input().split())
if correct(grafo, a, b):
results.append('Yes')
else:
results.append('No')
for j in results:
print(j)
|
Title: Leaders
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
After a revolution in Berland the new dictator faced an unexpected challenge: the country has to be somehow ruled. The dictator is a very efficient manager, yet he can't personally give orders to each and every citizen. That's why he decided to pick some set of leaders he would control. Those leaders will directly order the citizens. However, leadership efficiency turned out to vary from person to person (i.e. while person A makes an efficient leader, person B may not be that good at it). That's why the dictator asked world-famous berland scientists for help. The scientists suggested an innovatory technology — to make the leaders work in pairs.
A relationship graph is some undirected graph whose vertices correspond to people. A simple path is a path with no repeated vertices. Long and frighteningly expensive research showed that a pair of people has maximum leadership qualities if a graph of relationships has a simple path between them with an odd number of edges. The scientists decided to call such pairs of different people leader pairs. Secret services provided the scientists with the relationship graph so that the task is simple — we have to learn to tell the dictator whether the given pairs are leader pairs or not. Help the scientists cope with the task.
Input Specification:
The first line contains integers *n* and *m* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*m*<=≤<=105) — the number of vertices and edges in the relationship graph correspondingly. Next *m* lines contain pairs of integers *a* and *b* which mean that there is an edge between the *a*-th and the *b*-th vertices (the vertices are numbered starting from 1, 1<=≤<=*a*,<=*b*<=≤<=*n*). It is guaranteed that the graph has no loops or multiple edges.
Next line contains number *q* (1<=≤<=*q*<=≤<=105) — the number of pairs the scientists are interested in. Next *q* lines contain these pairs (in the same format as the edges, the queries can be repeated, a query can contain a pair of the identical vertices).
Output Specification:
For each query print on a single line "Yes" if there's a simple odd path between the pair of people; otherwise, print "No".
Demo Input:
['7 7\n1 3\n1 4\n2 3\n2 4\n5 6\n6 7\n7 5\n8\n1 2\n1 3\n1 4\n2 4\n1 5\n5 6\n5 7\n6 7\n']
Demo Output:
['No\nYes\nYes\nYes\nNo\nYes\nYes\nYes\n']
Note:
Notes to the samples:
1) Between vertices 1 and 2 there are 2 different simple paths in total: 1-3-2 and 1-4-2. Both of them consist of an even number of edges.
2) Vertices 1 and 3 are connected by an edge, that's why a simple odd path for them is 1-3.
5) Vertices 1 and 5 are located in different connected components, there's no path between them.
|
```python
def dfs_iterative(graph, start, destination):
"""
Generate all paths from start to destination.
"""
stack = [(start, [start])]
while stack:
node, path = stack.pop()
if node == destination:
yield path
stack.extend((adj, path + [adj]) for adj in set(graph[node]) - set(path))
def correct(graph, start, destination):
for i in dfs_iterative(graph, start, destination):
if (len(i) - 1) % 2 == 0:
continue
else:
return True
return False
if __name__ == "__main__":
n, m = map(int, input().split())
grafo = {i + 1: [] for i in range(n)}
for i in range(m):
a, b = map(int, input().split())
grafo[a].append(b)
grafo[b].append(a)
q = int(input())
results = []
for j in range(q):
a, b = map(int, input().split())
if correct(grafo, a, b):
results.append('Yes')
else:
results.append('No')
for j in results:
print(j)
```
| 0
|
948
|
A
|
Protect Sheep
|
PROGRAMMING
| 900
|
[
"brute force",
"dfs and similar",
"graphs",
"implementation"
] | null | null |
Bob is a farmer. He has a large pasture with many sheep. Recently, he has lost some of them due to wolf attacks. He thus decided to place some shepherd dogs in such a way that all his sheep are protected.
The pasture is a rectangle consisting of *R*<=×<=*C* cells. Each cell is either empty, contains a sheep, a wolf or a dog. Sheep and dogs always stay in place, but wolves can roam freely around the pasture, by repeatedly moving to the left, right, up or down to a neighboring cell. When a wolf enters a cell with a sheep, it consumes it. However, no wolf can enter a cell with a dog.
Initially there are no dogs. Place dogs onto the pasture in such a way that no wolf can reach any sheep, or determine that it is impossible. Note that since you have many dogs, you do not need to minimize their number.
|
First line contains two integers *R* (1<=≤<=*R*<=≤<=500) and *C* (1<=≤<=*C*<=≤<=500), denoting the number of rows and the numbers of columns respectively.
Each of the following *R* lines is a string consisting of exactly *C* characters, representing one row of the pasture. Here, 'S' means a sheep, 'W' a wolf and '.' an empty cell.
|
If it is impossible to protect all sheep, output a single line with the word "No".
Otherwise, output a line with the word "Yes". Then print *R* lines, representing the pasture after placing dogs. Again, 'S' means a sheep, 'W' a wolf, 'D' is a dog and '.' an empty space. You are not allowed to move, remove or add a sheep or a wolf.
If there are multiple solutions, you may print any of them. You don't have to minimize the number of dogs.
|
[
"6 6\n..S...\n..S.W.\n.S....\n..W...\n...W..\n......\n",
"1 2\nSW\n",
"5 5\n.S...\n...S.\nS....\n...S.\n.S...\n"
] |
[
"Yes\n..SD..\n..SDW.\n.SD...\n.DW...\nDD.W..\n......\n",
"No\n",
"Yes\n.S...\n...S.\nS.D..\n...S.\n.S...\n"
] |
In the first example, we can split the pasture into two halves, one containing wolves and one containing sheep. Note that the sheep at (2,1) is safe, as wolves cannot move diagonally.
In the second example, there are no empty spots to put dogs that would guard the lone sheep.
In the third example, there are no wolves, so the task is very easy. We put a dog in the center to observe the peacefulness of the meadow, but the solution would be correct even without him.
| 500
|
[
{
"input": "1 2\nSW",
"output": "No"
},
{
"input": "10 10\n....W.W.W.\n.........S\n.S.S...S..\nW.......SS\n.W..W.....\n.W...W....\nS..S...S.S\n....W...S.\n..S..S.S.S\nSS.......S",
"output": "Yes\nDDDDWDWDWD\nDDDDDDDDDS\nDSDSDDDSDD\nWDDDDDDDSS\nDWDDWDDDDD\nDWDDDWDDDD\nSDDSDDDSDS\nDDDDWDDDSD\nDDSDDSDSDS\nSSDDDDDDDS"
},
{
"input": "10 10\n....W.W.W.\n...W.....S\n.S.S...S..\nW......WSS\n.W..W.....\n.W...W....\nS..S...S.S\n...WWW..S.\n..S..S.S.S\nSS.......S",
"output": "No"
},
{
"input": "1 50\nW...S..............W.....S..S...............S...W.",
"output": "Yes\nWDDDSDDDDDDDDDDDDDDWDDDDDSDDSDDDDDDDDDDDDDDDSDDDWD"
},
{
"input": "2 4\n...S\n...W",
"output": "No"
},
{
"input": "4 2\n..\n..\n..\nSW",
"output": "No"
},
{
"input": "4 2\n..\n..\n..\nWS",
"output": "No"
},
{
"input": "2 4\n...W\n...S",
"output": "No"
},
{
"input": "50 1\nS\n.\n.\n.\n.\n.\n.\nS\n.\n.\n.\n.\n.\n.\n.\n.\nS\n.\nW\n.\nS\n.\n.\n.\n.\nS\n.\n.\n.\n.\n.\n.\n.\nW\n.\n.\n.\nW\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "Yes\nS\nD\nD\nD\nD\nD\nD\nS\nD\nD\nD\nD\nD\nD\nD\nD\nS\nD\nW\nD\nS\nD\nD\nD\nD\nS\nD\nD\nD\nD\nD\nD\nD\nW\nD\nD\nD\nW\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD"
},
{
"input": "4 4\nW..S\nW..S\nW..S\nW..S",
"output": "Yes\nWDDS\nWDDS\nWDDS\nWDDS"
},
{
"input": "4 4\nSSSS\n....\n....\nWWWW",
"output": "Yes\nSSSS\nDDDD\nDDDD\nWWWW"
},
{
"input": "4 4\nWWWW\n....\n....\nSSSS",
"output": "Yes\nWWWW\nDDDD\nDDDD\nSSSS"
},
{
"input": "4 4\nS..W\nS..W\nS..W\nS..W",
"output": "Yes\nSDDW\nSDDW\nSDDW\nSDDW"
},
{
"input": "1 1\n.",
"output": "Yes\nD"
},
{
"input": "1 1\nW",
"output": "Yes\nW"
},
{
"input": "1 1\nS",
"output": "Yes\nS"
},
{
"input": "4 2\n..\n..\n.W\n.S",
"output": "No"
},
{
"input": "4 2\n..\n..\n.S\n.W",
"output": "No"
},
{
"input": "4 2\n..\n..\nW.\nS.",
"output": "No"
},
{
"input": "4 2\n..\n..\nS.\nW.",
"output": "No"
},
{
"input": "2 4\n....\n..SW",
"output": "No"
},
{
"input": "2 4\n....\n..WS",
"output": "No"
},
{
"input": "1 2\nS.",
"output": "Yes\nSD"
}
] | 1,520,831,020
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 77
| 6,041,600
|
import re
r,c=map(int,input().split())
s='\n'.join(input().replace('.','D')for _ in[0]*r)
print('No'if re.search(f'(?s)(S.{{{c}}}?W)|(W.{{{c}}}?S)',s)else'Yes\n'+s)
|
Title: Protect Sheep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bob is a farmer. He has a large pasture with many sheep. Recently, he has lost some of them due to wolf attacks. He thus decided to place some shepherd dogs in such a way that all his sheep are protected.
The pasture is a rectangle consisting of *R*<=×<=*C* cells. Each cell is either empty, contains a sheep, a wolf or a dog. Sheep and dogs always stay in place, but wolves can roam freely around the pasture, by repeatedly moving to the left, right, up or down to a neighboring cell. When a wolf enters a cell with a sheep, it consumes it. However, no wolf can enter a cell with a dog.
Initially there are no dogs. Place dogs onto the pasture in such a way that no wolf can reach any sheep, or determine that it is impossible. Note that since you have many dogs, you do not need to minimize their number.
Input Specification:
First line contains two integers *R* (1<=≤<=*R*<=≤<=500) and *C* (1<=≤<=*C*<=≤<=500), denoting the number of rows and the numbers of columns respectively.
Each of the following *R* lines is a string consisting of exactly *C* characters, representing one row of the pasture. Here, 'S' means a sheep, 'W' a wolf and '.' an empty cell.
Output Specification:
If it is impossible to protect all sheep, output a single line with the word "No".
Otherwise, output a line with the word "Yes". Then print *R* lines, representing the pasture after placing dogs. Again, 'S' means a sheep, 'W' a wolf, 'D' is a dog and '.' an empty space. You are not allowed to move, remove or add a sheep or a wolf.
If there are multiple solutions, you may print any of them. You don't have to minimize the number of dogs.
Demo Input:
['6 6\n..S...\n..S.W.\n.S....\n..W...\n...W..\n......\n', '1 2\nSW\n', '5 5\n.S...\n...S.\nS....\n...S.\n.S...\n']
Demo Output:
['Yes\n..SD..\n..SDW.\n.SD...\n.DW...\nDD.W..\n......\n', 'No\n', 'Yes\n.S...\n...S.\nS.D..\n...S.\n.S...\n']
Note:
In the first example, we can split the pasture into two halves, one containing wolves and one containing sheep. Note that the sheep at (2,1) is safe, as wolves cannot move diagonally.
In the second example, there are no empty spots to put dogs that would guard the lone sheep.
In the third example, there are no wolves, so the task is very easy. We put a dog in the center to observe the peacefulness of the meadow, but the solution would be correct even without him.
|
```python
import re
r,c=map(int,input().split())
s='\n'.join(input().replace('.','D')for _ in[0]*r)
print('No'if re.search(f'(?s)(S.{{{c}}}?W)|(W.{{{c}}}?S)',s)else'Yes\n'+s)
```
| 0
|
|
810
|
B
|
Summer sell-off
|
PROGRAMMING
| 1,300
|
[
"greedy",
"sortings"
] | null | null |
Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant.
Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump.
For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out.
Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem.
|
The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out.
Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day.
|
Print a single integer denoting the maximal number of products that shop can sell.
|
[
"4 2\n2 1\n3 5\n2 3\n1 5\n",
"4 1\n0 2\n0 3\n3 5\n0 6\n"
] |
[
"10",
"5"
] |
In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units.
In the second example it is possible to sell 5 products, if you choose third day for sell-out.
| 1,000
|
[
{
"input": "4 2\n2 1\n3 5\n2 3\n1 5",
"output": "10"
},
{
"input": "4 1\n0 2\n0 3\n3 5\n0 6",
"output": "5"
},
{
"input": "1 1\n5 8",
"output": "8"
},
{
"input": "2 1\n8 12\n6 11",
"output": "19"
},
{
"input": "2 1\n6 7\n5 7",
"output": "13"
},
{
"input": "2 1\n5 7\n6 7",
"output": "13"
},
{
"input": "2 1\n7 8\n3 6",
"output": "13"
},
{
"input": "2 1\n9 10\n5 8",
"output": "17"
},
{
"input": "2 1\n3 6\n7 8",
"output": "13"
},
{
"input": "1 0\n10 20",
"output": "10"
},
{
"input": "2 1\n99 100\n3 6",
"output": "105"
},
{
"input": "4 2\n2 10\n3 10\n9 9\n5 10",
"output": "27"
},
{
"input": "2 1\n3 4\n2 8",
"output": "7"
},
{
"input": "50 2\n74 90\n68 33\n49 88\n52 13\n73 21\n77 63\n27 62\n8 52\n60 57\n42 83\n98 15\n79 11\n77 46\n55 91\n72 100\n70 86\n50 51\n57 39\n20 54\n64 95\n66 22\n79 64\n31 28\n11 89\n1 36\n13 4\n75 62\n16 62\n100 35\n43 96\n97 54\n86 33\n62 63\n94 24\n19 6\n20 58\n38 38\n11 76\n70 40\n44 24\n32 96\n28 100\n62 45\n41 68\n90 52\n16 0\n98 32\n81 79\n67 82\n28 2",
"output": "1889"
},
{
"input": "2 1\n10 5\n2 4",
"output": "9"
},
{
"input": "2 1\n50 51\n30 40",
"output": "90"
},
{
"input": "3 2\n5 10\n5 10\n7 9",
"output": "27"
},
{
"input": "3 1\n1000 1000\n50 100\n2 2",
"output": "1102"
},
{
"input": "2 1\n2 4\n12 12",
"output": "16"
},
{
"input": "2 1\n4 4\n1 2",
"output": "6"
},
{
"input": "2 1\n4000 4000\n1 2",
"output": "4002"
},
{
"input": "2 1\n5 6\n2 4",
"output": "9"
},
{
"input": "3 2\n10 10\n10 10\n1 2",
"output": "22"
},
{
"input": "10 5\n9 1\n11 1\n12 1\n13 1\n14 1\n2 4\n2 4\n2 4\n2 4\n2 4",
"output": "25"
},
{
"input": "2 1\n30 30\n10 20",
"output": "50"
},
{
"input": "1 1\n1 1",
"output": "1"
},
{
"input": "2 1\n10 2\n2 10",
"output": "6"
},
{
"input": "2 1\n4 5\n3 9",
"output": "10"
},
{
"input": "2 1\n100 100\n5 10",
"output": "110"
},
{
"input": "2 1\n14 28\n15 28",
"output": "43"
},
{
"input": "2 1\n100 1\n20 40",
"output": "41"
},
{
"input": "2 1\n5 10\n6 10",
"output": "16"
},
{
"input": "2 1\n29 30\n10 20",
"output": "49"
},
{
"input": "1 0\n12 12",
"output": "12"
},
{
"input": "2 1\n7 8\n4 7",
"output": "14"
},
{
"input": "2 1\n5 5\n2 4",
"output": "9"
},
{
"input": "2 1\n1 2\n228 2",
"output": "4"
},
{
"input": "2 1\n5 10\n100 20",
"output": "30"
},
{
"input": "2 1\n1000 1001\n2 4",
"output": "1004"
},
{
"input": "2 1\n3 9\n7 7",
"output": "13"
},
{
"input": "2 0\n1 1\n1 1",
"output": "2"
},
{
"input": "4 1\n10 10\n10 10\n10 10\n4 6",
"output": "36"
},
{
"input": "18 13\n63 8\n87 100\n18 89\n35 29\n66 81\n27 85\n64 51\n60 52\n32 94\n74 22\n86 31\n43 78\n12 2\n36 2\n67 23\n2 16\n78 71\n34 64",
"output": "772"
},
{
"input": "2 1\n10 18\n17 19",
"output": "35"
},
{
"input": "3 0\n1 1\n1 1\n1 1",
"output": "3"
},
{
"input": "2 1\n4 7\n8 9",
"output": "15"
},
{
"input": "4 2\n2 10\n3 10\n9 10\n5 10",
"output": "27"
},
{
"input": "2 1\n5 7\n3 6",
"output": "11"
},
{
"input": "2 1\n3 4\n12 12",
"output": "16"
},
{
"input": "2 1\n10 11\n9 20",
"output": "28"
},
{
"input": "2 1\n7 8\n2 4",
"output": "11"
},
{
"input": "2 1\n5 10\n7 10",
"output": "17"
},
{
"input": "4 2\n2 10\n3 10\n5 10\n9 10",
"output": "27"
},
{
"input": "2 1\n99 100\n5 10",
"output": "109"
},
{
"input": "4 2\n2 10\n3 10\n5 10\n9 9",
"output": "27"
},
{
"input": "2 1\n3 7\n5 7",
"output": "11"
},
{
"input": "2 1\n10 10\n3 6",
"output": "16"
},
{
"input": "2 1\n100 1\n2 4",
"output": "5"
},
{
"input": "5 0\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "5"
},
{
"input": "3 1\n3 7\n4 5\n2 3",
"output": "12"
},
{
"input": "2 1\n3 9\n7 8",
"output": "13"
},
{
"input": "2 1\n10 2\n3 4",
"output": "6"
},
{
"input": "2 1\n40 40\n3 5",
"output": "45"
},
{
"input": "2 1\n5 3\n1 2",
"output": "5"
},
{
"input": "10 5\n9 5\n10 5\n11 5\n12 5\n13 5\n2 4\n2 4\n2 4\n2 4\n2 4",
"output": "45"
},
{
"input": "3 1\n1 5\n1 5\n4 4",
"output": "7"
},
{
"input": "4 0\n1 1\n1 1\n1 1\n1 1",
"output": "4"
},
{
"input": "4 1\n1000 1001\n1000 1001\n2 4\n1 2",
"output": "2005"
},
{
"input": "2 1\n15 30\n50 59",
"output": "80"
},
{
"input": "2 1\n8 8\n3 5",
"output": "13"
},
{
"input": "2 1\n4 5\n2 5",
"output": "8"
},
{
"input": "3 2\n3 3\n1 2\n1 2",
"output": "7"
},
{
"input": "3 1\n2 5\n2 5\n4 4",
"output": "10"
},
{
"input": "2 1\n3 10\n50 51",
"output": "56"
},
{
"input": "4 2\n2 4\n2 4\n9 10\n9 10",
"output": "26"
},
{
"input": "2 1\n3 5\n8 8",
"output": "13"
},
{
"input": "2 1\n100 150\n70 150",
"output": "240"
},
{
"input": "2 1\n4 5\n3 6",
"output": "10"
},
{
"input": "2 1\n20 10\n3 5",
"output": "15"
},
{
"input": "15 13\n76167099 92301116\n83163126 84046805\n45309500 65037149\n29982002 77381688\n76738161 52935441\n37889502 25466134\n55955619 14197941\n31462620 12999429\n64648384 8824773\n3552934 68992494\n2823376 9338427\n86832070 3763091\n67753633 2162190\n302887 92011825\n84894984 410533",
"output": "435467000"
},
{
"input": "2 1\n8 7\n3 6",
"output": "13"
},
{
"input": "2 1\n7 8\n3 5",
"output": "12"
},
{
"input": "2 1\n10 10\n1 3",
"output": "12"
},
{
"input": "2 1\n9 10\n2 4",
"output": "13"
},
{
"input": "3 1\n10 11\n12 13\n8 10",
"output": "32"
},
{
"input": "2 1\n5 10\n7 7",
"output": "17"
},
{
"input": "4 2\n90 91\n2 10\n2 10\n2 10",
"output": "100"
},
{
"input": "2 1\n2 4\n4 4",
"output": "8"
},
{
"input": "2 1\n2 3\n4 3",
"output": "6"
},
{
"input": "2 1\n40 45\n50 52",
"output": "95"
},
{
"input": "3 1\n1 4\n2 4\n3 4",
"output": "8"
},
{
"input": "2 1\n1 2\n1000 1000",
"output": "1002"
},
{
"input": "2 1\n80 100\n70 95",
"output": "175"
}
] | 1,617,400,532
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 46
| 0
|
if __name__ == "main":
numOfDays, sellOffDays = list(map(int, input().split()))
totalProductsSold = 0
l = []
for i in range(numOfDays):
numOfProduct, numOfClients = map(int, input().split())
totalProductsSold += min(numOfProduct, numOfClients)
l.append(min(2*numOfProduct, numOfClients))
l.sort()
print(totalProductsSold + sum(l[numOfDays - sellOffDays:]))
|
Title: Summer sell-off
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Summer holidays! Someone is going on trips, someone is visiting grandparents, but someone is trying to get a part-time job. This summer Noora decided that she wants to earn some money, and took a job in a shop as an assistant.
Shop, where Noora is working, has a plan on the following *n* days. For each day sales manager knows exactly, that in *i*-th day *k**i* products will be put up for sale and exactly *l**i* clients will come to the shop that day. Also, the manager is sure, that everyone, who comes to the shop, buys exactly one product or, if there aren't any left, leaves the shop without buying anything. Moreover, due to the short shelf-life of the products, manager established the following rule: if some part of the products left on the shelves at the end of the day, that products aren't kept on the next day and are sent to the dump.
For advertising purposes manager offered to start a sell-out in the shop. He asked Noora to choose any *f* days from *n* next for sell-outs. On each of *f* chosen days the number of products were put up for sale would be doubled. Thus, if on *i*-th day shop planned to put up for sale *k**i* products and Noora has chosen this day for sell-out, shelves of the shop would keep 2·*k**i* products. Consequently, there is an opportunity to sell two times more products on days of sell-out.
Noora's task is to choose *f* days to maximize total number of sold products. She asks you to help her with such a difficult problem.
Input Specification:
The first line contains two integers *n* and *f* (1<=≤<=*n*<=≤<=105,<=0<=≤<=*f*<=≤<=*n*) denoting the number of days in shop's plan and the number of days that Noora has to choose for sell-out.
Each line of the following *n* subsequent lines contains two integers *k**i*,<=*l**i* (0<=≤<=*k**i*,<=*l**i*<=≤<=109) denoting the number of products on the shelves of the shop on the *i*-th day and the number of clients that will come to the shop on *i*-th day.
Output Specification:
Print a single integer denoting the maximal number of products that shop can sell.
Demo Input:
['4 2\n2 1\n3 5\n2 3\n1 5\n', '4 1\n0 2\n0 3\n3 5\n0 6\n']
Demo Output:
['10', '5']
Note:
In the first example we can choose days with numbers 2 and 4 for sell-out. In this case new numbers of products for sale would be equal to [2, 6, 2, 2] respectively. So on the first day shop will sell 1 product, on the second — 5, on the third — 2, on the fourth — 2. In total 1 + 5 + 2 + 2 = 10 product units.
In the second example it is possible to sell 5 products, if you choose third day for sell-out.
|
```python
if __name__ == "main":
numOfDays, sellOffDays = list(map(int, input().split()))
totalProductsSold = 0
l = []
for i in range(numOfDays):
numOfProduct, numOfClients = map(int, input().split())
totalProductsSold += min(numOfProduct, numOfClients)
l.append(min(2*numOfProduct, numOfClients))
l.sort()
print(totalProductsSold + sum(l[numOfDays - sellOffDays:]))
```
| 0
|
|
124
|
A
|
The number of positions
|
PROGRAMMING
| 1,000
|
[
"math"
] | null | null |
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
|
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
|
Print the single number — the number of the sought positions.
|
[
"3 1 1\n",
"5 2 3\n"
] |
[
"2\n",
"3\n"
] |
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5.
| 500
|
[
{
"input": "3 1 1",
"output": "2"
},
{
"input": "5 2 3",
"output": "3"
},
{
"input": "5 4 0",
"output": "1"
},
{
"input": "6 5 5",
"output": "1"
},
{
"input": "9 4 3",
"output": "4"
},
{
"input": "11 4 6",
"output": "7"
},
{
"input": "13 8 7",
"output": "5"
},
{
"input": "14 5 5",
"output": "6"
},
{
"input": "16 6 9",
"output": "10"
},
{
"input": "20 13 17",
"output": "7"
},
{
"input": "22 4 8",
"output": "9"
},
{
"input": "23 8 14",
"output": "15"
},
{
"input": "26 18 22",
"output": "8"
},
{
"input": "28 6 1",
"output": "2"
},
{
"input": "29 5 23",
"output": "24"
},
{
"input": "32 27 15",
"output": "5"
},
{
"input": "33 11 5",
"output": "6"
},
{
"input": "37 21 15",
"output": "16"
},
{
"input": "39 34 33",
"output": "5"
},
{
"input": "41 27 11",
"output": "12"
},
{
"input": "42 25 16",
"output": "17"
},
{
"input": "45 7 43",
"output": "38"
},
{
"input": "47 16 17",
"output": "18"
},
{
"input": "49 11 37",
"output": "38"
},
{
"input": "51 38 39",
"output": "13"
},
{
"input": "52 29 7",
"output": "8"
},
{
"input": "56 43 12",
"output": "13"
},
{
"input": "58 57 28",
"output": "1"
},
{
"input": "59 12 39",
"output": "40"
},
{
"input": "62 9 52",
"output": "53"
},
{
"input": "63 29 44",
"output": "34"
},
{
"input": "65 30 22",
"output": "23"
},
{
"input": "66 27 38",
"output": "39"
},
{
"input": "71 33 53",
"output": "38"
},
{
"input": "73 14 12",
"output": "13"
},
{
"input": "73 37 35",
"output": "36"
},
{
"input": "76 69 44",
"output": "7"
},
{
"input": "79 25 20",
"output": "21"
},
{
"input": "81 60 20",
"output": "21"
},
{
"input": "81 79 14",
"output": "2"
},
{
"input": "84 0 42",
"output": "43"
},
{
"input": "88 79 8",
"output": "9"
},
{
"input": "90 76 59",
"output": "14"
},
{
"input": "92 2 22",
"output": "23"
},
{
"input": "94 5 88",
"output": "89"
},
{
"input": "94 62 48",
"output": "32"
},
{
"input": "96 22 72",
"output": "73"
},
{
"input": "100 11 88",
"output": "89"
},
{
"input": "100 81 91",
"output": "19"
},
{
"input": "1 0 0",
"output": "1"
}
] | 1,619,792,853
| 2,147,483,647
|
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3
| 154
| 0
|
n,a,b=map(int,input().split())
n=n-max(a,b)
t=min(a,b)
if n>t:
print(t+1)
else:
print(n+1)
|
Title: The number of positions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petr stands in line of *n* people, but he doesn't know exactly which position he occupies. He can say that there are no less than *a* people standing in front of him and no more than *b* people standing behind him. Find the number of different positions Petr can occupy.
Input Specification:
The only line contains three integers *n*, *a* and *b* (0<=≤<=*a*,<=*b*<=<<=*n*<=≤<=100).
Output Specification:
Print the single number — the number of the sought positions.
Demo Input:
['3 1 1\n', '5 2 3\n']
Demo Output:
['2\n', '3\n']
Note:
The possible positions in the first sample are: 2 and 3 (if we number the positions starting with 1).
In the second sample they are 3, 4 and 5.
|
```python
n,a,b=map(int,input().split())
n=n-max(a,b)
t=min(a,b)
if n>t:
print(t+1)
else:
print(n+1)
```
| 0
|
|
892
|
A
|
Greed
|
PROGRAMMING
| 900
|
[
"greedy",
"implementation"
] | null | null |
Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*).
Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not!
|
The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans.
The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans.
|
Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes).
You can print each letter in any case (upper or lower).
|
[
"2\n3 5\n3 6\n",
"3\n6 8 9\n6 10 12\n",
"5\n0 0 5 0 0\n1 1 8 10 5\n",
"4\n4 1 0 3\n5 2 2 3\n"
] |
[
"YES\n",
"NO\n",
"YES\n",
"YES\n"
] |
In the first sample, there are already 2 cans, so the answer is "YES".
| 500
|
[
{
"input": "2\n3 5\n3 6",
"output": "YES"
},
{
"input": "3\n6 8 9\n6 10 12",
"output": "NO"
},
{
"input": "5\n0 0 5 0 0\n1 1 8 10 5",
"output": "YES"
},
{
"input": "4\n4 1 0 3\n5 2 2 3",
"output": "YES"
},
{
"input": "10\n9 10 24 11 1 7 8 3 28 14\n86 20 34 11 22 94 8 16 73 85",
"output": "YES"
},
{
"input": "4\n25 35 7 31\n70 37 43 35",
"output": "YES"
},
{
"input": "10\n15 26 15 14 14 39 40 4 25 39\n27 72 16 44 69 48 53 17 63 42",
"output": "NO"
},
{
"input": "5\n22 5 19 16 32\n26 10 43 38 37",
"output": "NO"
},
{
"input": "5\n32 4 22 40 26\n39 20 36 98 44",
"output": "YES"
},
{
"input": "6\n18 25 3 10 13 37\n38 73 19 35 24 37",
"output": "YES"
},
{
"input": "2\n2 2\n2 2",
"output": "YES"
},
{
"input": "2\n2 5\n2 5",
"output": "YES"
},
{
"input": "2\n1000 1008\n10000 2352",
"output": "YES"
},
{
"input": "5\n1 2 3 4 5\n1 2 3 4 11",
"output": "YES"
},
{
"input": "4\n1 0 0 0\n2 0 0 0",
"output": "YES"
},
{
"input": "2\n0 0\n1 2",
"output": "YES"
},
{
"input": "3\n9 13 4\n10 14 5",
"output": "NO"
},
{
"input": "2\n0 0\n1 1",
"output": "YES"
},
{
"input": "5\n1 1 2 3 1\n1 1 2 3 4",
"output": "NO"
},
{
"input": "2\n0 0\n0 0",
"output": "YES"
},
{
"input": "3\n5 1 1\n5 5 5",
"output": "YES"
}
] | 1,511,117,997
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 39
| 156
| 14,131,200
|
n = int(input())
a = sum(map(int, input().split()))
b = sorted(map(int, input().split()))
if b[-1] + b[-2] >= a:
print('YES')
else:
print('NO')
|
Title: Greed
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Jafar has *n* cans of cola. Each can is described by two integers: remaining volume of cola *a**i* and can's capacity *b**i* (*a**i* <=≤<= *b**i*).
Jafar has decided to pour all remaining cola into just 2 cans, determine if he can do this or not!
Input Specification:
The first line of the input contains one integer *n* (2<=≤<=*n*<=≤<=100<=000) — number of cola cans.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109) — volume of remaining cola in cans.
The third line contains *n* space-separated integers that *b*1,<=*b*2,<=...,<=*b**n* (*a**i*<=≤<=*b**i*<=≤<=109) — capacities of the cans.
Output Specification:
Print "YES" (without quotes) if it is possible to pour all remaining cola in 2 cans. Otherwise print "NO" (without quotes).
You can print each letter in any case (upper or lower).
Demo Input:
['2\n3 5\n3 6\n', '3\n6 8 9\n6 10 12\n', '5\n0 0 5 0 0\n1 1 8 10 5\n', '4\n4 1 0 3\n5 2 2 3\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n', 'YES\n']
Note:
In the first sample, there are already 2 cans, so the answer is "YES".
|
```python
n = int(input())
a = sum(map(int, input().split()))
b = sorted(map(int, input().split()))
if b[-1] + b[-2] >= a:
print('YES')
else:
print('NO')
```
| 3
|
|
294
|
A
|
Shaass and Oskols
|
PROGRAMMING
| 800
|
[
"implementation",
"math"
] | null | null |
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
|
The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100).
The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
|
On the *i*-th line of the output print the number of birds on the *i*-th wire.
|
[
"5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n",
"3\n2 4 1\n1\n2 2\n"
] |
[
"0\n12\n5\n0\n16\n",
"3\n0\n3\n"
] |
none
| 500
|
[
{
"input": "5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6",
"output": "0\n12\n5\n0\n16"
},
{
"input": "3\n2 4 1\n1\n2 2",
"output": "3\n0\n3"
},
{
"input": "5\n58 51 45 27 48\n5\n4 9\n5 15\n4 5\n5 8\n1 43",
"output": "0\n66\n57\n7\n0"
},
{
"input": "10\n48 53 10 28 91 56 81 2 67 52\n2\n2 40\n6 51",
"output": "87\n0\n23\n28\n141\n0\n86\n2\n67\n52"
},
{
"input": "2\n72 45\n6\n1 69\n2 41\n1 19\n2 7\n1 5\n2 1",
"output": "0\n0"
},
{
"input": "10\n95 54 36 39 98 30 19 24 14 12\n3\n9 5\n8 15\n7 5",
"output": "95\n54\n36\n39\n98\n34\n0\n28\n13\n21"
},
{
"input": "100\n95 15 25 18 64 62 23 59 70 84 50 26 87 35 75 86 0 22 77 60 66 41 21 9 75 50 25 3 69 14 39 68 64 46 59 99 2 0 21 76 90 12 61 42 6 91 36 39 47 41 93 81 66 57 70 36 68 89 52 1 19 93 67 22 76 20 8 81 98 18 100 73 61 93 75 80 53 72 40 20 2 86 33 59 27 16 11 26 55 44 47 55 94 58 2 55 82 22 9 95\n0",
"output": "95\n15\n25\n18\n64\n62\n23\n59\n70\n84\n50\n26\n87\n35\n75\n86\n0\n22\n77\n60\n66\n41\n21\n9\n75\n50\n25\n3\n69\n14\n39\n68\n64\n46\n59\n99\n2\n0\n21\n76\n90\n12\n61\n42\n6\n91\n36\n39\n47\n41\n93\n81\n66\n57\n70\n36\n68\n89\n52\n1\n19\n93\n67\n22\n76\n20\n8\n81\n98\n18\n100\n73\n61\n93\n75\n80\n53\n72\n40\n20\n2\n86\n33\n59\n27\n16\n11\n26\n55\n44\n47\n55\n94\n58\n2\n55\n82\n22\n9\n95"
},
{
"input": "1\n100\n1\n1 100",
"output": "0"
},
{
"input": "1\n100\n1\n1 1",
"output": "0"
},
{
"input": "1\n50\n1\n1 25",
"output": "0"
},
{
"input": "2\n50 0\n1\n1 1",
"output": "0\n49"
},
{
"input": "1\n10\n0",
"output": "10"
}
] | 1,690,312,875
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 31
| 92
| 0
|
x = int(input())
y =list(map(int, input().split()))
z = int(input())
f = 0
for i in range(z):
a,b= map(int,input().split())
a-=1
if a-1>=0:
y[a-1]+=b-1
if a+1<x:
y[a+1]+=(y[a]-b)
y[a]=0
for i in y:
print(i)
|
Title: Shaass and Oskols
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Shaass has decided to hunt some birds. There are *n* horizontal electricity wires aligned parallel to each other. Wires are numbered 1 to *n* from top to bottom. On each wire there are some oskols sitting next to each other. Oskol is the name of a delicious kind of birds in Shaass's territory. Supposed there are *a**i* oskols sitting on the *i*-th wire.
Sometimes Shaass shots one of the birds and the bird dies (suppose that this bird sat at the *i*-th wire). Consequently all the birds on the *i*-th wire to the left of the dead bird get scared and jump up on the wire number *i*<=-<=1, if there exists no upper wire they fly away. Also all the birds to the right of the dead bird jump down on wire number *i*<=+<=1, if there exists no such wire they fly away.
Shaass has shot *m* birds. You're given the initial number of birds on each wire, tell him how many birds are sitting on each wire after the shots.
Input Specification:
The first line of the input contains an integer *n*, (1<=≤<=*n*<=≤<=100). The next line contains a list of space-separated integers *a*1,<=*a*2,<=...,<=*a**n*, (0<=≤<=*a**i*<=≤<=100).
The third line contains an integer *m*, (0<=≤<=*m*<=≤<=100). Each of the next *m* lines contains two integers *x**i* and *y**i*. The integers mean that for the *i*-th time Shaass shoot the *y**i*-th (from left) bird on the *x**i*-th wire, (1<=≤<=*x**i*<=≤<=*n*,<=1<=≤<=*y**i*). It's guaranteed there will be at least *y**i* birds on the *x**i*-th wire at that moment.
Output Specification:
On the *i*-th line of the output print the number of birds on the *i*-th wire.
Demo Input:
['5\n10 10 10 10 10\n5\n2 5\n3 13\n2 12\n1 13\n4 6\n', '3\n2 4 1\n1\n2 2\n']
Demo Output:
['0\n12\n5\n0\n16\n', '3\n0\n3\n']
Note:
none
|
```python
x = int(input())
y =list(map(int, input().split()))
z = int(input())
f = 0
for i in range(z):
a,b= map(int,input().split())
a-=1
if a-1>=0:
y[a-1]+=b-1
if a+1<x:
y[a+1]+=(y[a]-b)
y[a]=0
for i in y:
print(i)
```
| 3
|
|
23
|
A
|
You're Given a String...
|
PROGRAMMING
| 1,200
|
[
"brute force",
"greedy"
] |
A. You're Given a String...
|
2
|
256
|
You're given a string of lower-case Latin letters. Your task is to find the length of its longest substring that can be met in the string at least twice. These occurrences can overlap (see sample test 2).
|
The first input line contains the string. It's guaranteed, that the string is non-empty, consists of lower-case Latin letters, and its length doesn't exceed 100.
|
Output one number — length of the longest substring that can be met in the string at least twice.
|
[
"abcd\n",
"ababa\n",
"zzz\n"
] |
[
"0",
"3",
"2"
] |
none
| 0
|
[
{
"input": "abcd",
"output": "0"
},
{
"input": "ababa",
"output": "3"
},
{
"input": "zzz",
"output": "2"
},
{
"input": "kmmm",
"output": "2"
},
{
"input": "wzznz",
"output": "1"
},
{
"input": "qlzazaaqll",
"output": "2"
},
{
"input": "lzggglgpep",
"output": "2"
},
{
"input": "iegdlraaidefgegiagrdfhihe",
"output": "2"
},
{
"input": "esxpqmdrtidgtkxojuxyrcwxlycywtzbjzpxvbngnlepgzcaeg",
"output": "1"
},
{
"input": "garvpaimjdjiivamusjdwfcaoswuhxyyxvrxzajoyihggvuxumaadycfphrzbprraicvjjlsdhojihaw",
"output": "2"
},
{
"input": "ckvfndqgkmhcyojaqgdkenmbexufryhqejdhctxujmtrwkpbqxufxamgoeigzfyzbhevpbkvviwntdhqscvkmphnkkljizndnbjt",
"output": "3"
},
{
"input": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "99"
},
{
"input": "ikiikiikikiiikkkkkikkkkiiiiikkiiikkiikiikkkkikkkikikkikiiikkikikiiikikkkiiikkkikkikkikkkkiiikkiiiiii",
"output": "10"
},
{
"input": "ovovhoovvhohhhvhhvhhvhovoohovhhoooooovohvooooohvvoooohvvovhhvhovhhvoovhvhvoovovvhooovhhooovohvhhovhv",
"output": "8"
},
{
"input": "ccwckkkycccccckwckwkwkwkkkkyycykcccycyckwywcckwykcycykkkwcycwwcykcwkwkwwykwkwcykywwwyyykckkyycckwcwk",
"output": "5"
},
{
"input": "ttketfkefktfztezzkzfkkeetkkfktftzktezekkeezkeeetteeteefetefkzzzetekfftkeffzkktffzkzzeftfeezfefzffeef",
"output": "4"
},
{
"input": "rtharczpfznrgdnkltchafduydgbgkdjqrmjqyfmpwjwphrtsjbmswkanjlprbnduaqbcjqxlxmkspkhkcnzbqwxonzxxdmoigti",
"output": "2"
},
{
"input": "fplrkfklvwdeiynbjgaypekambmbjfnoknlhczhkdmljicookdywdgpnlnqlpunnkebnikgcgcjefeqhknvlynmvjcegvcdgvvdb",
"output": "2"
},
{
"input": "txbciieycswqpniwvzipwlottivvnfsysgzvzxwbctcchfpvlbcjikdofhpvsknptpjdbxemtmjcimetkemdbettqnbvzzbdyxxb",
"output": "2"
},
{
"input": "fmubmfwefikoxtqvmaavwjxmoqltapexkqxcsztpezfcltqavuicefxovuswmqimuikoppgqpiapqutkczgcvxzutavkujxvpklv",
"output": "3"
},
{
"input": "ipsrjylhpkjvlzncfixipstwcicxqygqcfrawpzzvckoveyqhathglblhpkjvlzncfixipfajaqobtzvthmhgbuawoxoknirclxg",
"output": "15"
},
{
"input": "kcnjsntjzcbgzjscrsrjkrbytqsrptzspzctjrorsyggrtkcnjsntjzcbgzjscrsrjyqbrtpcgqirsrrjbbbrnyqstnrozcoztt",
"output": "20"
},
{
"input": "unhcfnrhsqetuerjqcetrhlsqgfnqfntvkgxsscquolxxroqgtchffyccetrhlsqgfnqfntvkgxsscquolxxroqgtchffhfqvx",
"output": "37"
},
{
"input": "kkcckkccckkcckcccckcckkkkcckkkkckkkcckckkkkkckkkkkcckkccckkcckcccckcckkkkcckkkkckkkcckckkkkkckckckkc",
"output": "46"
},
{
"input": "mlhsyijxeydqxhtkmpdeqwzogjvxahmssyhfhqessbxzvydbrxdmlhsyijxeydqxhtkmpdeqwzogjvxahmssyhfhqessbxzvydik",
"output": "47"
},
{
"input": "abcdefghijklmnopqrstuvwxyz",
"output": "0"
},
{
"input": "tttttbttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttmttttttt",
"output": "85"
},
{
"input": "ffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffbfffffffffffffffffffffffffffffffffffff",
"output": "61"
},
{
"input": "cccccccccccccccccccccccwcccccccccccccccccccccuccccccccccccccnccccccccccccccccccccccccccccccccccccccc",
"output": "38"
},
{
"input": "ffffffffffffffffffffffffffufffgfffffffffffffffffffffffffffffffffffffffgffffffftffffffgffffffffffffff",
"output": "38"
},
{
"input": "rrrrrrrrrrrrrrrrrrrlhbrrrrrrrrurrrrrrrfrrqrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrewrrrrrrryrrxrrrrrrrrrrr",
"output": "33"
},
{
"input": "vyvvvvvvvvzvvvvvzvvvwvvvvrvvvvvvvvvvvvvvvrvvvvvvvvvpkvvpvgvvvvvvvvvvvvvgvvvvvvvvvvvvvvvvvvysvvvbvvvv",
"output": "17"
},
{
"input": "cbubbbbbbbbbbfbbbbbbbbjbobbbbbbbbbbibbubbbbjbbbnzgbbzbbfbbbbbbbbbbbfbpbbbbbbbbbbygbbbgbabbbbbbbhibbb",
"output": "12"
},
{
"input": "lrqrrrrrrrjrrrrrcdrrgrrmwvrrrrrrrrrxfzrmrmrryrrrurrrdrrrrrrrrrrererrrsrrrrrrrrrrrqrrrrcrrwjsrrlrrrrr",
"output": "10"
},
{
"input": "ssssusisisosscssssztzessssyspskjssvosiissussszsosssslsssdsssvssvsssslsssmsfjasjsssssowscsjsssszsspss",
"output": "8"
},
{
"input": "uukuuuumueuuuujuukgdhbztuuuubbguuocuozfaunqufjujuguyuuvkuuauubuubuucuvtjuuuuuusduduuuuuuuueunuuuuuzu",
"output": "7"
},
{
"input": "jpkkgwklngwqcfzmwkkpcwkkkkkekkkekkkdsykqwjkkkhkkkxdnukkkkkkmkqykkkxqklkskkrkkkkkqqjikkkkkkpknkkkkkoh",
"output": "7"
},
{
"input": "bmzbbfbbhqxwthtbbisbbbbbtbbfbbpbfbbpbkbjfbcbbbbzbbbdwmbbbrnvqdbbtbbuglrnbbbbvmbyblebbabibrevaxbbjbqb",
"output": "6"
},
{
"input": "qqqmqqqsbteqqopsuqiqumrqzpqnqgqeniqqkyqqyqqqpxzqeqqquhdqquhqqqfqjirqaqqaquxqoqqjqqqqbjbgqcqqqqicnkqc",
"output": "4"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaasaaaavaaaaaaauaaeaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "44"
},
{
"input": "a",
"output": "0"
},
{
"input": "fg",
"output": "0"
},
{
"input": "yy",
"output": "1"
},
{
"input": "abcabcabc",
"output": "6"
},
{
"input": "qwerqwedqwes",
"output": "3"
}
] | 1,596,552,714
| 2,147,483,647
|
PyPy 3
|
OK
|
TESTS
| 45
| 310
| 22,016,000
|
s=input()
ans=0
m=set()
for i in range(len(s)):
for j in range(i,-1,-1):
if(s[j:i+1] in m):
ans=max(ans,i-j+1)
else:
m.add(s[j:i+1])
print(ans)
|
Title: You're Given a String...
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You're given a string of lower-case Latin letters. Your task is to find the length of its longest substring that can be met in the string at least twice. These occurrences can overlap (see sample test 2).
Input Specification:
The first input line contains the string. It's guaranteed, that the string is non-empty, consists of lower-case Latin letters, and its length doesn't exceed 100.
Output Specification:
Output one number — length of the longest substring that can be met in the string at least twice.
Demo Input:
['abcd\n', 'ababa\n', 'zzz\n']
Demo Output:
['0', '3', '2']
Note:
none
|
```python
s=input()
ans=0
m=set()
for i in range(len(s)):
for j in range(i,-1,-1):
if(s[j:i+1] in m):
ans=max(ans,i-j+1)
else:
m.add(s[j:i+1])
print(ans)
```
| 3.881492
|
357
|
B
|
Flag Day
|
PROGRAMMING
| 1,400
|
[
"constructive algorithms",
"implementation"
] | null | null |
In Berland, there is the national holiday coming — the Flag Day. In the honor of this event the president of the country decided to make a big dance party and asked your agency to organize it. He has several conditions:
- overall, there must be *m* dances;- exactly three people must take part in each dance;- each dance must have one dancer in white clothes, one dancer in red clothes and one dancer in blue clothes (these are the colors of the national flag of Berland).
The agency has *n* dancers, and their number can be less than 3*m*. That is, some dancers will probably have to dance in more than one dance. All of your dancers must dance on the party. However, if some dance has two or more dancers from a previous dance, then the current dance stops being spectacular. Your agency cannot allow that to happen, so each dance has at most one dancer who has danced in some previous dance.
You considered all the criteria and made the plan for the *m* dances: each dance had three dancers participating in it. Your task is to determine the clothes color for each of the *n* dancers so that the President's third condition fulfilled: each dance must have a dancer in white, a dancer in red and a dancer in blue. The dancers cannot change clothes between the dances.
|
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=105) and *m* (1<=≤<=*m*<=≤<=105) — the number of dancers and the number of dances, correspondingly. Then *m* lines follow, describing the dances in the order of dancing them. The *i*-th line contains three distinct integers — the numbers of the dancers that take part in the *i*-th dance. The dancers are numbered from 1 to *n*. Each dancer takes part in at least one dance.
|
Print *n* space-separated integers: the *i*-th number must represent the color of the *i*-th dancer's clothes (1 for white, 2 for red, 3 for blue). If there are multiple valid solutions, print any of them. It is guaranteed that at least one solution exists.
|
[
"7 3\n1 2 3\n1 4 5\n4 6 7\n",
"9 3\n3 6 9\n2 5 8\n1 4 7\n",
"5 2\n4 1 5\n3 1 2\n"
] |
[
"1 2 3 3 2 2 1 \n",
"1 1 1 2 2 2 3 3 3 \n",
"2 3 1 1 3 \n"
] |
none
| 1,000
|
[
{
"input": "7 3\n1 2 3\n1 4 5\n4 6 7",
"output": "1 2 3 3 2 2 1 "
},
{
"input": "9 3\n3 6 9\n2 5 8\n1 4 7",
"output": "1 1 1 2 2 2 3 3 3 "
},
{
"input": "5 2\n4 1 5\n3 1 2",
"output": "2 3 1 1 3 "
},
{
"input": "14 5\n1 5 3\n13 10 11\n6 3 8\n14 9 2\n7 4 12",
"output": "1 3 3 2 2 2 1 1 2 2 3 3 1 1 "
},
{
"input": "14 6\n14 3 13\n10 14 5\n6 2 10\n7 13 9\n12 11 8\n1 4 9",
"output": "2 2 2 3 2 1 2 3 1 3 2 1 3 1 "
},
{
"input": "14 6\n11 13 10\n3 10 14\n2 7 12\n13 1 9\n5 11 4\n8 6 5",
"output": "1 1 2 2 3 2 2 1 3 3 1 3 2 1 "
},
{
"input": "13 5\n13 6 2\n13 3 8\n11 4 7\n10 9 5\n1 12 6",
"output": "3 3 3 2 3 2 3 2 2 1 1 1 1 "
},
{
"input": "14 6\n5 4 8\n5 7 12\n3 6 12\n7 11 14\n10 13 2\n10 1 9",
"output": "3 3 3 2 1 1 3 3 2 1 2 2 2 1 "
},
{
"input": "14 5\n4 13 2\n7 2 11\n6 1 5\n14 12 8\n10 3 9",
"output": "2 3 2 1 3 1 2 3 3 1 1 2 2 1 "
},
{
"input": "14 6\n2 14 5\n3 4 5\n6 13 14\n7 13 12\n8 10 11\n9 6 1",
"output": "1 1 1 2 3 3 3 1 2 2 3 2 1 2 "
},
{
"input": "14 6\n7 14 12\n6 1 12\n13 5 2\n2 3 9\n7 4 11\n5 8 10",
"output": "2 3 2 3 2 1 1 1 1 3 2 3 1 2 "
},
{
"input": "13 6\n8 7 6\n11 7 3\n13 9 3\n12 1 13\n8 10 4\n2 7 5",
"output": "3 1 3 2 3 3 2 1 2 3 1 2 1 "
},
{
"input": "13 5\n8 4 3\n1 9 5\n6 2 11\n12 10 4\n7 10 13",
"output": "1 2 3 2 3 1 3 1 2 1 3 3 2 "
},
{
"input": "20 8\n16 19 12\n13 3 5\n1 5 17\n10 19 7\n8 18 2\n3 11 14\n9 20 12\n4 15 6",
"output": "2 3 2 1 3 3 3 1 1 1 1 3 1 3 2 1 1 2 2 2 "
},
{
"input": "19 7\n10 18 14\n5 9 11\n9 17 7\n3 15 4\n6 8 12\n1 2 18\n13 16 19",
"output": "3 1 1 3 1 1 3 2 2 1 3 3 1 3 2 2 1 2 3 "
},
{
"input": "18 7\n17 4 13\n7 1 6\n16 9 13\n9 2 5\n11 12 17\n14 8 10\n3 15 18",
"output": "2 1 1 2 3 3 1 2 2 3 2 3 3 1 2 1 1 3 "
},
{
"input": "20 7\n8 5 11\n3 19 20\n16 1 17\n9 6 2\n7 18 13\n14 12 18\n10 4 15",
"output": "2 3 1 2 2 2 1 1 1 1 3 1 3 3 3 1 3 2 2 3 "
},
{
"input": "20 7\n6 11 20\n19 5 2\n15 10 12\n3 7 8\n9 1 6\n13 17 18\n14 16 4",
"output": "3 3 1 3 2 1 2 3 2 2 2 3 1 1 1 2 2 3 1 3 "
},
{
"input": "18 7\n15 5 1\n6 11 4\n14 8 17\n11 12 13\n3 8 16\n9 4 7\n2 18 10",
"output": "3 1 1 3 2 1 1 2 2 3 2 1 3 1 1 3 3 2 "
},
{
"input": "19 7\n3 10 8\n17 7 4\n1 19 18\n2 9 5\n12 11 15\n11 14 6\n13 9 16",
"output": "1 1 1 3 3 3 2 3 2 2 2 1 1 1 3 3 1 3 2 "
},
{
"input": "19 7\n18 14 4\n3 11 6\n8 10 7\n10 19 16\n17 13 15\n5 1 14\n12 9 2",
"output": "1 3 1 3 3 3 3 1 2 2 2 1 2 2 3 3 1 1 1 "
},
{
"input": "20 7\n18 7 15\n17 5 20\n9 19 12\n16 13 10\n3 6 1\n3 8 11\n4 2 14",
"output": "3 2 1 1 2 2 2 3 1 3 2 3 2 3 3 1 1 1 2 3 "
},
{
"input": "18 7\n8 4 6\n13 17 3\n9 8 12\n12 16 5\n18 2 7\n11 1 10\n5 15 14",
"output": "2 2 3 2 3 3 3 1 3 3 1 2 1 1 2 1 2 1 "
},
{
"input": "99 37\n40 10 7\n10 3 5\n10 31 37\n87 48 24\n33 47 38\n34 87 2\n2 35 28\n99 28 76\n66 51 97\n72 77 9\n18 17 67\n23 69 98\n58 89 99\n42 44 52\n65 41 80\n70 92 74\n62 88 45\n68 27 61\n6 83 95\n39 85 49\n57 75 77\n59 54 81\n56 20 82\n96 4 53\n90 7 11\n16 43 84\n19 25 59\n68 8 93\n73 94 78\n15 71 79\n26 12 50\n30 32 4\n14 22 29\n46 21 36\n60 55 86\n91 8 63\n13 1 64",
"output": "2 2 1 2 3 1 3 3 3 2 1 2 1 1 1 1 2 1 2 2 2 2 1 3 3 1 2 3 3 3 1 1 1 3 1 3 3 3 1 1 2 1 2 2 3 1 2 2 3 3 2 3 3 2 2 1 3 3 1 1 3 1 1 3 1 1 3 1 2 1 2 1 1 3 1 1 2 3 3 3 3 3 2 3 2 3 1 2 1 2 2 2 2 2 3 1 3 3 2 "
},
{
"input": "99 41\n11 70 20\n57 11 76\n52 11 64\n49 70 15\n19 61 17\n71 77 21\n77 59 39\n37 64 68\n17 84 36\n46 11 90\n35 11 14\n36 25 80\n12 43 48\n18 78 42\n82 94 15\n22 10 84\n63 86 4\n98 86 50\n92 60 9\n73 42 65\n21 5 27\n30 24 23\n7 88 49\n40 97 45\n81 56 17\n79 61 33\n13 3 77\n54 6 28\n99 58 8\n29 95 24\n89 74 32\n51 89 66\n87 91 96\n22 34 38\n1 53 72\n55 97 26\n41 16 44\n2 31 47\n83 67 91\n75 85 69\n93 47 62",
"output": "1 1 1 3 2 2 2 3 3 1 1 1 3 2 3 2 3 1 1 3 3 3 3 2 3 3 1 3 3 1 2 3 3 2 3 1 1 1 3 1 1 3 2 3 3 3 3 3 1 3 3 3 2 1 1 2 3 2 1 2 2 1 1 2 1 2 1 3 3 2 1 3 2 2 1 2 2 2 1 2 1 1 3 2 2 2 1 3 1 2 2 1 2 2 1 3 2 1 1 "
},
{
"input": "99 38\n70 56 92\n61 70 68\n18 92 91\n82 43 55\n37 5 43\n47 27 26\n64 63 40\n20 61 57\n69 80 59\n60 89 50\n33 25 86\n38 15 73\n96 85 90\n3 12 64\n95 23 48\n66 30 9\n38 99 45\n67 88 71\n74 11 81\n28 51 79\n72 92 34\n16 77 31\n65 18 94\n3 41 2\n36 42 81\n22 77 83\n44 24 52\n10 75 97\n54 21 53\n4 29 32\n58 39 98\n46 62 16\n76 5 84\n8 87 13\n6 41 14\n19 21 78\n7 49 93\n17 1 35",
"output": "2 3 2 1 1 3 1 1 3 1 2 3 3 2 2 1 1 2 1 2 2 1 2 2 2 3 2 1 2 2 3 3 1 1 3 1 3 1 2 3 1 2 2 1 2 2 1 3 2 3 2 3 3 1 3 2 1 1 3 1 3 3 2 1 1 1 1 2 1 1 3 2 3 1 2 3 2 3 3 2 3 1 3 2 2 3 2 2 2 3 1 3 3 3 1 1 3 3 3 "
},
{
"input": "98 38\n70 23 73\n73 29 86\n93 82 30\n6 29 10\n7 22 78\n55 61 87\n98 2 12\n11 5 54\n44 56 60\n89 76 50\n37 72 43\n47 41 61\n85 40 38\n48 93 20\n90 64 29\n31 68 25\n83 57 41\n51 90 3\n91 97 66\n96 95 1\n50 84 71\n53 19 5\n45 42 28\n16 17 89\n63 58 15\n26 47 39\n21 24 19\n80 74 38\n14 46 75\n88 65 36\n77 92 33\n17 59 34\n35 69 79\n13 94 39\n8 52 4\n67 27 9\n65 62 18\n81 32 49",
"output": "3 2 1 3 2 1 1 1 3 3 1 3 2 1 3 2 3 3 1 2 2 2 2 3 3 2 2 3 2 3 1 2 3 1 1 3 1 3 1 2 1 2 3 1 1 2 3 3 3 3 2 2 3 3 1 2 3 2 2 3 2 1 1 1 2 3 1 2 2 1 1 2 3 2 3 2 1 3 3 1 1 2 2 2 1 1 3 1 1 3 1 2 1 3 2 1 2 1 "
},
{
"input": "99 42\n61 66 47\n10 47 96\n68 86 67\n21 29 10\n55 44 47\n12 82 4\n45 71 55\n86 3 95\n16 99 93\n14 92 82\n12 59 20\n73 24 8\n79 72 48\n44 87 39\n87 84 97\n47 70 37\n49 77 95\n39 75 28\n75 25 5\n44 41 36\n76 86 78\n73 6 90\n8 22 58\n9 72 63\n81 42 14\n1 21 35\n91 54 15\n30 13 39\n56 89 79\n11 2 76\n19 65 52\n23 85 74\n7 38 24\n57 94 81\n43 34 60\n62 82 27\n69 64 53\n18 32 17\n24 31 88\n51 50 33\n40 80 98\n83 46 26",
"output": "2 3 1 3 3 3 3 3 1 2 2 1 2 3 3 1 3 1 1 2 3 2 1 2 1 3 3 1 1 1 1 2 3 2 1 3 1 1 3 1 1 2 1 2 2 2 3 3 1 2 1 3 3 2 1 2 2 1 3 3 1 1 3 2 2 2 3 1 1 2 3 2 1 3 2 1 2 3 1 2 1 2 1 3 2 2 1 3 3 2 1 1 3 3 3 1 2 3 2 "
}
] | 1,575,640,476
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 0
| 93
| 307,200
|
n,k = map(int,input().split())
l = [0]*(n+1)
for i in range(k):
a,b,c= map(int,input().split())
if(l[a]==0 and l[b]==0 and l[c]==0):
l[a]=1
l[b]=2
l[c] =3
else:
if(l[a]!=0):
x = l[a]
if(x==1):
l[b]=2
l[c] =3
elif(x==2):
l[b] = 1
l[c] =3
elif(x==3):
l[b] = 2
l[c] =1
if(l[b]!=0):
x = l[b]
if(x==1):
l[a]=2
l[c] =3
elif(x==2):
l[a] = 1
l[c] =3
elif(x==3):
l[a] = 2
l[c] =1
if(l[c]!=0):
x = l[c]
if(x==1):
l[b]=2
l[a] =3
elif(x==2):
l[b] = 1
l[a] =3
elif(x==3):
l[b] = 2
l[a] =1
for i in l[1:]:
print(i,end=" ")
|
Title: Flag Day
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In Berland, there is the national holiday coming — the Flag Day. In the honor of this event the president of the country decided to make a big dance party and asked your agency to organize it. He has several conditions:
- overall, there must be *m* dances;- exactly three people must take part in each dance;- each dance must have one dancer in white clothes, one dancer in red clothes and one dancer in blue clothes (these are the colors of the national flag of Berland).
The agency has *n* dancers, and their number can be less than 3*m*. That is, some dancers will probably have to dance in more than one dance. All of your dancers must dance on the party. However, if some dance has two or more dancers from a previous dance, then the current dance stops being spectacular. Your agency cannot allow that to happen, so each dance has at most one dancer who has danced in some previous dance.
You considered all the criteria and made the plan for the *m* dances: each dance had three dancers participating in it. Your task is to determine the clothes color for each of the *n* dancers so that the President's third condition fulfilled: each dance must have a dancer in white, a dancer in red and a dancer in blue. The dancers cannot change clothes between the dances.
Input Specification:
The first line contains two space-separated integers *n* (3<=≤<=*n*<=≤<=105) and *m* (1<=≤<=*m*<=≤<=105) — the number of dancers and the number of dances, correspondingly. Then *m* lines follow, describing the dances in the order of dancing them. The *i*-th line contains three distinct integers — the numbers of the dancers that take part in the *i*-th dance. The dancers are numbered from 1 to *n*. Each dancer takes part in at least one dance.
Output Specification:
Print *n* space-separated integers: the *i*-th number must represent the color of the *i*-th dancer's clothes (1 for white, 2 for red, 3 for blue). If there are multiple valid solutions, print any of them. It is guaranteed that at least one solution exists.
Demo Input:
['7 3\n1 2 3\n1 4 5\n4 6 7\n', '9 3\n3 6 9\n2 5 8\n1 4 7\n', '5 2\n4 1 5\n3 1 2\n']
Demo Output:
['1 2 3 3 2 2 1 \n', '1 1 1 2 2 2 3 3 3 \n', '2 3 1 1 3 \n']
Note:
none
|
```python
n,k = map(int,input().split())
l = [0]*(n+1)
for i in range(k):
a,b,c= map(int,input().split())
if(l[a]==0 and l[b]==0 and l[c]==0):
l[a]=1
l[b]=2
l[c] =3
else:
if(l[a]!=0):
x = l[a]
if(x==1):
l[b]=2
l[c] =3
elif(x==2):
l[b] = 1
l[c] =3
elif(x==3):
l[b] = 2
l[c] =1
if(l[b]!=0):
x = l[b]
if(x==1):
l[a]=2
l[c] =3
elif(x==2):
l[a] = 1
l[c] =3
elif(x==3):
l[a] = 2
l[c] =1
if(l[c]!=0):
x = l[c]
if(x==1):
l[b]=2
l[a] =3
elif(x==2):
l[b] = 1
l[a] =3
elif(x==3):
l[b] = 2
l[a] =1
for i in l[1:]:
print(i,end=" ")
```
| 0
|
|
38
|
A
|
Army
|
PROGRAMMING
| 800
|
[
"implementation"
] |
A. Army
|
2
|
256
|
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
|
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
|
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
|
[
"3\n5 6\n1 2\n",
"3\n5 6\n1 3\n"
] |
[
"5\n",
"11\n"
] |
none
| 0
|
[
{
"input": "3\n5 6\n1 2",
"output": "5"
},
{
"input": "3\n5 6\n1 3",
"output": "11"
},
{
"input": "2\n55\n1 2",
"output": "55"
},
{
"input": "3\n85 78\n1 3",
"output": "163"
},
{
"input": "4\n63 4 49\n2 3",
"output": "4"
},
{
"input": "5\n93 83 42 56\n2 5",
"output": "181"
},
{
"input": "6\n22 9 87 89 57\n1 6",
"output": "264"
},
{
"input": "7\n52 36 31 23 74 78\n2 7",
"output": "242"
},
{
"input": "8\n82 14 24 5 91 49 94\n3 8",
"output": "263"
},
{
"input": "9\n12 40 69 39 59 21 59 5\n4 6",
"output": "98"
},
{
"input": "10\n95 81 32 59 71 30 50 61 100\n1 6",
"output": "338"
},
{
"input": "15\n89 55 94 4 15 69 19 60 91 77 3 94 91 62\n3 14",
"output": "617"
},
{
"input": "20\n91 1 41 51 95 67 92 35 23 70 44 91 57 50 21 8 9 71 40\n8 17",
"output": "399"
},
{
"input": "25\n70 95 21 84 97 39 12 98 53 24 78 29 84 65 70 22 100 17 69 27 62 48 35 80\n8 23",
"output": "846"
},
{
"input": "30\n35 69 50 44 19 56 86 56 98 24 21 2 61 24 85 30 2 22 57 35 59 84 12 77 92 53 50 92 9\n1 16",
"output": "730"
},
{
"input": "35\n2 34 47 15 27 61 6 88 67 20 53 65 29 68 77 5 78 86 44 98 32 81 91 79 54 84 95 23 65 97 22 33 42 87\n8 35",
"output": "1663"
},
{
"input": "40\n32 88 59 36 95 45 28 78 73 30 97 13 13 47 48 100 43 21 22 45 88 25 15 13 63 25 72 92 29 5 25 11 50 5 54 51 48 84 23\n7 26",
"output": "862"
},
{
"input": "45\n83 74 73 95 10 31 100 26 29 15 80 100 22 70 31 88 9 56 19 70 2 62 48 30 27 47 52 50 94 44 21 94 23 85 15 3 95 72 43 62 94 89 68 88\n17 40",
"output": "1061"
},
{
"input": "50\n28 8 16 29 19 82 70 51 96 84 74 72 17 69 12 21 37 21 39 3 18 66 19 49 86 96 94 93 2 90 96 84 59 88 58 15 61 33 55 22 35 54 51 29 64 68 29 38 40\n23 28",
"output": "344"
},
{
"input": "60\n24 28 25 21 43 71 64 73 71 90 51 83 69 43 75 43 78 72 56 61 99 7 23 86 9 16 16 94 23 74 18 56 20 72 13 31 75 34 35 86 61 49 4 72 84 7 65 70 66 52 21 38 6 43 69 40 73 46 5\n28 60",
"output": "1502"
},
{
"input": "70\n69 95 34 14 67 61 6 95 94 44 28 94 73 66 39 13 19 71 73 71 28 48 26 22 32 88 38 95 43 59 88 77 80 55 17 95 40 83 67 1 38 95 58 63 56 98 49 2 41 4 73 8 78 41 64 71 60 71 41 61 67 4 4 19 97 14 39 20 27\n9 41",
"output": "1767"
},
{
"input": "80\n65 15 43 6 43 98 100 16 69 98 4 54 25 40 2 35 12 23 38 29 10 89 30 6 4 8 7 96 64 43 11 49 89 38 20 59 54 85 46 16 16 89 60 54 28 37 32 34 67 9 78 30 50 87 58 53 99 48 77 3 5 6 19 99 16 20 31 10 80 76 82 56 56 83 72 81 84 60 28\n18 24",
"output": "219"
},
{
"input": "90\n61 35 100 99 67 87 42 90 44 4 81 65 29 63 66 56 53 22 55 87 39 30 34 42 27 80 29 97 85 28 81 22 50 22 24 75 67 86 78 79 94 35 13 97 48 76 68 66 94 13 82 1 22 85 5 36 86 73 65 97 43 56 35 26 87 25 74 47 81 67 73 75 99 75 53 38 70 21 66 78 38 17 57 40 93 57 68 55 1\n12 44",
"output": "1713"
},
{
"input": "95\n37 74 53 96 65 84 65 72 95 45 6 77 91 35 58 50 51 51 97 30 51 20 79 81 92 10 89 34 40 76 71 54 26 34 73 72 72 28 53 19 95 64 97 10 44 15 12 38 5 63 96 95 86 8 36 96 45 53 81 5 18 18 47 97 65 9 33 53 41 86 37 53 5 40 15 76 83 45 33 18 26 5 19 90 46 40 100 42 10 90 13 81 40 53\n6 15",
"output": "570"
},
{
"input": "96\n51 32 95 75 23 54 70 89 67 3 1 51 4 100 97 30 9 35 56 38 54 77 56 98 43 17 60 43 72 46 87 61 100 65 81 22 74 38 16 96 5 10 54 22 23 22 10 91 9 54 49 82 29 73 33 98 75 8 4 26 24 90 71 42 90 24 94 74 94 10 41 98 56 63 18 43 56 21 26 64 74 33 22 38 67 66 38 60 64 76 53 10 4 65 76\n21 26",
"output": "328"
},
{
"input": "97\n18 90 84 7 33 24 75 55 86 10 96 72 16 64 37 9 19 71 62 97 5 34 85 15 46 72 82 51 52 16 55 68 27 97 42 72 76 97 32 73 14 56 11 86 2 81 59 95 60 93 1 22 71 37 77 100 6 16 78 47 78 62 94 86 16 91 56 46 47 35 93 44 7 86 70 10 29 45 67 62 71 61 74 39 36 92 24 26 65 14 93 92 15 28 79 59\n6 68",
"output": "3385"
},
{
"input": "98\n32 47 26 86 43 42 79 72 6 68 40 46 29 80 24 89 29 7 21 56 8 92 13 33 50 79 5 7 84 85 24 23 1 80 51 21 26 55 96 51 24 2 68 98 81 88 57 100 64 84 54 10 14 2 74 1 89 71 1 20 84 85 17 31 42 58 69 67 48 60 97 90 58 10 21 29 2 21 60 61 68 89 77 39 57 18 61 44 67 100 33 74 27 40 83 29 6\n8 77",
"output": "3319"
},
{
"input": "99\n46 5 16 66 53 12 84 89 26 27 35 68 41 44 63 17 88 43 80 15 59 1 42 50 53 34 75 16 16 55 92 30 28 11 12 71 27 65 11 28 86 47 24 10 60 47 7 53 16 75 6 49 56 66 70 3 20 78 75 41 38 57 89 23 16 74 30 39 1 32 49 84 9 33 25 95 75 45 54 59 17 17 29 40 79 96 47 11 69 86 73 56 91 4 87 47 31 24\n23 36",
"output": "514"
},
{
"input": "100\n63 65 21 41 95 23 3 4 12 23 95 50 75 63 58 34 71 27 75 31 23 94 96 74 69 34 43 25 25 55 44 19 43 86 68 17 52 65 36 29 72 96 84 25 84 23 71 54 6 7 71 7 21 100 99 58 93 35 62 47 36 70 68 9 75 13 35 70 76 36 62 22 52 51 2 87 66 41 54 35 78 62 30 35 65 44 74 93 78 37 96 70 26 32 71 27 85 85 63\n43 92",
"output": "2599"
},
{
"input": "51\n85 38 22 38 42 36 55 24 36 80 49 15 66 91 88 61 46 82 1 61 89 92 6 56 28 8 46 80 56 90 91 38 38 17 69 64 57 68 13 44 45 38 8 72 61 39 87 2 73 88\n15 27",
"output": "618"
},
{
"input": "2\n3\n1 2",
"output": "3"
},
{
"input": "5\n6 8 22 22\n2 3",
"output": "8"
},
{
"input": "6\n3 12 27 28 28\n3 4",
"output": "27"
},
{
"input": "9\n1 2 2 2 2 3 3 5\n3 7",
"output": "9"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1\n6 8",
"output": "2"
},
{
"input": "20\n1 1 1 1 1 1 1 1 2 2 2 2 2 3 3 3 3 3 3\n5 17",
"output": "23"
},
{
"input": "25\n1 1 1 4 5 6 8 11 11 11 11 12 13 14 14 14 15 16 16 17 17 17 19 19\n4 8",
"output": "23"
},
{
"input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2\n30 31",
"output": "2"
},
{
"input": "45\n1 1 1 1 2 2 2 2 2 2 2 3 3 3 3 3 3 4 5 5 5 5 6 6 6 6 6 6 6 7 7 7 7 8 8 8 9 9 9 9 9 10 10 10\n42 45",
"output": "30"
},
{
"input": "50\n1 8 8 13 14 15 15 16 19 21 22 24 26 31 32 37 45 47 47 47 50 50 51 54 55 56 58 61 61 61 63 63 64 66 66 67 67 70 71 80 83 84 85 92 92 94 95 95 100\n4 17",
"output": "285"
},
{
"input": "60\n1 2 4 4 4 6 6 8 9 10 10 13 14 18 20 20 21 22 23 23 26 29 30 32 33 34 35 38 40 42 44 44 46 48 52 54 56 56 60 60 66 67 68 68 69 73 73 74 80 80 81 81 82 84 86 86 87 89 89\n56 58",
"output": "173"
},
{
"input": "70\n1 2 3 3 4 5 5 7 7 7 8 8 8 8 9 9 10 12 12 12 12 13 16 16 16 16 16 16 17 17 18 18 20 20 21 23 24 25 25 26 29 29 29 29 31 32 32 34 35 36 36 37 37 38 39 39 40 40 40 40 41 41 42 43 44 44 44 45 45\n62 65",
"output": "126"
},
{
"input": "80\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 4 4 4 5 5 5 5 5 5 5 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 9 9 9 9 9 10 10 10 10 10 10 10 10 10 11 11 11 11 11 11 11 12 12 12 12 12 12 12 12\n17 65",
"output": "326"
},
{
"input": "90\n1 1 3 5 8 9 10 11 11 11 11 12 13 14 15 15 15 16 16 19 19 20 22 23 24 25 25 28 29 29 30 31 33 34 35 37 37 38 41 43 43 44 45 47 51 54 55 56 58 58 59 59 60 62 66 67 67 67 68 68 69 70 71 72 73 73 76 77 77 78 78 78 79 79 79 82 83 84 85 85 87 87 89 93 93 93 95 99 99\n28 48",
"output": "784"
},
{
"input": "95\n2 2 3 3 4 6 6 7 7 7 9 10 12 12 12 12 13 14 15 16 17 18 20 20 20 20 21 21 21 21 22 22 22 22 22 23 23 23 25 26 26 27 27 27 28 29 29 30 30 31 32 33 34 36 37 37 38 39 39 39 42 43 43 43 45 47 48 50 50 51 52 53 54 54 54 55 55 55 58 59 60 61 61 61 61 62 62 63 64 65 66 67 67 67\n64 93",
"output": "1636"
},
{
"input": "96\n1 1 2 3 3 5 8 9 9 10 10 10 11 11 11 11 11 12 13 13 13 14 15 15 16 16 17 17 17 17 18 18 20 20 20 21 21 21 23 24 24 25 25 26 27 27 27 27 29 29 29 30 30 30 32 32 32 32 32 32 33 33 34 34 34 35 35 35 36 36 37 37 37 38 39 40 41 41 41 41 42 42 43 43 45 45 45 46 46 47 47 49 50 52 52\n76 96",
"output": "898"
},
{
"input": "98\n2 3 4 4 5 7 8 10 10 10 11 11 12 12 12 12 13 14 15 15 16 16 18 19 19 20 21 21 21 21 22 23 24 25 26 26 27 27 27 27 29 29 30 30 31 31 37 40 40 40 41 41 41 42 43 44 44 44 46 46 47 49 49 50 50 50 51 53 55 55 56 56 56 56 56 57 57 58 59 60 60 60 62 62 63 64 64 64 65 66 66 67 68 70 70 71 71\n8 90",
"output": "3016"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n66 95",
"output": "29"
},
{
"input": "100\n1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 3 3 3 4 4 4 4 4 4 4 4 4 4 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7 7 7 7 8 8 8 8 9 9 9 9 10 10 10 10 11 11 11 11 12 12 12 13 13 13 13 13 13 13 13 13 13 14 14 14 14 14 14 15 15 15 15 15 15 16 16 16 17 17\n39 52",
"output": "82"
},
{
"input": "51\n5 7 9 16 19 25 26 29 29 30 31 32 32 41 43 44 47 49 50 50 51 52 54 55 56 63 64 66 67 70 74 74 77 78 79 80 80 85 86 87 89 89 90 92 93 94 94 95 95 97\n3 44",
"output": "2268"
}
] | 1,587,168,264
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 50
| 218
| 0
|
n = input()
yearList = list(map(int, input().split()))
a, b = map(int, input().split())
print(sum(yearList[a - 1:b - 1]))
|
Title: Army
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Berland Armed Forces System consists of *n* ranks that are numbered using natural numbers from 1 to *n*, where 1 is the lowest rank and *n* is the highest rank.
One needs exactly *d**i* years to rise from rank *i* to rank *i*<=+<=1. Reaching a certain rank *i* having not reached all the previous *i*<=-<=1 ranks is impossible.
Vasya has just reached a new rank of *a*, but he dreams of holding the rank of *b*. Find for how many more years Vasya should serve in the army until he can finally realize his dream.
Input Specification:
The first input line contains an integer *n* (2<=≤<=*n*<=≤<=100). The second line contains *n*<=-<=1 integers *d**i* (1<=≤<=*d**i*<=≤<=100). The third input line contains two integers *a* and *b* (1<=≤<=*a*<=<<=*b*<=≤<=*n*). The numbers on the lines are space-separated.
Output Specification:
Print the single number which is the number of years that Vasya needs to rise from rank *a* to rank *b*.
Demo Input:
['3\n5 6\n1 2\n', '3\n5 6\n1 3\n']
Demo Output:
['5\n', '11\n']
Note:
none
|
```python
n = input()
yearList = list(map(int, input().split()))
a, b = map(int, input().split())
print(sum(yearList[a - 1:b - 1]))
```
| 3.9455
|
279
|
B
|
Books
|
PROGRAMMING
| 1,400
|
[
"binary search",
"brute force",
"implementation",
"two pointers"
] | null | null |
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
|
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
|
Print a single integer — the maximum number of books Valera can read.
|
[
"4 5\n3 1 2 1\n",
"3 3\n2 2 3\n"
] |
[
"3\n",
"1\n"
] |
none
| 1,000
|
[
{
"input": "4 5\n3 1 2 1",
"output": "3"
},
{
"input": "3 3\n2 2 3",
"output": "1"
},
{
"input": "1 3\n5",
"output": "0"
},
{
"input": "1 10\n4",
"output": "1"
},
{
"input": "2 10\n6 4",
"output": "2"
},
{
"input": "6 10\n2 3 4 2 1 1",
"output": "4"
},
{
"input": "7 13\n6 8 14 9 4 11 10",
"output": "2"
},
{
"input": "10 15\n10 9 1 1 5 10 5 3 7 2",
"output": "3"
},
{
"input": "20 30\n8 1 2 6 9 4 1 9 9 10 4 7 8 9 5 7 1 8 7 4",
"output": "6"
},
{
"input": "30 60\n16 13 22 38 13 35 17 17 20 38 12 19 9 22 20 3 35 34 34 21 35 40 22 3 27 19 12 4 8 19",
"output": "4"
},
{
"input": "100 100\n75 92 18 6 81 67 7 92 100 65 82 32 50 67 85 31 80 91 84 63 39 52 92 81 1 98 24 12 43 48 17 86 51 72 48 95 45 50 12 66 19 79 49 89 34 1 97 75 20 33 96 27 42 23 73 71 93 1 85 19 66 14 17 61 20 39 36 33 42 61 56 64 23 91 80 99 40 74 13 18 98 85 74 39 62 84 46 74 50 23 38 11 79 14 9 25 66 100 25 52",
"output": "3"
},
{
"input": "10 1\n4418 7528 8170 1736 1317 3205 8183 4995 8039 4708",
"output": "0"
},
{
"input": "50 2\n124 214 63 73 996 760 38 571 451 300 970 1 706 937 837 494 619 88 851 411 957 990 842 613 821 649 627 34 693 678 734 116 816 985 705 940 499 493 922 967 854 439 112 644 961 438 189 572 655 550",
"output": "1"
}
] | 1,698,627,235
| 2,147,483,647
|
PyPy 3-64
|
OK
|
TESTS
| 38
| 154
| 11,059,200
|
def solve():
n, k = map(int, input().split())
l = [int(i) for i in input().split()]
cur = 0
r = 0
ans = 0
for i in range(n):
while r < n and cur + l[r] <= k:
cur += l[r]
r += 1
ans = max(ans, r-i)
cur -= l[i]
print(ans)
# t = int(input())
t = 1
while t:
solve()
t -= 1
|
Title: Books
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Valera has got some free time, he goes to the library to read some books. Today he's got *t* free minutes to read. That's why Valera took *n* books in the library and for each book he estimated the time he is going to need to read it. Let's number the books by integers from 1 to *n*. Valera needs *a**i* minutes to read the *i*-th book.
Valera decided to choose an arbitrary book with number *i* and read the books one by one, starting from this book. In other words, he will first read book number *i*, then book number *i*<=+<=1, then book number *i*<=+<=2 and so on. He continues the process until he either runs out of the free time or finishes reading the *n*-th book. Valera reads each book up to the end, that is, he doesn't start reading the book if he doesn't have enough free time to finish reading it.
Print the maximum number of books Valera can read.
Input Specification:
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=105; 1<=≤<=*t*<=≤<=109) — the number of books and the number of free minutes Valera's got. The second line contains a sequence of *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104), where number *a**i* shows the number of minutes that the boy needs to read the *i*-th book.
Output Specification:
Print a single integer — the maximum number of books Valera can read.
Demo Input:
['4 5\n3 1 2 1\n', '3 3\n2 2 3\n']
Demo Output:
['3\n', '1\n']
Note:
none
|
```python
def solve():
n, k = map(int, input().split())
l = [int(i) for i in input().split()]
cur = 0
r = 0
ans = 0
for i in range(n):
while r < n and cur + l[r] <= k:
cur += l[r]
r += 1
ans = max(ans, r-i)
cur -= l[i]
print(ans)
# t = int(input())
t = 1
while t:
solve()
t -= 1
```
| 3
|
|
18
|
C
|
Stripe
|
PROGRAMMING
| 1,200
|
[
"data structures",
"implementation"
] |
C. Stripe
|
2
|
64
|
Once Bob took a paper stripe of *n* squares (the height of the stripe is 1 square). In each square he wrote an integer number, possibly negative. He became interested in how many ways exist to cut this stripe into two pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece, and each piece contains positive integer amount of squares. Would you help Bob solve this problem?
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of squares in the stripe. The second line contains *n* space-separated numbers — they are the numbers written in the squares of the stripe. These numbers are integer and do not exceed 10000 in absolute value.
|
Output the amount of ways to cut the stripe into two non-empty pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece. Don't forget that it's allowed to cut the stripe along the squares' borders only.
|
[
"9\n1 5 -6 7 9 -16 0 -2 2\n",
"3\n1 1 1\n",
"2\n0 0\n"
] |
[
"3\n",
"0\n",
"1\n"
] |
none
| 0
|
[
{
"input": "9\n1 5 -6 7 9 -16 0 -2 2",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "0"
},
{
"input": "2\n0 0",
"output": "1"
},
{
"input": "4\n100 1 10 111",
"output": "1"
},
{
"input": "10\n0 4 -3 0 -2 2 -3 -3 2 5",
"output": "3"
},
{
"input": "10\n0 -1 2 2 -1 1 0 0 0 2",
"output": "0"
},
{
"input": "10\n-1 -1 1 -1 0 1 0 1 1 1",
"output": "1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "9"
},
{
"input": "50\n-4 -3 3 4 -1 0 2 -4 -3 -4 1 4 3 0 4 1 0 -3 4 -3 -2 2 2 1 0 -4 -4 -5 3 2 -1 4 5 -3 -3 4 4 -5 2 -3 4 -5 2 5 -4 4 1 -2 -4 3",
"output": "3"
},
{
"input": "15\n0 4 0 3 -1 4 -2 -2 -4 -4 3 2 4 -1 -3",
"output": "0"
},
{
"input": "10\n3 -1 -3 -1 3 -2 0 3 1 -2",
"output": "0"
},
{
"input": "100\n-4 2 4 4 1 3 -3 -3 2 1 -4 0 0 2 3 -1 -4 -3 4 -2 -3 -3 -3 -1 -2 -3 -1 -4 0 4 0 -1 4 0 -4 -4 4 -4 -2 1 -4 1 -3 -2 3 -4 4 0 -1 3 -1 4 -1 4 -1 3 -3 -3 -2 -2 4 -3 -3 4 -3 -2 -1 0 -2 4 0 -3 -1 -2 -3 1 -4 1 -3 -3 -3 -2 -3 0 1 -2 -2 -4 -3 -1 2 3 -1 1 1 0 3 -3 -1 -2",
"output": "1"
},
{
"input": "100\n-2 -1 1 0 -2 -1 2 2 0 0 2 1 0 2 0 2 1 0 -1 -1 -1 0 -2 -1 2 -1 -2 2 -2 2 -2 -2 2 1 1 1 -2 2 0 0 2 -1 2 2 2 0 -1 -1 -1 1 -2 2 2 2 -2 0 0 -2 0 -2 -2 0 -1 -1 -2 -1 1 2 -2 -1 1 -2 -1 0 -2 2 2 -1 -2 2 0 0 0 1 0 1 2 1 -2 -2 -1 -1 -2 -2 -2 -1 2 2 2 -2",
"output": "6"
},
{
"input": "100\n2 7 6 0 8 -2 0 1 8 -1 7 -4 -1 1 0 3 4 -4 3 7 8 -4 -6 6 4 -2 -5 7 4 6 1 6 3 8 -2 6 -6 -3 0 -1 -7 -8 -2 5 8 6 -2 -2 -5 -4 -7 -3 -5 -3 -3 -1 5 8 4 0 -7 -6 8 -4 -1 7 2 6 6 4 -5 -4 -5 -2 2 -2 -7 -1 5 -8 -6 -2 -5 4 2 8 -6 7 -8 -1 -5 8 6 -3 -1 7 -1 2 -8 -8",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n10000",
"output": "0"
},
{
"input": "1\n-10000",
"output": "0"
}
] | 1,667,962,633
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 45
| 186
| 7,372,800
|
def solve():
n = int(input())
l = list(map(int, input().split()))
s1=0
s2=sum(l)
ans=0
for i in range(n-1):
s1 += l[i]
s2 -= l[i]
if s1 == s2:
ans += 1
print(ans)
solve()
|
Title: Stripe
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Once Bob took a paper stripe of *n* squares (the height of the stripe is 1 square). In each square he wrote an integer number, possibly negative. He became interested in how many ways exist to cut this stripe into two pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece, and each piece contains positive integer amount of squares. Would you help Bob solve this problem?
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of squares in the stripe. The second line contains *n* space-separated numbers — they are the numbers written in the squares of the stripe. These numbers are integer and do not exceed 10000 in absolute value.
Output Specification:
Output the amount of ways to cut the stripe into two non-empty pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece. Don't forget that it's allowed to cut the stripe along the squares' borders only.
Demo Input:
['9\n1 5 -6 7 9 -16 0 -2 2\n', '3\n1 1 1\n', '2\n0 0\n']
Demo Output:
['3\n', '0\n', '1\n']
Note:
none
|
```python
def solve():
n = int(input())
l = list(map(int, input().split()))
s1=0
s2=sum(l)
ans=0
for i in range(n-1):
s1 += l[i]
s2 -= l[i]
if s1 == s2:
ans += 1
print(ans)
solve()
```
| 3.898568
|
118
|
A
|
String Task
|
PROGRAMMING
| 1,000
|
[
"implementation",
"strings"
] | null | null |
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
|
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
|
Print the resulting string. It is guaranteed that this string is not empty.
|
[
"tour\n",
"Codeforces\n",
"aBAcAba\n"
] |
[
".t.r\n",
".c.d.f.r.c.s\n",
".b.c.b\n"
] |
none
| 500
|
[
{
"input": "tour",
"output": ".t.r"
},
{
"input": "Codeforces",
"output": ".c.d.f.r.c.s"
},
{
"input": "aBAcAba",
"output": ".b.c.b"
},
{
"input": "obn",
"output": ".b.n"
},
{
"input": "wpwl",
"output": ".w.p.w.l"
},
{
"input": "ggdvq",
"output": ".g.g.d.v.q"
},
{
"input": "pumesz",
"output": ".p.m.s.z"
},
{
"input": "g",
"output": ".g"
},
{
"input": "zjuotps",
"output": ".z.j.t.p.s"
},
{
"input": "jzbwuehe",
"output": ".j.z.b.w.h"
},
{
"input": "tnkgwuugu",
"output": ".t.n.k.g.w.g"
},
{
"input": "kincenvizh",
"output": ".k.n.c.n.v.z.h"
},
{
"input": "xattxjenual",
"output": ".x.t.t.x.j.n.l"
},
{
"input": "ktajqhpqsvhw",
"output": ".k.t.j.q.h.p.q.s.v.h.w"
},
{
"input": "xnhcigytnqcmy",
"output": ".x.n.h.c.g.t.n.q.c.m"
},
{
"input": "jfmtbejyilxcec",
"output": ".j.f.m.t.b.j.l.x.c.c"
},
{
"input": "D",
"output": ".d"
},
{
"input": "ab",
"output": ".b"
},
{
"input": "Ab",
"output": ".b"
},
{
"input": "aB",
"output": ".b"
},
{
"input": "AB",
"output": ".b"
},
{
"input": "ba",
"output": ".b"
},
{
"input": "bA",
"output": ".b"
},
{
"input": "Ba",
"output": ".b"
},
{
"input": "BA",
"output": ".b"
},
{
"input": "aab",
"output": ".b"
},
{
"input": "baa",
"output": ".b"
},
{
"input": "femOZeCArKCpUiHYnbBPTIOFmsHmcpObtPYcLCdjFrUMIyqYzAokKUiiKZRouZiNMoiOuGVoQzaaCAOkquRjmmKKElLNqCnhGdQM",
"output": ".f.m.z.c.r.k.c.p.h.n.b.b.p.t.f.m.s.h.m.c.p.b.t.p.c.l.c.d.j.f.r.m.q.z.k.k.k.z.r.z.n.m.g.v.q.z.c.k.q.r.j.m.m.k.k.l.l.n.q.c.n.h.g.d.q.m"
},
{
"input": "VMBPMCmMDCLFELLIISUJDWQRXYRDGKMXJXJHXVZADRZWVWJRKFRRNSAWKKDPZZLFLNSGUNIVJFBEQsMDHSBJVDTOCSCgZWWKvZZN",
"output": ".v.m.b.p.m.c.m.m.d.c.l.f.l.l.s.j.d.w.q.r.x.r.d.g.k.m.x.j.x.j.h.x.v.z.d.r.z.w.v.w.j.r.k.f.r.r.n.s.w.k.k.d.p.z.z.l.f.l.n.s.g.n.v.j.f.b.q.s.m.d.h.s.b.j.v.d.t.c.s.c.g.z.w.w.k.v.z.z.n"
},
{
"input": "MCGFQQJNUKuAEXrLXibVjClSHjSxmlkQGTKZrRaDNDomIPOmtSgjJAjNVIVLeUGUAOHNkCBwNObVCHOWvNkLFQQbFnugYVMkJruJ",
"output": ".m.c.g.f.q.q.j.n.k.x.r.l.x.b.v.j.c.l.s.h.j.s.x.m.l.k.q.g.t.k.z.r.r.d.n.d.m.p.m.t.s.g.j.j.j.n.v.v.l.g.h.n.k.c.b.w.n.b.v.c.h.w.v.n.k.l.f.q.q.b.f.n.g.v.m.k.j.r.j"
},
{
"input": "iyaiuiwioOyzUaOtAeuEYcevvUyveuyioeeueoeiaoeiavizeeoeyYYaaAOuouueaUioueauayoiuuyiuovyOyiyoyioaoyuoyea",
"output": ".w.z.t.c.v.v.v.v.z.v"
},
{
"input": "yjnckpfyLtzwjsgpcrgCfpljnjwqzgVcufnOvhxplvflxJzqxnhrwgfJmPzifgubvspffmqrwbzivatlmdiBaddiaktdsfPwsevl",
"output": ".j.n.c.k.p.f.l.t.z.w.j.s.g.p.c.r.g.c.f.p.l.j.n.j.w.q.z.g.v.c.f.n.v.h.x.p.l.v.f.l.x.j.z.q.x.n.h.r.w.g.f.j.m.p.z.f.g.b.v.s.p.f.f.m.q.r.w.b.z.v.t.l.m.d.b.d.d.k.t.d.s.f.p.w.s.v.l"
},
{
"input": "RIIIUaAIYJOiuYIUWFPOOAIuaUEZeIooyUEUEAoIyIHYOEAlVAAIiLUAUAeiUIEiUMuuOiAgEUOIAoOUYYEYFEoOIIVeOOAOIIEg",
"output": ".r.j.w.f.p.z.h.l.v.l.m.g.f.v.g"
},
{
"input": "VBKQCFBMQHDMGNSGBQVJTGQCNHHRJMNKGKDPPSQRRVQTZNKBZGSXBPBRXPMVFTXCHZMSJVBRNFNTHBHGJLMDZJSVPZZBCCZNVLMQ",
"output": ".v.b.k.q.c.f.b.m.q.h.d.m.g.n.s.g.b.q.v.j.t.g.q.c.n.h.h.r.j.m.n.k.g.k.d.p.p.s.q.r.r.v.q.t.z.n.k.b.z.g.s.x.b.p.b.r.x.p.m.v.f.t.x.c.h.z.m.s.j.v.b.r.n.f.n.t.h.b.h.g.j.l.m.d.z.j.s.v.p.z.z.b.c.c.z.n.v.l.m.q"
},
{
"input": "iioyoaayeuyoolyiyoeuouiayiiuyTueyiaoiueyioiouyuauouayyiaeoeiiigmioiououeieeeyuyyaYyioiiooaiuouyoeoeg",
"output": ".l.t.g.m.g"
},
{
"input": "ueyiuiauuyyeueykeioouiiauzoyoeyeuyiaoaiiaaoaueyaeydaoauexuueafouiyioueeaaeyoeuaueiyiuiaeeayaioeouiuy",
"output": ".k.z.d.x.f"
},
{
"input": "FSNRBXLFQHZXGVMKLQDVHWLDSLKGKFMDRQWMWSSKPKKQBNDZRSCBLRSKCKKFFKRDMZFZGCNSMXNPMZVDLKXGNXGZQCLRTTDXLMXQ",
"output": ".f.s.n.r.b.x.l.f.q.h.z.x.g.v.m.k.l.q.d.v.h.w.l.d.s.l.k.g.k.f.m.d.r.q.w.m.w.s.s.k.p.k.k.q.b.n.d.z.r.s.c.b.l.r.s.k.c.k.k.f.f.k.r.d.m.z.f.z.g.c.n.s.m.x.n.p.m.z.v.d.l.k.x.g.n.x.g.z.q.c.l.r.t.t.d.x.l.m.x.q"
},
{
"input": "EYAYAYIOIOYOOAUOEUEUOUUYIYUUMOEOIIIAOIUOAAOIYOIOEUIERCEYYAOIOIGYUIAOYUEOEUAEAYPOYEYUUAUOAOEIYIEYUEEY",
"output": ".m.r.c.g.p"
},
{
"input": "jvvzcdcxjstbbksmqjsngxkgtttdxrljjxtwptgwwqzpvqchvgrkqlzxmptzblxhhsmrkmzzmgdfskhtmmnqzzflpmqdctvrfgtx",
"output": ".j.v.v.z.c.d.c.x.j.s.t.b.b.k.s.m.q.j.s.n.g.x.k.g.t.t.t.d.x.r.l.j.j.x.t.w.p.t.g.w.w.q.z.p.v.q.c.h.v.g.r.k.q.l.z.x.m.p.t.z.b.l.x.h.h.s.m.r.k.m.z.z.m.g.d.f.s.k.h.t.m.m.n.q.z.z.f.l.p.m.q.d.c.t.v.r.f.g.t.x"
},
{
"input": "YB",
"output": ".b"
},
{
"input": "fly",
"output": ".f.l"
},
{
"input": "YyyYYYyyYxdwdawdDAWDdaddYYYY",
"output": ".x.d.w.d.w.d.d.w.d.d.d.d"
}
] | 1,695,438,700
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 1
| 62
| 0
|
dict_vowel = ['A','O','Y','E','U','I',
'a','o','y','e','u','i']
word=input()
list_word=list(word)
list_result=[]
for index,item in enumerate(list_word):
if item not in dict_vowel:
list_result.append(item)
elif item.isupper() and item not in dict_vowel:
list_result.append(item.lower())
for index,item in enumerate(list_result):
list_result[index] = "."+item
print("".join(list_result))
|
Title: String Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya started to attend programming lessons. On the first lesson his task was to write a simple program. The program was supposed to do the following: in the given string, consisting if uppercase and lowercase Latin letters, it:
- deletes all the vowels, - inserts a character "." before each consonant, - replaces all uppercase consonants with corresponding lowercase ones.
Vowels are letters "A", "O", "Y", "E", "U", "I", and the rest are consonants. The program's input is exactly one string, it should return the output as a single string, resulting after the program's processing the initial string.
Help Petya cope with this easy task.
Input Specification:
The first line represents input string of Petya's program. This string only consists of uppercase and lowercase Latin letters and its length is from 1 to 100, inclusive.
Output Specification:
Print the resulting string. It is guaranteed that this string is not empty.
Demo Input:
['tour\n', 'Codeforces\n', 'aBAcAba\n']
Demo Output:
['.t.r\n', '.c.d.f.r.c.s\n', '.b.c.b\n']
Note:
none
|
```python
dict_vowel = ['A','O','Y','E','U','I',
'a','o','y','e','u','i']
word=input()
list_word=list(word)
list_result=[]
for index,item in enumerate(list_word):
if item not in dict_vowel:
list_result.append(item)
elif item.isupper() and item not in dict_vowel:
list_result.append(item.lower())
for index,item in enumerate(list_result):
list_result[index] = "."+item
print("".join(list_result))
```
| 0
|
|
807
|
A
|
Is it rated?
|
PROGRAMMING
| 900
|
[
"implementation",
"sortings"
] | null | null |
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
|
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
|
[
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] |
[
"rated\n",
"unrated\n",
"maybe\n"
] |
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
| 500
|
[
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,616,411,168
| 2,147,483,647
|
Python 3
|
WRONG_ANSWER
|
TESTS
| 5
| 61
| 307,200
|
import sys
input = sys.stdin.readline
import math
def inpit(): #int
return(int(input()))
def inplt(): #list
return(list(map(int,input().split())))
def inpstr(): #string
s = input()
return(list(s[:len(s) - 1]))
def inpspit(): #spaced intergers
return(map(int,input().split()))
import math
def lcm(a):
return abs(math.prod(a)) // math.gcd(*a)
n = inpit()
p,q =inpspit()
for i in range(1,n):
a,b = inpspit()
if(a != b):
print('rated')
exit()
elif(a > p and b >q and a == b ):
print('unrated')
exit()
p,q = a,b
print('maybe')
|
Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
|
```python
import sys
input = sys.stdin.readline
import math
def inpit(): #int
return(int(input()))
def inplt(): #list
return(list(map(int,input().split())))
def inpstr(): #string
s = input()
return(list(s[:len(s) - 1]))
def inpspit(): #spaced intergers
return(map(int,input().split()))
import math
def lcm(a):
return abs(math.prod(a)) // math.gcd(*a)
n = inpit()
p,q =inpspit()
for i in range(1,n):
a,b = inpspit()
if(a != b):
print('rated')
exit()
elif(a > p and b >q and a == b ):
print('unrated')
exit()
p,q = a,b
print('maybe')
```
| 0
|
|
688
|
A
|
Opponents
|
PROGRAMMING
| 800
|
[
"implementation"
] | null | null |
Arya has *n* opponents in the school. Each day he will fight with all opponents who are present this day. His opponents have some fighting plan that guarantees they will win, but implementing this plan requires presence of them all. That means if one day at least one of Arya's opponents is absent at the school, then Arya will beat all present opponents. Otherwise, if all opponents are present, then they will beat Arya.
For each opponent Arya knows his schedule — whether or not he is going to present on each particular day. Tell him the maximum number of consecutive days that he will beat all present opponents.
Note, that if some day there are no opponents present, Arya still considers he beats all the present opponents.
|
The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=100) — the number of opponents and the number of days, respectively.
The *i*-th of the following *d* lines contains a string of length *n* consisting of characters '0' and '1'. The *j*-th character of this string is '0' if the *j*-th opponent is going to be absent on the *i*-th day.
|
Print the only integer — the maximum number of consecutive days that Arya will beat all present opponents.
|
[
"2 2\n10\n00\n",
"4 1\n0100\n",
"4 5\n1101\n1111\n0110\n1011\n1111\n"
] |
[
"2\n",
"1\n",
"2\n"
] |
In the first and the second samples, Arya will beat all present opponents each of the *d* days.
In the third sample, Arya will beat his opponents on days 1, 3 and 4 and his opponents will beat him on days 2 and 5. Thus, the maximum number of consecutive winning days is 2, which happens on days 3 and 4.
| 500
|
[
{
"input": "2 2\n10\n00",
"output": "2"
},
{
"input": "4 1\n0100",
"output": "1"
},
{
"input": "4 5\n1101\n1111\n0110\n1011\n1111",
"output": "2"
},
{
"input": "3 2\n110\n110",
"output": "2"
},
{
"input": "10 6\n1111111111\n0100110101\n1111111111\n0000011010\n1111111111\n1111111111",
"output": "1"
},
{
"input": "10 10\n1111111111\n0001001000\n1111111111\n1111111111\n1111111111\n1000000100\n1111111111\n0000011100\n1111111111\n1111111111",
"output": "1"
},
{
"input": "10 10\n0000100011\n0100001111\n1111111111\n1100011111\n1111111111\n1000111000\n1111000010\n0111001001\n1101010110\n1111111111",
"output": "4"
},
{
"input": "10 10\n1100110010\n0000000001\n1011100111\n1111111111\n1111111111\n1111111111\n1100010110\n1111111111\n1001001010\n1111111111",
"output": "3"
},
{
"input": "10 7\n0000111001\n1111111111\n0110110001\n1111111111\n1111111111\n1000111100\n0110000111",
"output": "2"
},
{
"input": "5 10\n00110\n11000\n10010\n00010\n11110\n01101\n11111\n10001\n11111\n01001",
"output": "6"
},
{
"input": "5 9\n11111\n11101\n11111\n11111\n01010\n01010\n00000\n11111\n00111",
"output": "3"
},
{
"input": "5 10\n11111\n00010\n11010\n11111\n11111\n00100\n11111\n11111\n01000\n11111",
"output": "2"
},
{
"input": "5 9\n11111\n11111\n11111\n11111\n11100\n11111\n11111\n11111\n00000",
"output": "1"
},
{
"input": "5 8\n11111\n10110\n01001\n11111\n01100\n10010\n11111\n11111",
"output": "2"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "100 1\n0011001100100010000011001100000001011101110110010001110001101100110011111101001011011001000010001111",
"output": "1"
},
{
"input": "100 1\n1011011100000101000111110000110111010101110010010011110010001110100011001110110101111100100110000000",
"output": "1"
},
{
"input": "100 1\n1110000011110101010111111100011001100000101101010110100101110000011100110110110101011100110110010011",
"output": "1"
},
{
"input": "100 1\n1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111",
"output": "0"
},
{
"input": "1 100\n1\n0\n0\n0\n1\n1\n0\n0\n0\n0\n1\n1\n0\n1\n1\n0\n0\n1\n1\n1\n0\n0\n1\n1\n1\n1\n1\n0\n1\n0\n0\n0\n1\n1\n0\n1\n0\n1\n0\n0\n0\n1\n0\n1\n0\n0\n0\n1\n1\n1\n0\n1\n1\n1\n0\n1\n0\n1\n1\n1\n1\n0\n0\n0\n0\n0\n0\n1\n1\n0\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n0\n1\n0\n0\n1\n0\n0\n1\n0\n0\n1\n0\n1\n1\n1\n0\n1\n0\n0",
"output": "6"
},
{
"input": "1 100\n0\n0\n0\n0\n1\n0\n0\n0\n0\n1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "49"
},
{
"input": "1 100\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "0"
},
{
"input": "1 100\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "100"
},
{
"input": "2 2\n11\n10",
"output": "1"
},
{
"input": "1 1\n0",
"output": "1"
}
] | 1,647,848,006
| 2,147,483,647
|
Python 3
|
OK
|
TESTS
| 56
| 62
| 512,000
|
#!/usr/bin/env python
import math
import sys
import itertools
import fractions
if __name__ == '__main__':
wtf = sys.stdin.read()
wtf = wtf.strip().split('\n')
n,d = map(int, wtf[0].split())
ans = []
tmp = 0
for t in wtf[1:]:
if t == '1'*n:
ans.append(tmp)
tmp = 0
continue
tmp +=1
if tmp > 0:
ans.append(tmp)
print(max(ans))
|
Title: Opponents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arya has *n* opponents in the school. Each day he will fight with all opponents who are present this day. His opponents have some fighting plan that guarantees they will win, but implementing this plan requires presence of them all. That means if one day at least one of Arya's opponents is absent at the school, then Arya will beat all present opponents. Otherwise, if all opponents are present, then they will beat Arya.
For each opponent Arya knows his schedule — whether or not he is going to present on each particular day. Tell him the maximum number of consecutive days that he will beat all present opponents.
Note, that if some day there are no opponents present, Arya still considers he beats all the present opponents.
Input Specification:
The first line of the input contains two integers *n* and *d* (1<=≤<=*n*,<=*d*<=≤<=100) — the number of opponents and the number of days, respectively.
The *i*-th of the following *d* lines contains a string of length *n* consisting of characters '0' and '1'. The *j*-th character of this string is '0' if the *j*-th opponent is going to be absent on the *i*-th day.
Output Specification:
Print the only integer — the maximum number of consecutive days that Arya will beat all present opponents.
Demo Input:
['2 2\n10\n00\n', '4 1\n0100\n', '4 5\n1101\n1111\n0110\n1011\n1111\n']
Demo Output:
['2\n', '1\n', '2\n']
Note:
In the first and the second samples, Arya will beat all present opponents each of the *d* days.
In the third sample, Arya will beat his opponents on days 1, 3 and 4 and his opponents will beat him on days 2 and 5. Thus, the maximum number of consecutive winning days is 2, which happens on days 3 and 4.
|
```python
#!/usr/bin/env python
import math
import sys
import itertools
import fractions
if __name__ == '__main__':
wtf = sys.stdin.read()
wtf = wtf.strip().split('\n')
n,d = map(int, wtf[0].split())
ans = []
tmp = 0
for t in wtf[1:]:
if t == '1'*n:
ans.append(tmp)
tmp = 0
continue
tmp +=1
if tmp > 0:
ans.append(tmp)
print(max(ans))
```
| 3
|
Subsets and Splits
Successful Python Submissions
Retrieves all records from the train dataset where the verdict is 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Retrieves records of users with a rating of 1600 or higher and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a rating above 2000 and a verdict of 'OK', providing basic filtering but limited analytical value.
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.